HHSEARCH alignment of GI: 254780845 and SCOP domain: d1w68a_

Alignment
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=100.00  E-value=0  Score=502.54  Aligned_cols=278  Identities=29%  Similarity=0.553  Sum_probs=255.3

Q ss_pred             HHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13374868899800017861679999999999457987036747989985202689989999999999999864333345
Q gi|254780845|r   19 VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVAN   98 (352)
Q Consensus        19 ~~~~~~~~~~~~~~~l~p~kY~~~~~ly~k~~~~fW~peEi~l~~D~~dw~t~~~Lt~~Ek~~~~~~l~~~~~~D~~v~~   98 (352)
                      +.+++|++++++|++++|+||||+|++|++++++||+|+||||++|++||++   ||++||++++++|++|+++|++|++
T Consensus         1 ~~~e~~l~~~~~r~~~~PikY~~~~~~y~~~~~~fW~peEi~ls~D~~dw~~---L~~~Er~~~~~~l~~~~~~D~~v~~   77 (281)
T d1w68a_           1 VEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPDERHFISHVLAFFAASDGIVNE   77 (281)
T ss_dssp             CTTCTTTSCCGGGGCCCSCSCHHHHHHHHHHHHTCCCGGGSCCGGGHHHHHH---SCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCHHCCCHHHHHHHHH---CCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9988677789996455077677999999999876998131460611999985---9999999999999999835667764


Q ss_pred             HHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH
Q ss_conf             5666401330577999999999999997789999999971464699---9999972001898778899999740121010
Q gi|254780845|r   99 NIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFT  175 (352)
Q Consensus        99 ~~~~~i~~~~~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~~~~~e---~f~~~~~~~~i~~k~~~~~~~~~~~~~~~~~  175 (352)
                      ++...+.+.++.||+++++++|+++|+||++|||+++++++.++.+   .++++.+.+.+.+|..++..+...       
T Consensus        78 ~~~~~~~~~~~~~e~~~~~~~~~~~E~iH~~sYs~il~t~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------  150 (281)
T d1w68a_          78 NLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGD-------  150 (281)
T ss_dssp             HHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHTGGGTCHHHHHHHHHHHHHHHC-------
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-------
T ss_conf             3565332660669999999999999988788999999986033245788899999659999999999865102-------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             26777401499999999740001444114788998997598012899999998566666999999999765537542206
Q gi|254780845|r  176 TGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK  255 (352)
Q Consensus       176 ~~~~~~~~~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l~~E~p~l~~~  255 (352)
                           ....+..+ +++++++||++|||||+++++|+++|+|+|+|++|++|+|||++|+.|++.++++++.|.|     
T Consensus       151 -----~~~~~~~~-~v~~~~~Egi~f~s~F~~~~~~~~~g~m~g~~~~i~~I~rDE~~H~~~~~~l~~~l~~e~~-----  219 (281)
T d1w68a_         151 -----KEATYGER-VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPA-----  219 (281)
T ss_dssp             -----SSSCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCC-----
T ss_pred             -----CCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----
T ss_conf             -----21059999-9999999999999879999999862976147899999987678888899999875012203-----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             78999999999999876886887518884799989999999999999999788798899988832
Q gi|254780845|r  256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF  320 (352)
Q Consensus       256 ~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~~~nP~  320 (352)
                        .+++++++++||++|.+|++++++.+++|||.+++++||+|+||+||++||++|+|++ +||+
T Consensus       220 --~~~v~~~~~~av~lE~~~~~~~~~~~~~Gl~~~~~~~yi~y~an~rL~~lG~~~~f~~-~NPf  281 (281)
T d1w68a_         220 --EQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRV-ENPF  281 (281)
T ss_dssp             --HHHHHHHHHHHHHHHHHHHHTTSCGGGGTCCHHHHHHHHHHHHHHHHHHHTSCCSSCC-CCCC
T ss_pred             --HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCCC
T ss_conf             --8999999999999999999985778868989999999999999999997789998999-9958


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Mouse (Mus musculus) [TaxId: 10090]