HHSEARCH alignment of GI: 254780845 and SCOP domain: d1mhyb_

Alignment
>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]}
Probab=97.76  E-value=0.0015  Score=40.31  Aligned_cols=230  Identities=11%  Similarity=0.032  Sum_probs=144.5

Q ss_pred             HHHHHHHHHHCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             4798998520268998999-999999999986433334556664013305779999999999999977899999999714
Q gi|254780845|r   61 MQDDLALWKSKNGLTDDER-LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG  139 (352)
Q Consensus        61 l~~D~~dw~t~~~Lt~~Ek-~~~~~~l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~  139 (352)
                      .-.....+.   +|++..+ +++...|+-+...+-....+.. .+......+.++.+..+|++.|..|++--+++...|+
T Consensus       119 ~~~~~~~~~---~l~p~w~~~~L~~~l~p~r~~E~ga~m~~a-~i~r~a~~~~i~n~~~fqa~DeLR~aQ~l~~~~~~L~  194 (383)
T d1mhyb_         119 AYSSEGSIR---TIDPYWRDEILNKYFGALLYSEYGLFNAHS-SVGRDCLSDTIRQTAVFAALDKVDNAQMIQMERLFIA  194 (383)
T ss_dssp             HHHHHTGGG---GSCHHHHHTTHHHHHHHHHHHHHHHHHHHH-HHHHHCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCC---CCCHHHHHHHHHHHHCCCCHHHHHHHHHHH-HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999669620---089999999999986131089999998889-9986467589999999998878889999999999987


Q ss_pred             C-----C--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHH---HHHHHHHHH
Q ss_conf             6-----4--69999999720018987788999997401210102677740149999999974000144---411478899
Q gi|254780845|r  140 L-----D--EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW---FYTGFAQIL  209 (352)
Q Consensus       140 ~-----~--~~e~f~~~~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~---Fys~Fa~~~  209 (352)
                      .     +  .++-=..+.++|.-+.--+++.+....             ...-.+.+++.++++|+++   +++.|..- 
T Consensus       195 ~~~~gf~~~~~~~k~~W~~dp~WQ~~R~~vE~~lva-------------~~Dw~E~~vA~NlV~e~ll~~L~~~~f~~~-  260 (383)
T d1mhyb_         195 KLVPGFDASTDVPKKIWTTDPIYSGARATVQEIWQG-------------VQDWNEILWAGHAVYDATFGQFARREFFQR-  260 (383)
T ss_dssp             HHSTTCCCCSHHHHHHHHHCGGGHHHHHHHHHHHHS-------------CCCHHHHHHHHHHTHHHHHHHHHHTTTHHH-
T ss_pred             HHCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHC-------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-
T ss_conf             746898705689988984488689999999988731-------------765999999998879986589999999999-


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CC
Q ss_conf             8997598012899999998566666999999999765537542---206789999999999998768868875188--84
Q gi|254780845|r  210 SLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL---WTKEFQQKSRTMLHEATLLEIAYAHETMPK--GF  284 (352)
Q Consensus       210 ~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l~~E~p~l---~~~~~~~~i~~~~~eave~E~~~~~~~~~~--~~  284 (352)
                       ++..+-=.-+...+..+..|+..|...+..+++.+..+.|+.   ....+..|+-+-...|.+.=..+. -+++.  .+
T Consensus       261 -~Aa~nGD~~t~~l~~s~q~D~~R~~~w~~alvk~~l~~d~e~~~~Nr~~lq~Wi~~W~~~a~~A~~~l~-pi~~~~p~~  338 (383)
T d1mhyb_         261 -LATVYGDTLTPFFTAQSQTYFQTTRGAIDDLFVYCLANDSEFGAHNRTFLNAWTEHYLASSVAALKDFV-GLYAKVEKV  338 (383)
T ss_dssp             -HHTTTTCSSHHHHHHHHHHHHHHHHHHHHHHHCCCCCTCTTTHHHHHHHHHHHHHHHHHHHHHHHHHHG-GGGGGSCCC
T ss_pred             -HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCC
T ss_conf             -999759705699999999899999999999999998469522155899999999999999999999867-876047754


Q ss_pred             CC-CCHHHH-HHHHHHHHHHHH---HHCCCC
Q ss_conf             79-998999-999999999999---978879
Q gi|254780845|r  285 VG-LNAPSC-EQYMQFIANRRC---HQIGLE  310 (352)
Q Consensus       285 ~G-l~~~~~-~~yi~y~an~rL---~~lG~~  310 (352)
                      -+ ...+.. ...-+.+++..+   +.||++
T Consensus       339 ~~~~~~~~~~~a~~rv~~~~~~~~a~~i~~~  369 (383)
T d1mhyb_         339 AGATDSAGVSEALQRVFGDWKIDYADKIGFR  369 (383)
T ss_dssp             TTTTSHHHHHHHHHHHHHHHHHHTHHHHTCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             4311057899999999998854331541765


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Methane monooxygenase hydrolase beta subunit
species: Methylosinus trichosporium [TaxId: 426]