HHSEARCH alignment of GI: 254780845 and SCOP domain: d1syya_

Alignment
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]}
Probab=100.00  E-value=0  Score=586.46  Aligned_cols=315  Identities=54%  Similarity=1.009  Sum_probs=302.8

Q ss_pred             CCHHCCCCCCCCHHHCCCCCCCC-CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             41000654578813374868899-80001786167999999999945798703674798998520268998999999999
Q gi|254780845|r    7 LSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN   85 (352)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~~   85 (352)
                      .+.+++|.++++..+|||++|++ |+++++|+||||+|++|++++++||+|+|||+++|++||++ ++|++.||++++++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~p~kYp~~~~~yk~~~~~fW~peEi~ls~D~~dw~~-~kL~~~e~~~~~~~   80 (317)
T d1syya_           2 ADILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELWKS-DRLSEDERRVILLN   80 (317)
T ss_dssp             CSSGGGGGGSCCGGGCCSSSCCSSCTTCCCSCCCHHHHHHHHHHHHTCCCGGGSCCHHHHHHHHS-SCSCHHHHHHHHHH
T ss_pred             CCHHHCCCCCCCCCCCEEECCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH-CCCCHHHHHHHHHH
T ss_conf             21321534456711140268998765551898777999999999976999510574013888865-88998999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998643333455666401330577999999999999997789999999971464699999997200189877889999
Q gi|254780845|r   86 LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQY  165 (352)
Q Consensus        86 l~~~~~~D~~v~~~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e~f~~~~~~~~i~~k~~~~~~~  165 (352)
                      |++|+.+|++|++++...+++.++.||+++++++|+++|+||++|||+++++++.|++|+|+++.++|.+++|++++.++
T Consensus        81 l~~~~~~d~~v~~~~~~~l~~~i~~pE~~~~~~~q~~~E~iH~~sYs~il~~l~~d~~e~~~~~~~~~~i~~k~~~~~~~  160 (317)
T d1syya_          81 LGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEI  160 (317)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHTTHHHHCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998886687540576401237859999999999999878999999999985677899999984299999999999997


Q ss_pred             HHHHCCCHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97401210102677740149999999974000144411478899899759801289999999856666699999999976
Q gi|254780845|r  166 TQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI  245 (352)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l  245 (352)
                      +....+........+..+.++.+++++++++||++|||||+++++|+++|+|+|+|++|++|+|||++|+.|++.+++++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lEgi~F~s~F~~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l  240 (317)
T d1syya_         161 TGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGI  240 (317)
T ss_dssp             TSGGGSTTCCSSSHHHHHHHHHHHHHHHTTTTTTHHHHHHHHHHHHHHTTSSHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             75311434344644339999999999999999999977999999987335421089998999811887866999999998


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             553754220678999999999999876886887518884799989999999999999999788798899988832578
Q gi|254780845|r  246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWM  323 (352)
Q Consensus       246 ~~E~p~l~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~~~nP~~W~  323 (352)
                      ++|+|++++++..+++++++++||++|++|++++++.|++|||++++++||+|+||+||.+||++|+|++ +||+|||
T Consensus       241 ~~e~~e~~~~~~~~~i~el~~eav~~E~~~~~~~~~~~~~Gl~~~~l~~Yv~y~an~~L~~LG~~~~f~~-~NP~~wm  317 (317)
T d1syya_         241 KEENPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIYHT-KNPFPWM  317 (317)
T ss_dssp             HHHCGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSCBTTBCHHHHHHHHHHHHHHHHHHTTCCCSSCC-CCSCTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCCCCC
T ss_conf             5505999863359999999999999999999998379878999999999999999999997799999989-9998979


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Chlamydia trachomatis [TaxId: 813]