HHsearch alignment for GI: 254780845 and conserved domain: PRK12759

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional.
Probab=100.00  E-value=0  Score=644.85  Aligned_cols=308  Identities=27%  Similarity=0.478  Sum_probs=289.3

Q ss_pred             CCC--CCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             800--017861679999999999457987036747989985202689989999999999999864333345566640133
Q gi|254780845|r   30 DVN--QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRH  107 (352)
Q Consensus        30 ~~~--~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~~l~~~~~~D~~v~~~~~~~i~~~  107 (352)
T Consensus        94 ~~~~~tykP~~Yp~awe~ykk~~~~~Wt~eEIdL~~Dv~DW~~-~kLtd~Er~fIk~iLaFFA~sD~iV~eNl~~~f~~e  172 (410)
T PRK12759         94 TTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKN-GKITKVEKEYITNILRLFTQSDVAVGQNYYDQFIPL  172 (410)
T ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHHCCCHHHCCHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2115665784388999999999980797676465441887601-789979999999999999757999999999999987


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHHH
Q ss_conf             05779999999999999977899999999714646999999972001898778899999740121010267774014999
Q gi|254780845|r  108 LSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ  187 (352)
Q Consensus       108 ~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (352)
T Consensus       173 v~~pEar~fy~~Qa~~E~IHse~YslLidTl~~~d~e-f~a~~~~p~i~~K~~~~~~~~-------------~~~~~~~a  238 (410)
T PRK12759        173 FKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSE-YHAFLEYKAMTDKIDFMMDAD-------------PTTRRGLG  238 (410)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH-HHHHHHHHHHHHHHHHHHCCC-------------CCHHHHHH
T ss_conf             4789999999999999999999999999985698899-999998599998999984689-------------32788999


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999740001444114788998997598012899999998566666999999999765537542206789999999999
Q gi|254780845|r  188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE  267 (352)
Q Consensus       188 ~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l~~E~p~l~~~~~~~~i~~~~~e  267 (352)
T Consensus       239 ~~l~~~~f~EGifFsgSFa~I~~lkkrglMpGL~~sne~I~RDEglH~eFa~~Lf~~~~~e~p~i~~~~~~~~I~~ii~e  318 (410)
T PRK12759        239 LCLAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASK  318 (410)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHEEEECCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999847899999999997131688740131200011201336899999999997637120777899999999999


Q ss_pred             HHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             998768868875188847-9998999999999999999978879889998883257899717886755576671122105
Q gi|254780845|r  268 ATLLEIAYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQG  346 (352)
Q Consensus       268 ave~E~~~~~~~~~~~~~-Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~~~nP~~W~~~~~~~~~~tnFFe~~~t~Y~k~  346 (352)
T Consensus       319 AVeiE~~Fi~~alp~~~I~Gmn~~~m~qYIeyVADRlL~qLG~~kiy~~~~NPf~wMe~il~~~~ktNFFE~RVtEYqka  398 (410)
T PRK12759        319 AVELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVA  398 (410)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCHHHHHHC
T ss_conf             99999999997466677899899999999999999999986999878999998279999876755577567768877627


Q ss_pred             C-CCCCC
Q ss_conf             8-67789
Q gi|254780845|r  347 A-ELKWD  352 (352)
Q Consensus       347 ~-~~~~d  352 (352)
T Consensus       399 gv~g~wd  405 (410)
T PRK12759        399 GLTGSWD  405 (410)
T ss_pred             CCCCCHH
T ss_conf             7576488