BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] (113 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780844|ref|YP_003065257.1| hypothetical protein CLIBASIA_03695 [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 231 bits (590), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL Sbjct: 1 MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQL 60 Query: 61 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF Sbjct: 61 VGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF 113 >gi|254781120|ref|YP_003065533.1| radical SAM protein [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 42 VALNVLSPLAPLGD--GCEQLVGATVHSEGKKRSHDV 76 + L VL + LGD GCE + G + S G+K S+ V Sbjct: 147 ILLQVLLARSLLGDFPGCEDIEGMVIPSVGRKISNIV 183 >gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Score = 23.1 bits (48), Expect = 1.3, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 31 EKYKAPSYPTTVALNVLSPLAPLGDG 56 E Y A A++VLS ++P G+G Sbjct: 344 ESYNANPASMKAAISVLSQISPHGEG 369 >gi|254780763|ref|YP_003065176.1| hypothetical protein CLIBASIA_03260 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 21.9 bits (45), Expect = 2.9, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 66 HSEGKKRSHDVPSSSNQEDQRGSPSP 91 HS+ K+ D+ ++ QE G P P Sbjct: 75 HSDAHKKIEDLVATKTQEITEGLPIP 100 >gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Score = 21.9 bits (45), Expect = 3.4, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 54 GDGCEQLVGATVHSEGKKR 72 G G L T+H+EG++R Sbjct: 37 GSGKSSLAFDTIHAEGQRR 55 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 21.2 bits (43), Expect = 6.0, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 6 ACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGA 63 + RN+ ++S+ C LF + ++ S P +A+ A L G + +G+ Sbjct: 581 SSRNISTRVVSVPCFELFFEQSDSYRAQIIGSSPIKIAIE-----AGLRQGWDAFIGS 633 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 20.8 bits (42), Expect = 7.2, Method: Composition-based stats. Identities = 6/16 (37%), Positives = 12/16 (75%) Query: 59 QLVGATVHSEGKKRSH 74 +++ ++ HS+GK SH Sbjct: 1693 KILSSSTHSKGKSSSH 1708 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,946 Number of Sequences: 1233 Number of extensions: 2674 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 113 length of database: 328,796 effective HSP length: 63 effective length of query: 50 effective length of database: 251,117 effective search space: 12555850 effective search space used: 12555850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)