HHsearch results for GI: 254780845 and protein with PDBid: 2inp_A

>2inp_A Phenol hydroxylase component PHN; DIIRON, four-helix bundle, regulatory protein, oxidoreductase; 2.30A {Pseudomonas stutzeri} PDB: 2inn_A
Probab=98.32  E-value=0.00025  Score=47.38  Aligned_cols=222  Identities=15%  Similarity=0.073  Sum_probs=140.8

Q ss_pred             CCC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH---HHHHHH
Q ss_conf             899-8999999999999986433334556664013305779999999999999977899999999714646---999999
Q gi|254780845|r   73 GLT-DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELFNM  148 (352)
Q Consensus        73 ~Lt-~~Ek~~~~~~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~---~e~f~~  148 (352)
                      +|+ +.-.++++..++.+..++-....+.. .+.+..+.++++.+..+|+..|..|++-=.+++..+..+-   ......
T Consensus        82 ~lsdp~w~~~Lk~~l~~~~~~Ey~a~~~~a-~~~r~a~~~~irn~~~~qa~DelRhaQ~~~~~~~~~~~~~~g~~~~~~~  160 (494)
T 2inp_A           82 NISDARYVNALKLFISGISPLEHAAFQGYS-KVGRQFSGAGARVACQMQAIDELRHSQTQQHAMSHYNKHFNGLHDGPHM  160 (494)
T ss_dssp             GSSCGGGHHHHHHHHHHTHHHHHHHHHHHH-HHHHHCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSSCTTHHHH
T ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHHHH-HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             379878999999997020389999999999-9987468889999999988899999999999998852146743167887


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             97200189877889999974012101026777401499999999740001444114788998997598012899999998
Q gi|254780845|r  149 YREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIM  228 (352)
Q Consensus       149 ~~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~  228 (352)
                      +.++|..+..-+++.+...           .    .-++.+++.++++|.++=-.-|..+...+..+-=.-+..++.-|.
T Consensus       161 w~~~p~~q~~R~~~E~~~t-----------a----D~~E~~valnlv~E~~ftnllfv~l~~~Aa~nGD~~tptl~~S~q  225 (494)
T 2inp_A          161 HDRVWYLSVPKSFFDDARS-----------A----GPFEFLTAISFSFEYVLTNLLFVPFMSGAAYNGDMATVTFGFSAQ  225 (494)
T ss_dssp             HTTSGGGHHHHHHHHHHHH-----------S----CHHHHHHHHTTCCCCCSHHHHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHC-----------C----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             3348088878999998751-----------4----689999999998998657999999999999877877799999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--CCCC-HHHHHHHHHHHHH---H
Q ss_conf             56666699999999976553754220678999999999999876886887518884--7999-8999999999999---9
Q gi|254780845|r  229 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF--VGLN-APSCEQYMQFIAN---R  302 (352)
Q Consensus       229 RDE~lH~~f~~~l~~~l~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~--~Gl~-~~~~~~yi~y~an---~  302 (352)
                      .||++|...|..+++.++++.|.- .+..+.++...+-.+..+= +.+-.+++-+.  -.++ ++..+.++.-...   +
T Consensus       226 sDe~RH~~~g~~llk~lle~~~~N-~~~lq~wld~wfWr~~~~~-~l~g~~mdY~~~~r~~s~ke~w~~w~ed~~g~~~~  303 (494)
T 2inp_A          226 SDEARHMTLGLEVIKFILEQHEDN-VPIVQRWIDKWFWRGFRLL-SLVSMMMDYMLPNKVMSWSEAWEVYYEQNGGALFK  303 (494)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCTTH-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHTCSSCSSCHHHHHHHHTTTHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHHH-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             999999998999999998558133-7999999999999999999-98887776068754435999999999999999999


Q ss_pred             HHHHCCCCCC
Q ss_conf             9997887988
Q gi|254780845|r  303 RCHQIGLEPL  312 (352)
Q Consensus       303 rL~~lG~~~~  312 (352)
                      +|...|+++.
T Consensus       304 ~L~~yGl~~P  313 (494)
T 2inp_A          304 DLERYGIRPP  313 (494)
T ss_dssp             HHGGGTCCCC
T ss_pred             HHHHHCCCCC
T ss_conf             9998089898