HHsearch alignment for GI: 254780845 and conserved domain: PRK09101

>PRK09101 nrdB ribonucleotide-diphosphate reductase subunit beta; Reviewed.
Probab=100.00  E-value=0  Score=614.42  Aligned_cols=335  Identities=22%  Similarity=0.329  Sum_probs=303.2

Q ss_pred             HHCCCCCCCCHHHCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             000654578813374868899-8000178616799999999994579870367479899852026899899999999999
Q gi|254780845|r    9 PIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLG   87 (352)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~-~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~~l~   87 (352)
T Consensus         4 ~~fn~~~-~d~~~~p~F~G~~~~i~~~~~~kYp~~~~Lykkq~~~FW~PEEIdLs~D~~d~~~---Lt~~Ek~~f~~~L~   79 (376)
T PRK09101          4 TTFSQTK-NDQLKEPMFFGQSVNVARYDQQKYEIFEKLIEKQLSFFWRPEEVDVSRDRIDYQA---LPEHEKHIFISNLK   79 (376)
T ss_pred             EECCCCC-CCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHH---CCHHHHHHHHHHHH
T ss_conf             1106887-6300288427997442143201457999999999867898311223631999987---79999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99864333345566640133057799999999999999778999999997146469999999720018987788999997
Q gi|254780845|r   88 FFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQ  167 (352)
Q Consensus        88 ~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~~~~~~i~~k~~~~~~~~~  167 (352)
T Consensus        80 f~t~lDSiq~~n~~~~f~~~is~PE~~~~~~~q~~~E~IHs~SYs~Ii~t~~~dp~eiFd~i~~~~~i~kra~~i~~~yd  159 (376)
T PRK09101         80 YQTLLDSIQGRSPNVALLPLVSIPELETWIETWSFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEEILKRAEDISSYYD  159 (376)
T ss_pred             HHHHHHHHHHCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999853507677554679999999999999999999999999998628989999999847999999999999989


Q ss_pred             HHCCCHHH----------CC-------CCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             40121010----------26-------77740149999999974000144411478899899759801289999999856
Q gi|254780845|r  168 TLSSPSFT----------TG-------TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRD  230 (352)
Q Consensus       168 ~~~~~~~~----------~~-------~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RD  230 (352)
T Consensus       160 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~l~~al-va~~iLEgi~F~~~F~~~~~~~~~~~m~g~~~~~~~i~rD  238 (376)
T PRK09101        160 DLIEMTQYYHLLGEGTHTVNGKTVTVNLRELKKKLYLCL-MSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARD  238 (376)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             999887888751443101255411001688999999999-9999876899899999999998648884579999999971


Q ss_pred             HHHHHHHHHHHHHHHHH--HCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             66669999999997655--375422--067899999999999987688688751888-4799989999999999999999
Q gi|254780845|r  231 ESLHLNFGIDVINQIKI--ENPHLW--TKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCH  305 (352)
Q Consensus       231 E~lH~~f~~~l~~~l~~--E~p~l~--~~~~~~~i~~~~~eave~E~~~~~~~~~~~-~~Gl~~~~~~~yi~y~an~rL~  305 (352)
T Consensus       239 E~~Hl~~~~~ii~~l~~~~e~pe~~~~~~e~~~~v~~m~~~ave~E~~wa~ylf~~G~iiGLn~~~l~~Yi~ylan~Rl~  318 (376)
T PRK09101        239 EALHLTGTQHMLNLMRSGKDDPEMAEIAEECKQECYDLFVQAAEQEKEWADYLFKDGSMIGLNKDILCQYVEYITNIRMQ  318 (376)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99899999999999985389827889999999999999999999999999996669971688999999999999999999


Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             78879889998883257899717886-75557667112210586
Q gi|254780845|r  306 QIGLEPLFKYTENPFPWMSEVIDLKK-EKNFFETRVTEYQQGAE  348 (352)
Q Consensus       306 ~lG~~~~f~~~~nP~~W~~~~~~~~~-~tnFFe~~~t~Y~k~~~  348 (352)
T Consensus       319 ~lGl~~~y~~~~NPlpWm~~~~~~~~~q~a~qE~evtsY~~g~~  362 (376)
T PRK09101        319 AVGLDLPFQTRSNPIPWINTWLVSDNVQVAPQEVEVSSYLVGQI  362 (376)
T ss_pred             HCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEECC
T ss_conf             76999999999998458999865576746731201300112142