RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] (113 letters) >d1ej5a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Score = 27.0 bits (60), Expect = 0.48 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 54 GDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRG 87 E LVGA +H +KRS + SS EDQ G Sbjct: 75 SQSSEGLVGALMHVM-QKRSRAIHSSDEGEDQAG 107 >d1h05a_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 144 Score = 23.7 bits (51), Expect = 5.1 Identities = 11/43 (25%), Positives = 20/43 (46%) Query: 12 VCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLG 54 LS + + S + A E+++ SY + +A V+ L G Sbjct: 88 CAELSAPLIEVHISNVHAREEFRRHSYLSPIATGVIVGLGIQG 130 >d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 179 Score = 23.5 bits (50), Expect = 5.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 75 DVPSSSNQEDQRGSPSPKKTKNILELF 101 DV + +N D GSP+ + + ELF Sbjct: 14 DVRNMNNISDTDGSPNDFTSIDTHELF 40 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0526 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 388,528 Number of extensions: 14797 Number of successful extensions: 15 Number of sequences better than 10.0: 1 Number of HSP's gapped: 15 Number of HSP's successfully gapped: 4 Length of query: 113 Length of database: 2,407,596 Length adjustment: 71 Effective length of query: 42 Effective length of database: 1,432,766 Effective search space: 60176172 Effective search space used: 60176172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.4 bits)