HHsearch alignment for GI: 254780845 and conserved domain: cd01057

>cd01057 AAMH_A Aromatic and Alkene Monooxygenase Hydroxylase, subunit A, ferritin-like diiron-binding domain. Aromatic and Alkene Monooxygenase Hydroxylases, subunit A (AAMH_A). Subunit A of the soluble hydroxylase of multicomponent, aromatic and alkene monooxygenases are members of a superfamily of ferritin-like iron-storage proteins. AAMH exists as a hexamer (an alpha2-beta2-gamma2 homodimer) with each alpha-subunit housing one nonheme diiron center embedded in a four-helix bundle. The N-terminal domain of the alpha- and noncatalytic beta-subunits possess nearly identical folds, however, the beta-subunit lacks critical diiron ligands and a C-terminal domain found in the alpha-subunit. Methane monooxygenase is a multicomponent enzyme found in methanotrophic bacteria that catalyzes the hydroxylation of methane and higher alkenes (as large as octane). Phenol monooxygenase, found in a diverse group of bacteria, catalyses the hydroxylation of phenol, chloro- and methyl-phenol and naphtho
Probab=98.01  E-value=0.0017  Score=43.12  Aligned_cols=229  Identities=16%  Similarity=0.119  Sum_probs=129.2

Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             02689989999999999999864333345566640133057799999999999999778999999997146469999999
Q gi|254780845|r   70 SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMY  149 (352)
Q Consensus        70 t~~~Lt~~Ek~~~~~~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~  149 (352)
T Consensus        67 ~~~~~dpr~~~~~Kl~~~~i~~~EY~A~~~~-a~~~r~~~~~~~Rn~~~~q~lDE~RH~q~q~~~~~~y~k~~~-gf~~~  144 (465)
T cd01057          67 AYEKVDPRWVEAMKLFLGAITPGEYAAVRGM-AMLGRFAPAAELRNGYLMQMLDELRHTQIQLYLPHYYAKNYA-GFDWA  144 (465)
T ss_pred             CCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH-HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHH
T ss_conf             6544786899999999824888999999999-999873698899999887678888899999989998873087-76679


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             72001898778899999740121010267774014999999997400014441147889989975980128999999985
Q gi|254780845|r  150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMR  229 (352)
Q Consensus       150 ~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~R  229 (352)
T Consensus       145 ~~---~~~~~~~~~~~~~~f~d~-~~t--~-d~---~e~~i~l~f~fEt~fTNllFv~~~s~Aa~nGD~~~~t~~~SiQs  214 (465)
T cd01057         145 QK---AFHGNWYAGAAKRFFFDG-FIT--G-DA---VEAALALQFVFETAFTNLLFVALASDAAANGDYATPTVFLSIQS  214 (465)
T ss_pred             HH---HHHCCCHHHHHHHHHHHH-HHC--C-CH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCC
T ss_conf             99---860462477668886433-003--6-78---99999878778675101799870888987576375567777312


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CCC-HHHHHHHHHHHHHHHHHH
Q ss_conf             66666999999999765537542206789999999999998768868875188847--999-899999999999999997
Q gi|254780845|r  230 DESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFV--GLN-APSCEQYMQFIANRRCHQ  306 (352)
Q Consensus       230 DE~lH~~f~~~l~~~l~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~--Gl~-~~~~~~yi~y~an~rL~~  306 (352)
T Consensus       215 DEsRH~~~G~~~l~-~l~~d~~n-~~~lQ~~lD~aFWr~~r~~~~lvG~~mDY~tp~R~~S~kE~W~eWI~ed~g~~~~d  292 (465)
T cd01057         215 DEARHMANGYPTLV-LLENDPDN-VPLLQRDLDKAFWRQHRLFDALVGMLMDYGTPKRVMSWKEFWEEWIEEDFGSYFKD  292 (465)
T ss_pred             HHHHHHHCCHHHHH-HHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             27777643788999-99969543-69999999999999999999988777662788776459999999999999999988


Q ss_pred             C---CCCCC
Q ss_conf             8---87988
Q gi|254780845|r  307 I---GLEPL  312 (352)
Q Consensus       307 l---G~~~~  312 (352)
T Consensus       293 L~~yGLk~P  301 (465)
T cd01057         293 LEKYGLKKP  301 (465)
T ss_pred             HHHCCCCCC
T ss_conf             997379998