HHSEARCH alignment of GI: 254780845 and SCOP domain: d1za0a1

Alignment
>d1za0a1 a.25.1.2 (A:8-274) Possible acyl-[acyl-carrier protein] desaturase {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=97.47  E-value=0.0035  Score=37.85  Aligned_cols=177  Identities=13%  Similarity=0.128  Sum_probs=95.7

Q ss_pred             HHHHHHHHHHH--HCCCCCCC-CCHHHH-------HHHHHH-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCC
Q ss_conf             79999999999--45798703-674798-------998520-26899899999999999998643333455666---401
Q gi|254780845|r   40 GWAWEKYLSAC--NNHWMPTE-VPMQDD-------LALWKS-KNGLTDDERLMIKRNLGFFASSESLVANNIVL---AIY  105 (352)
Q Consensus        40 ~~~~~ly~k~~--~~fW~peE-i~l~~D-------~~dw~t-~~~Lt~~Ek~~~~~~l~~~~~~D~~v~~~~~~---~i~  105 (352)
                      |++-+...++.  +.-|.|.+ +|-++.       ..+|.. .+.|++.-+..+.-        +.++-+|++.   .+.
T Consensus         9 ~~~e~~~~~hl~~~~~W~p~d~lP~~~~~~f~~~~~~~~~~~~~~l~~~~~~alv~--------~lltEdnLP~Y~~~l~   80 (267)
T d1za0a1           9 PVVEANMTRHLDTEDIWFAHDYVPFDQGENFAFLGGRDWDPSQSTLPRTITDACEI--------LLILKDNLAGHHRELV   80 (267)
T ss_dssp             HHHHHHHHHHHHTCCCCCGGGGCCGGGCCCCGGGTSCCCCGGGCCSCHHHHHHHHH--------HHHHHHC---------
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHH--------HHHCCCCCCHHHHHHH
T ss_conf             99999999861143222850249998898810147665996445575667878774--------1100357748999999


Q ss_pred             HHC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCH
Q ss_conf             330-5779999999999999977899999999714-64699999997200189877889999974012101026777401
Q gi|254780845|r  106 RHL-SNPECRQYLLRQAFEEAVHSHTFQYIITSLG-LDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ  183 (352)
Q Consensus       106 ~~~-~~~E~~~~l~~q~~~E~iH~~sYs~il~~l~-~~~~e~f~~~~~~~~i~~k~~~~~~~~~~~~~~~~~~~~~~~~~  183 (352)
                      ..+ ..+....+...|.++|+.|..+-...+..-+ .|+..+..         .+...+.+-++.            ...
T Consensus        81 ~~f~~d~~w~~wv~~WtaEEnrHg~aL~~YL~lsg~vDp~~~e~---------~~~~~~~~G~~~------------~~~  139 (267)
T d1za0a1          81 EHFILEDWWGRWLGRWTAEEHLHAIALREYLVVTREVDPVANED---------VRVQHVMKGYRA------------EKY  139 (267)
T ss_dssp             ------CHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSCTTTTTC---------TTC----------------------CC
T ss_pred             HHHCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHHHH---------HHHHHHHHCCCC------------CCC
T ss_conf             98055528999985155887558999999999951689157699---------999999853688------------987


Q ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             4999999997400014441147889989975980128999999985666669999999997655375
Q gi|254780845|r  184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP  250 (352)
Q Consensus       184 ~~~~~~i~~~~~lEGi~Fys~Fa~~~~l~~~g~m~g~~~~i~~I~RDE~lH~~f~~~l~~~l~~E~p  250 (352)
                      .-. ..++|.++-|-.-.    .+--++++.--=|-++++...|++||.+|..|...+++.+.+-+|
T Consensus       140 ~p~-~~l~y~~fqE~aT~----i~h~nla~~~~dPvL~~i~~rIA~DE~rH~~fy~~~v~~~le~dp  201 (267)
T d1za0a1         140 TQV-ETLVYMAFYERCGA----VFCRNLAAQIEEPILAGLIDRIARDEVRHEEFFANLVTHCLDYTR  201 (267)
T ss_dssp             CHH-HHHHHHHHHHHHHH----HHHHHHHHHCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSH
T ss_pred             CHH-HHHHHHHHHHHHHH----HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             667-89999999876899----999999987389799999999988899999999999999987592


SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Possible acyl-[acyl-carrier protein] desaturase
species: Mycobacterium tuberculosis [TaxId: 1773]