HHsearch results for GI: 254780845 and protein with PDBid: 2inc_B

>2inc_B Toluene, O-xylene monooxygenase oxygenase subunit; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: a.25.1.2 PDB: 2rdb_B* 1t0r_B 1t0s_B 1t0q_B* 2ind_B*
Probab=97.10  E-value=0.017  Score=34.86  Aligned_cols=209  Identities=10%  Similarity=-0.014  Sum_probs=136.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CH---HHHH
Q ss_conf             89989999999999999864333345566640133057799999999999999778999999997146---46---9999
Q gi|254780845|r   73 GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL---DE---GELF  146 (352)
Q Consensus        73 ~Lt~~Ek~~~~~~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~---~~---~e~f  146 (352)
                      .|++.-+.++...++-+...+-..+.+.. .+......+.++.+..+|++.|..|++-.+++...|..   +.   ..-=
T Consensus       105 ~l~~~w~~~l~~~l~p~r~~E~ga~~~~a-~~~r~~~~~~i~n~~~~qa~D~lR~aQ~~~~~~~~L~~~~~d~~~~~~~k  183 (322)
T 2inc_B          105 MLTREWVETLARFYTPARYLFHALQMGSV-YIHQIAPASTITNCATYETADHLRWLTHTAYRTRELANCYPDVGFGKRER  183 (322)
T ss_dssp             GSCHHHHHHHHHHTTTHHHHHHHHHHHHH-HHHHHCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCTTTSHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             08999999999987367699999998789-99986674999999999988898999999999999986389965016899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHH---HHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             999720018987788999997401210102677740149999999974000144---41147889989975980128999
Q gi|254780845|r  147 NMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW---FYTGFAQILSLGRANKMVGIAEQ  223 (352)
Q Consensus       147 ~~~~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~---Fys~Fa~~~~l~~~g~m~g~~~~  223 (352)
                      ..+.++|.-+.--    ++.+.+-.          -..-++..++.++++|+++   |++.|...  .+.+| =.-+..+
T Consensus       184 ~~W~~dp~wQ~~R----~~vE~~l~----------~~Dw~E~~vA~nlv~epl~~~l~~~~~~~~--A~~~G-D~~~~~l  246 (322)
T 2inc_B          184 DVWENDPAWQGFR----ELIEKALI----------AWDWGEAFTAINLVTKPAVEEALLQQLGSL--AQSEG-DTLLGLL  246 (322)
T ss_dssp             HHHHHCHHHHHHH----HHHHHHTT----------CCSHHHHHHHHHTTHHHHHHHHHTHHHHHH--HHHTT-CHHHHHH
T ss_pred             HHHHCCCHHHHHH----HHHHHHHH----------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHCC-CCHHHHH
T ss_conf             9881396058899----99998870----------035999999999989987469999999999--99869-9200999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99998566666999999999765537542206789999999999998768868875188847999899999999999999
Q gi|254780845|r  224 YQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR  303 (352)
Q Consensus       224 i~~I~RDE~lH~~f~~~l~~~l~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~r  303 (352)
                      +..+..|+..|...+..+++.+.+ .++ ...-++.++.+....|.+.=..++. +++.+      +..-.-.+-....+
T Consensus       247 ~~~~~~d~~r~~~w~~alvk~~~e-~~~-N~~ll~~W~~~W~~~a~~Al~~~~~-~~~~~------~~a~~~a~~a~~~~  317 (322)
T 2inc_B          247 AQAQKRDAERHRRWSSALVKMALE-KEG-NREVLQKWVAKWEPLADKAIEAYCS-ALPDG------ENAIVEAKSASRYV  317 (322)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTT-STT-HHHHHHHHHHHHHHHHHHHHHHHHH-HSTTH------HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC-CHH-HHHHHHHHHHHHHHHHHHHHHHHHH-HHCCC------HHHHHHHHHHHHHH
T ss_conf             998999999999999999999944-966-7999999999999999999998888-76144------15899999999999


Q ss_pred             HHHCC
Q ss_conf             99788
Q gi|254780845|r  304 CHQIG  308 (352)
Q Consensus       304 L~~lG  308 (352)
                      .+.||
T Consensus       318 ~~~~g  322 (322)
T 2inc_B          318 RQMMG  322 (322)
T ss_dssp             HHTTC
T ss_pred             HHHCC
T ss_conf             98549