HHsearch results for GI: 254780845 and protein with PDBid: 2rcc_A

>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125}
Probab=100.00  E-value=0  Score=599.35  Aligned_cols=337  Identities=26%  Similarity=0.474  Sum_probs=305.2

Q ss_pred             CCCCCCCCHHCCCCCCCCHHHCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHH
Q ss_conf             98543641000654578813374868899-80001786167999999999945798703674798998520268998999
Q gi|254780845|r    1 MANNTGLSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER   79 (352)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek   79 (352)
                      |++.... +++++++..  .+++|++|++ +..+++|+||||+|++|++++++||+|+|||+++|++||++   ||++||
T Consensus         2 ~~~~~~~-~i~~~~~~n--~~~~i~~g~~~~~~~~~~ikY~~~~~~y~k~~~~fW~peEi~ls~D~~dw~~---Lt~~Er   75 (346)
T 2rcc_A            2 MEQLQKR-KIYDTTASN--ASTGILNGKSSNVLNWDDVRFSWAYPLYKNMLANFWTPFEINMSHDAKQFPT---LTETEQ   75 (346)
T ss_dssp             CCCCCCC-CSCCTTSCS--SCSCSBSCCCCSCCCTTSCSBTTHHHHHHHHHHTCCCGGGSCCHHHHHHGGG---SCHHHH
T ss_pred             CCHHCCC-CCCCCCCCC--CCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH---CCHHHH
T ss_conf             1110335-678999987--6688507997642324444768999999999877999423150410899987---999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH--HHHHHHHHHHHHHHH
Q ss_conf             999999999986433334556664013305779999999999999977899999999714646--999999972001898
Q gi|254780845|r   80 LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE--GELFNMYREVPSITA  157 (352)
Q Consensus        80 ~~~~~~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~--~e~f~~~~~~~~i~~  157 (352)
                      ++++++|++|+++|++|++.+ ..+.+.++.||+++++++|+++|+||+++||++++++++++  +++|+++.++|.+++
T Consensus        76 ~~~~~iL~~f~~~D~~~~~~~-~~~~~~~~~~E~~~~~~~~~~~E~iH~~sYs~il~~l~~~~~~~e~~~~~~~~~~i~~  154 (346)
T 2rcc_A           76 EAFKKIIGLLAFLDSVQTDYS-MRAAEYLTDSSLAALMSVLSFQEVVHNQSYSYVLSSLVPKATQDEIFEYWKHDDVLKE  154 (346)
T ss_dssp             HHHHHHHHHHHHTTTTCCCHH-HHHHTTBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHTCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999887752458-9999865699999999999999999999999999986477017999999987799998


Q ss_pred             HHHHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             77889999974012101026777401499999999740001444114788998997598012899999998566666999
Q gi|254780845|r  158 KANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF  237 (352)
Q Consensus       158 k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f  237 (352)
                      |++|+.++++....       .+.++.+++++ ++++++|||+|||||+++++|+++|+|+|++++|++|+|||++|+.|
T Consensus       155 k~~~~~~~~~~~~~-------~~~~~~~~~~l-v~~~~lEGi~f~ssFa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~~  226 (346)
T 2rcc_A          155 RNEFIIDGYEKFVD-------NPTPKTFLESI-VYDVILEGLNFYSGFAFFYNLARNQKMVSTSTMINYINRDEQLHVYL  226 (346)
T ss_dssp             HHHHHHHHHHHHHH-------SCCHHHHHHHH-HHHHHHHHTTTHHHHHHHHHHHHTTSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH-------CCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             77899999875510-------24578999999-99999889999988999999987088987899999998437688999


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC-C
Q ss_conf             999999765537542206789999999999998768868875188847999899999999999999997887988999-8
Q gi|254780845|r  238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY-T  316 (352)
Q Consensus       238 ~~~l~~~l~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~-~  316 (352)
                      ++.+++++++|+|+++++++.+++++++++||++|++|++++++.+++|||++++++||+|+||+||.+||++++|+. .
T Consensus       227 ~~~l~~~l~~e~~~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~e~~~~yi~y~an~~L~~lG~~~~f~~~~  306 (346)
T 2rcc_A          227 FTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWFRYIIGDKIPGINPEDMETYISFIANKRAVQLGMEKPYPEIK  306 (346)
T ss_dssp             HHHHHHHHHHHCGGGCSHHHHHHHHHHHHHHHHHHHHHHHHHTTTCSTTCCHHHHHHHHHHHHHHHHHHTTCCCSCTTCC
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999998762661025678999999999999999999999818776888899999999999999999779999998777


Q ss_pred             CCCHHHHHHHHCCCC-CCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             883257899717886-755576671122105867-789
Q gi|254780845|r  317 ENPFPWMSEVIDLKK-EKNFFETRVTEYQQGAEL-KWD  352 (352)
Q Consensus       317 ~nP~~W~~~~~~~~~-~tnFFe~~~t~Y~k~~~~-~~d  352 (352)
                      +||+|||++..++++ ++||||+|+|+|+|++.. +||
T Consensus       307 ~nP~~w~~~~~~~~~~~~nFFE~~~t~Y~k~~~~~~~D  344 (346)
T 2rcc_A          307 HNPMKWIRAYEDVNSGKSDFFEQKSRQYAKVSADNGFD  344 (346)
T ss_dssp             SCSCTTC-------------------------------
T ss_pred             CCCHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCC
T ss_conf             89588999864347652588889778753267778866