BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate
reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62]
         (352 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040522|gb|ACT57318.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040641|gb|ACT57437.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 352

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/352 (100%), Positives = 352/352 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID
Sbjct: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA
Sbjct: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
Sbjct: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352


>gi|315122301|ref|YP_004062790.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495703|gb|ADR52302.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 372

 Score =  601 bits (1549), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 276/352 (78%), Positives = 313/352 (88%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A+  GL PIQ G  R++ D+KRM+NARSDVNQLLPLKY WAWEKYL  CNNHWMPTEV 
Sbjct: 21  IADTVGLGPIQKGSARIHADEKRMINARSDVNQLLPLKYKWAWEKYLFGCNNHWMPTEVS 80

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQ D+ALW+SKNGLT+DER MIKRNLGFFA+SESLVANNIVLAIYRH+SNPECRQYLLRQ
Sbjct: 81  MQADIALWQSKNGLTNDERHMIKRNLGFFATSESLVANNIVLAIYRHISNPECRQYLLRQ 140

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVH+HTFQYI+ SL L+EGELFNMYRE+PSIT KA+WAL+YT+ L+S SF+TGT D
Sbjct: 141 AFEEAVHTHTFQYIVESLSLNEGELFNMYREIPSITNKASWALRYTKNLNSTSFSTGTDD 200

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYIMRDES+HLNFGID
Sbjct: 201 RDQDFLRDLIAFYVVFEGMWFYTGFAQILSLGRYNKMVGIAEQYQYIMRDESVHLNFGID 260

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT++FQQ+ R ML EA LLE+AY  +TMPK F+G+NA  CE+YM FI 
Sbjct: 261 MINQIKIENPHLWTEDFQQEVRKMLQEAALLEVAYGKDTMPKPFLGINANLCEKYMYFIT 320

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+P+F+ TENPFPWMSEVIDL+KEKNFFETRVTEYQ+G  L WD
Sbjct: 321 NRRCTQIGLDPVFEKTENPFPWMSEVIDLQKEKNFFETRVTEYQKGTSLDWD 372


>gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida
           fusca YX]
 gi|71917133|gb|AAZ57035.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
          Length = 354

 Score =  594 bits (1532), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 274/351 (78%), Positives = 309/351 (88%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            N TGL  IQ+G  RV+V+DKRM+N+R+DVNQLLPLKY WAWEKYL+ACNNHWMPTEV M
Sbjct: 4   VNTTGLGEIQSGAARVDVEDKRMINSRADVNQLLPLKYRWAWEKYLAACNNHWMPTEVSM 63

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKSK+GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YRHL+NPECRQYLLRQA
Sbjct: 64  QADIALWKSKDGLTEDERLMVKRNLGFFATAESLVANNIVLAVYRHLTNPECRQYLLRQA 123

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI  SLGLDEGELFNMYREVPSITAK  WAL+YT+ L +P+FTTGT +A
Sbjct: 124 FEEAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALRYTRNLENPNFTTGTPEA 183

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVV EGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 184 DQAFLRDLVAFYVVLEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 243

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLWT+EFQ + RTML EA  LE AY  ETMP+G +GLNA  CEQYM+FI +
Sbjct: 244 INQIKIENPHLWTEEFQDEVRTMLIEACELEAAYGRETMPRGILGLNAKLCEQYMRFITD 303

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  Q+GL P+F  TENPFPWMSE++DLKKEKNFFETRV EYQ G+ L WD
Sbjct: 304 RRAEQLGLAPIFGETENPFPWMSEMMDLKKEKNFFETRVIEYQTGSGLSWD 354


>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium
           sp. BNC1]
 gi|110286020|gb|ABG64079.1| ribonucleotide reductase [Chelativorans sp. BNC1]
          Length = 369

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/348 (78%), Positives = 303/348 (87%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I+ G  RV+VDDKRM+NAR+DVNQLLPLKY WAWEKYLS CNNHWMPTEV MQ D
Sbjct: 22  TGLGTIERGAGRVSVDDKRMINARADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSMQAD 81

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS++GLT+DER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFEE
Sbjct: 82  IALWKSRDGLTEDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFEE 141

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL+YT+ L  P+F TGT +ADQ 
Sbjct: 142 AVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALEYTRHLDDPNFRTGTPEADQA 201

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 202 FLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 261

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK ENPHLWT EFQ++ R ML +A  LE AY  +TMP+GF+GLNA  CEQYM FIANRRC
Sbjct: 262 IKHENPHLWTPEFQEELRRMLKDAAELEAAYGRDTMPRGFLGLNAGQCEQYMHFIANRRC 321

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 322 AQLGLPPVFPETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWD 369


>gi|209885874|ref|YP_002289731.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874070|gb|ACI93866.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
          Length = 377

 Score =  587 bits (1513), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/351 (77%), Positives = 299/351 (85%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A  TGL  I     RV+VD+KRM+N R+DVNQLLPLKY WAWEKYLS CNNHWMPTEV M
Sbjct: 27  AEQTGLGEIDRTGGRVSVDEKRMINCRADVNQLLPLKYKWAWEKYLSGCNNHWMPTEVSM 86

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 87  QADIALWKSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 146

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +A
Sbjct: 147 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTKNLDDPDFKTGTLEA 206

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 207 DQAFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 266

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK+ENPHLWTK FQ + R M+ EA  LE AY  +TMP+GF+GLNA  CEQYM FIAN
Sbjct: 267 INQIKLENPHLWTKAFQDEVRGMISEAAGLEAAYGRDTMPRGFLGLNAALCEQYMHFIAN 326

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 327 RRCAQIGLAPVFAETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWD 377


>gi|92119123|ref|YP_578852.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           hamburgensis X14]
 gi|91802017|gb|ABE64392.1| Ribonucleoside-diphosphate reductase [Nitrobacter hamburgensis X14]
          Length = 416

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 270/348 (77%), Positives = 296/348 (85%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I     RV VDDKRM+NAR+DVNQLLPLKYGWAWEKYLS CNNHWMPTEV MQ D
Sbjct: 69  TGLGAIDRSGGRVRVDDKRMINARADVNQLLPLKYGWAWEKYLSGCNNHWMPTEVSMQAD 128

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKSK+GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFEE
Sbjct: 129 IALWKSKDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFEE 188

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI+ SLGLDEGELFNMYREV SIT KA WAL++T+ L  P F TGT +ADQ 
Sbjct: 189 AVHTHTFQYIVESLGLDEGELFNMYREVSSITDKAAWALKHTRHLDDPGFKTGTPEADQA 248

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYVVFEGMWFYTGF QILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 249 FLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 308

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW+K FQ++ R ML  A  LE AY  +TMP+GF+GLNA  CEQYM  IANRRC
Sbjct: 309 IKIENPHLWSKPFQEEVRAMLKNAAELEAAYGRDTMPRGFLGLNAALCEQYMHVIANRRC 368

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL P+F   +NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 AQLGLAPVFAEADNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 416


>gi|85714830|ref|ZP_01045816.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
 gi|85698316|gb|EAQ36187.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
          Length = 389

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 270/351 (76%), Positives = 297/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A+ TGL  I  G  RV VDDKRM+NAR+DVNQLLP KY WAWEKYLS CNNHWMPTEV M
Sbjct: 39  ADATGLGDIDRGAARVRVDDKRMINARADVNQLLPFKYRWAWEKYLSGCNNHWMPTEVSM 98

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS++GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 99  QADIALWKSRDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 158

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +A
Sbjct: 159 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTRHLDDPGFKTGTPEA 218

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGF QILSLGR NKM+GIAEQYQYI+RDES+HLNFGIDV
Sbjct: 219 DQAFLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMIGIAEQYQYILRDESIHLNFGIDV 278

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLWTK FQ + R ML  A  LE AY  +TMP+GF+GLNA  CE YM  IAN
Sbjct: 279 INQIKIENPHLWTKTFQDEVRAMLKNAAELEAAYGRDTMPRGFLGLNAALCETYMHVIAN 338

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+F  T+NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 339 RRCAQLGLAPVFAETDNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 389


>gi|226227154|ref|YP_002761260.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
 gi|226090345|dbj|BAH38790.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
          Length = 371

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/348 (77%), Positives = 297/348 (85%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I     RV VDDK M+N R+DVNQLLPLKY WAWEKYLS CNNHWMPTEV MQ D
Sbjct: 24  TGLGEIDRHGGRVRVDDKAMINCRADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSMQAD 83

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           LA+W+S++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFEE
Sbjct: 84  LAIWRSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFEE 143

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+HTFQYI  SLGLDEGELFNMYREVPSITAKA WAL+YTQ L+ P F+TGT + DQ 
Sbjct: 144 AIHTHTFQYICESLGLDEGELFNMYREVPSITAKAAWALKYTQHLADPGFSTGTPETDQA 203

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 204 FLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 263

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLW+  FQ++ R ML EA  LE+AY  +TMP+GF+GLNA  CE YM FI NRRC
Sbjct: 264 IKVENPHLWSAAFQEEVRQMLAEACELEVAYGRDTMPRGFLGLNAALCETYMHFITNRRC 323

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL P+F  T+NPFPWMSE IDLKKEKNFFETRV EYQ G  LKWD
Sbjct: 324 AQLGLAPVFPETDNPFPWMSEAIDLKKEKNFFETRVIEYQNGGALKWD 371


>gi|299134880|ref|ZP_07028072.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
 gi|298590690|gb|EFI50893.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
          Length = 373

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 269/348 (77%), Positives = 300/348 (86%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I     RV+VD+KRM+N R+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV MQ D
Sbjct: 26  TGLGAIDRSGGRVSVDEKRMINCRADVNQLLPLKYKWAWEKYLAGCNNHWMPTEVSMQAD 85

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFEE
Sbjct: 86  IALWKSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFEE 145

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++TQ L +P F+TGT++ADQ 
Sbjct: 146 AVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTQNLDNPDFSTGTQEADQS 205

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 206 FLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 265

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+EN HLWTK FQ+  R M+ +A  LE AY  +TMP+GF+GLNA  CEQYM FIANRRC
Sbjct: 266 IKLENQHLWTKAFQEDVRGMIRDAAELEAAYGRDTMPRGFLGLNAALCEQYMHFIANRRC 325

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L W+
Sbjct: 326 AQIGLTPVFPETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWE 373


>gi|75677068|ref|YP_319489.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           winogradskyi Nb-255]
 gi|74421938|gb|ABA06137.1| ribonucleotide reductase [Nitrobacter winogradskyi Nb-255]
          Length = 391

 Score =  580 bits (1496), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 295/348 (84%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  I  G  RV VDDKRM+NAR+DVNQLLPLKY WAWEKYLS CNNHWMPTEV MQ D
Sbjct: 44  AGLGDIDRGGARVRVDDKRMINARADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSMQAD 103

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKSK+GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFEE
Sbjct: 104 IALWKSKDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFEE 163

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +ADQ 
Sbjct: 164 AVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTRHLDDPGFKTGTPEADQA 223

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYVVFEGMWFYTGF QILSLGR NKMVGIAEQYQYI+RDES+HLNFGID+INQ
Sbjct: 224 FLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDIINQ 283

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW+K FQ++ R ML  A  LE AY  +TMP+GF+GLNA  CE YM  IANRRC
Sbjct: 284 IKIENPHLWSKPFQEEVRAMLKNAADLEAAYGRDTMPRGFLGLNATLCETYMHVIANRRC 343

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL P+F   +NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 344 AQLGLAPVFPDADNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 391


>gi|297563527|ref|YP_003682501.1| ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296847975|gb|ADH69995.1| Ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 360

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 301/348 (86%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           +GL  I+   +RVNVDDK M+NAR+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV MQ D
Sbjct: 13  SGLGEIERDAERVNVDDKAMINARADVNQLLPLKYTWAWEKYLAGCNNHWMPTEVAMQAD 72

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS++GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YR L+NPECRQYLLRQAFEE
Sbjct: 73  IALWKSRDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLTNPECRQYLLRQAFEE 132

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI  SLGLDEGELFNMYREVPSITAK  WAL+YTQ L +P F TGT +ADQ 
Sbjct: 133 AVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALKYTQNLENPEFRTGTPEADQA 192

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 193 FLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 252

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW++EFQ + R ML EA  LE+AY  ETMP+G +GLNA  CE+YM FI +RR 
Sbjct: 253 IKIENPHLWSEEFQAEVRQMLTEACELEVAYGRETMPRGVLGLNAELCEKYMHFITDRRA 312

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL P+F  TENPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 313 EQIGLAPIFGETENPFPWMSEMMDLQKEKNFFETRVIEYQTGGGLDWD 360


>gi|90425007|ref|YP_533377.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris BisB18]
 gi|90107021|gb|ABD89058.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 386

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 265/350 (75%), Positives = 297/350 (84%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I     RV++DDK M+N R+DVNQLLPLK+ WAWEKYL+ACNNHWMPTEV MQ
Sbjct: 37  DATGLGAIDRSGARVSIDDKAMINCRADVNQLLPLKHRWAWEKYLAACNNHWMPTEVSMQ 96

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW S++GLT+DER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAF
Sbjct: 97  ADIALWTSRDGLTEDERRAIKRNLGFFATSESLVANNIVLAIYRHLTNPECRQYLLRQAF 156

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++TQ L  P+F TGT +AD
Sbjct: 157 EEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTQHLDDPTFATGTVEAD 216

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           + FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 217 RAFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVI 276

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENP LWT  FQ++ R ML EA  LE AY+ +TMP+GF+GLNA  CEQYM FI NR
Sbjct: 277 NQIKIENPKLWTAGFQEELRGMLQEAAELEAAYSRDTMPRGFLGLNAALCEQYMHFITNR 336

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL P+F   ENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 337 RCAQLGLAPIFAEVENPFPWMSETMDLKKEKNFFETRVIEYQNGGALTWD 386


>gi|134097869|ref|YP_001103530.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007412|ref|ZP_06565385.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133910492|emb|CAM00605.1| ribonucleoside-diphosphate reductase, beta subunit
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 360

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 261/349 (74%), Positives = 300/349 (85%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           ++GL  I     RV+V +K M+N+R+DVNQLLPLKYGWAWEKYL+ CNNHWMPTEV MQ 
Sbjct: 12  SSGLGEIDRDGGRVDVAEKAMINSRADVNQLLPLKYGWAWEKYLAGCNNHWMPTEVSMQA 71

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWKS++GLTDDER+M+KRNLGFFA++ESLVANNIVLA+YRH++NPECRQYLLRQAFE
Sbjct: 72  DIALWKSRDGLTDDERMMLKRNLGFFATAESLVANNIVLAVYRHITNPECRQYLLRQAFE 131

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EAVH+HTFQYI  SLGLDEGELFNMYRE+PSI+ K  WAL+YTQ L +P F  GT +ADQ
Sbjct: 132 EAVHTHTFQYICESLGLDEGELFNMYREIPSISDKDAWALRYTQNLENPDFEIGTPEADQ 191

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID IN
Sbjct: 192 AFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDCIN 251

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EFQ++ RTML EA  LE+AY  +TMP+G +GLNA  CE+YM+FI NRR
Sbjct: 252 QIKIENPHLWTPEFQEEVRTMLTEACELEVAYGRDTMPRGILGLNAGLCEEYMRFITNRR 311

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C Q+GLEP+F  T NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 312 CAQLGLEPVFPETANPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 360


>gi|256377255|ref|YP_003100915.1| ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
 gi|255921558|gb|ACU37069.1| Ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
          Length = 358

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 265/347 (76%), Positives = 296/347 (85%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  I+ G  RV+VDDK M+NAR+DVNQLLPLKY WAWEKYL+ C NHWMPTEV MQ D+
Sbjct: 12  GLGEIERGAGRVHVDDKAMINARADVNQLLPLKYHWAWEKYLAGCANHWMPTEVSMQADI 71

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALW+S NGLT DER  IKRNLGFFA+SESLVANN+VLA+YR+++NPECRQYLLRQAFEEA
Sbjct: 72  ALWRSPNGLTADERHAIKRNLGFFATSESLVANNVVLAVYRNITNPECRQYLLRQAFEEA 131

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+HTF+YI +SLGLDEGELFNMYREVPSIT KA WAL+YT++L  P F TGT +ADQ F
Sbjct: 132 VHTHTFEYICSSLGLDEGELFNMYREVPSITDKAAWALKYTKSLEDPEFRTGTPEADQAF 191

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID INQI
Sbjct: 192 LRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDAINQI 251

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW + FQ + RTML EA  LEIAY  +TMP G +GLNA  CEQYM+FI NRRC 
Sbjct: 252 KIENPHLWGEAFQAEVRTMLAEACELEIAYGRDTMPNGLLGLNAELCEQYMRFITNRRCA 311

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GLEP+F  TENPFPWMSE +DLKKEKNFFETRVTEY  G  L WD
Sbjct: 312 QLGLEPVFAATENPFPWMSEAVDLKKEKNFFETRVTEYASGGTLDWD 358


>gi|257055668|ref|YP_003133500.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
 gi|256585540|gb|ACU96673.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
          Length = 349

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 261/340 (76%), Positives = 298/340 (87%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RVNVDDK M+NAR+DVNQLLP+KYGWAWEKYL+ C+NHWMPTEV MQ D+ALWKS +
Sbjct: 10  GAARVNVDDKAMINARADVNQLLPMKYGWAWEKYLAGCDNHWMPTEVSMQADIALWKSPD 69

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLTDDERLM+KRNLGFFA++ESLVANN+VLA+YRHL+NPECRQYLLRQAFEEAVH+HTFQ
Sbjct: 70  GLTDDERLMLKRNLGFFATAESLVANNLVLAVYRHLTNPECRQYLLRQAFEEAVHTHTFQ 129

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI  SLGLDEGELFN YREVPSI  K +WAL+YT+ L  P+FTTGT +ADQEFL+DL  F
Sbjct: 130 YICVSLGLDEGELFNAYREVPSIANKDSWALRYTRNLEDPNFTTGTMEADQEFLRDLVAF 189

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           YVVFEGMWFYTGFAQ+LSLGR NKMVGIAEQYQYI+RDES+HLNFG+D INQIK ENPHL
Sbjct: 190 YVVFEGMWFYTGFAQVLSLGRRNKMVGIAEQYQYILRDESIHLNFGVDCINQIKAENPHL 249

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EFQQ+ R ML EA  LE+AYAH+TMP+  +GL+A  CEQYM FI +RR  Q+GL+P+
Sbjct: 250 WTPEFQQQVRDMLVEACELEVAYAHDTMPRPMLGLSAELCEQYMHFITDRRAAQLGLDPV 309

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F   ENPFPWMSEVIDL+KEKNFFETRVT+Y+ GA L WD
Sbjct: 310 FGERENPFPWMSEVIDLRKEKNFFETRVTDYRSGAALAWD 349


>gi|192291019|ref|YP_001991624.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris TIE-1]
 gi|192284768|gb|ACF01149.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           TIE-1]
          Length = 373

 Score =  571 bits (1471), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 290/350 (82%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I  G  RV VDDKRM+NAR+DVNQLLPLKY WAWEKYL+ACNNHWMPTEV MQ
Sbjct: 24  DTTGLGTIDRGAARVRVDDKRMINARADVNQLLPLKYHWAWEKYLAACNNHWMPTEVSMQ 83

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWKS++GLT+DER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAF
Sbjct: 84  ADIALWKSRDGLTEDERHMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAF 143

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL YT+ L  P F TGT   D
Sbjct: 144 EEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALDYTKHLDDPHFETGTPATD 203

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL DL  FYVVFEGMWFYTGFAQILSLGR  KM GIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 204 QAFLLDLIAFYVVFEGMWFYTGFAQILSLGRRQKMTGIAEQYQYILRDESIHLNFGIDVI 263

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIK+EN  +WT  FQ   R M+H+A  LE AY  +TMP G +GLNA  CE YM FIANR
Sbjct: 264 NQIKLENAAVWTASFQDDIRGMIHDAAELEAAYGRDTMPHGLLGLNAALCESYMHFIANR 323

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL P+F  T+NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 324 RCVQLGLRPVFAETDNPFPWMSETMDLKKEKNFFETRVIEYQNGGALDWD 373


>gi|300784783|ref|YP_003765074.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
 gi|299794297|gb|ADJ44672.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
          Length = 357

 Score =  571 bits (1471), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 261/348 (75%), Positives = 296/348 (85%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I+ G  R+NVDDKRM+NAR+DVNQLLP+KY WAWEKYL+ CNNHWMPTEV MQ D
Sbjct: 10  TGLGEIEVGAARINVDDKRMINARADVNQLLPMKYKWAWEKYLAGCNNHWMPTEVAMQAD 69

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS +GLT+DER M+KRNLGFFA++ESLVANNIVLA+YR ++NPECRQYLLRQAFEE
Sbjct: 70  IALWKSPDGLTEDERQMLKRNLGFFATAESLVANNIVLAVYRQITNPECRQYLLRQAFEE 129

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI  SLGL EGELFNMYREVPSI+ K  WAL+YTQ L +P F TGT +ADQ 
Sbjct: 130 AVHTHTFQYICESLGLVEGELFNMYREVPSISDKDAWALKYTQNLENPDFETGTPEADQA 189

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID INQ
Sbjct: 190 FLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDCINQ 249

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT+EFQ + R ML EA  LE+ YA +TMP+G +GL+A  CEQYM F+ +RR 
Sbjct: 250 IKIENPHLWTEEFQAEVRGMLKEACELEVKYARDTMPRGMLGLSAQLCEQYMHFVTDRRA 309

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 310 QQIGLAPIFGETENPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 357


>gi|302525965|ref|ZP_07278307.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
 gi|302434860|gb|EFL06676.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
          Length = 357

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 260/348 (74%), Positives = 296/348 (85%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I+ G  R+NVDDKRM+NAR+DVNQLLP+KY WAW+KYL+ACNNHWMPTEV MQ D
Sbjct: 10  TGLGEIEVGAARINVDDKRMINARADVNQLLPMKYRWAWDKYLAACNNHWMPTEVAMQAD 69

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS +GLT+DER M+KRNLGFFA++ESLVANNIVLA+YR ++NPECRQYLLRQAFEE
Sbjct: 70  IALWKSPDGLTEDERQMLKRNLGFFATAESLVANNIVLAVYRQITNPECRQYLLRQAFEE 129

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI  SLGL EGELFNMYREVPSI+ K  WAL+YTQ L +P F TGT +ADQ 
Sbjct: 130 AVHTHTFQYICESLGLVEGELFNMYREVPSISDKDAWALKYTQNLENPDFETGTPEADQA 189

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID INQ
Sbjct: 190 FLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDCINQ 249

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT+EFQ + R ML EA  LE+ YA +TMP+G +GL+A  CEQYM FI +RR 
Sbjct: 250 IKIENPHLWTEEFQAEVRGMLQEACELEVKYARDTMPRGMLGLSADLCEQYMHFITDRRA 309

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL P++   ENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 310 QQIGLPPIYGENENPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 357


>gi|300022335|ref|YP_003754946.1| ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524156|gb|ADJ22625.1| Ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 374

 Score =  567 bits (1461), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 293/348 (84%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I     RV VDDK M+NAR+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV MQ D
Sbjct: 27  TGLGNIDRNGGRVRVDDKAMINARADVNQLLPLKYRWAWEKYLAGCNNHWMPTEVSMQAD 86

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKSK+GLT++ER MIKRNLGFFA+SESLVANNIVLAIYR+L+NPECRQYLLRQAFEE
Sbjct: 87  IALWKSKDGLTEEERRMIKRNLGFFAASESLVANNIVLAIYRNLTNPECRQYLLRQAFEE 146

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           AVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL YT+ L  PSF TGTK+ DQ 
Sbjct: 147 AVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALAYTKHLDDPSFKTGTKETDQA 206

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVINQ
Sbjct: 207 FLRDLIAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQ 266

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK EN HLW+K FQ + R ML +A  LE AY  +TMP G +GLN    EQYM+FIANRRC
Sbjct: 267 IKAENAHLWSKAFQDEVRGMLRDAAQLEAAYGRDTMPTGLLGLNPGLTEQYMEFIANRRC 326

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL P+FK  ENPFPWMSE +DLKKEKNFFETRV EYQ G  L W+
Sbjct: 327 AQLGLTPVFKDRENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWE 374


>gi|324998522|ref|ZP_08119634.1| ribonucleoside-diphosphate reductase beta chain [Pseudonocardia sp.
           P1]
          Length = 358

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 254/350 (72%), Positives = 298/350 (85%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I  G   ++ DDKRM+NAR+DVNQLLPLKY WAW+KYL+ C+NHWMPTEV MQ
Sbjct: 9   DTTGLGEIDRGAAPIDADDKRMINARADVNQLLPLKYHWAWDKYLAGCSNHWMPTEVAMQ 68

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW+S++GLTDDERLM+ RNLGFFA++ESLVANN+VLA+YRHL+NPECRQYLLRQ+F
Sbjct: 69  ADIALWRSRDGLTDDERLMLTRNLGFFATAESLVANNVVLAVYRHLTNPECRQYLLRQSF 128

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQY+  SLGLDEGELFN YR+VPSIT K  WAL+YTQ LS P F TGT + D
Sbjct: 129 EEAVHTHTFQYVCESLGLDEGELFNAYRQVPSITDKDAWALRYTQALSDPDFCTGTPEND 188

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           + FL+DL  FYVVFEGMWFYTGFAQIL+LGR NKMVG+AEQYQYI+RDES+HLNFGID I
Sbjct: 189 RAFLRDLVAFYVVFEGMWFYTGFAQILALGRRNKMVGVAEQYQYILRDESIHLNFGIDCI 248

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENPHLWT+EF  + R MLHEA  LE+AYA +TMP+G +GL A SCEQY++FI +R
Sbjct: 249 NQIKIENPHLWTEEFAAEIRAMLHEACELEVAYARDTMPRGMLGLTAESCEQYLRFITDR 308

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           R  QIGL PLF   +NPFPWMSE +DL+KEKNFFETRVTEY+ G  L+WD
Sbjct: 309 RAEQIGLAPLFGQADNPFPWMSEAMDLRKEKNFFETRVTEYRTGGSLEWD 358


>gi|114321252|ref|YP_742935.1| ribonucleotide-diphosphate reductase subunit beta [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114227646|gb|ABI57445.1| Ribonucleoside-diphosphate reductase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 354

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 296/350 (84%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           N TGL  I+AG  RV+VD+KRM+N R+DVNQLLPLKY WAWEKYL+ CNNHWMPTEVPM 
Sbjct: 5   NATGLEAIEAGAHRVSVDEKRMINCRADVNQLLPLKYEWAWEKYLAGCNNHWMPTEVPMG 64

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW+  +GLT DERLMIKRNLGFFA+SESLVANNIVLAIYRH++NPECRQYLLRQAF
Sbjct: 65  ADIALWRHPDGLTADERLMIKRNLGFFATSESLVANNIVLAIYRHITNPECRQYLLRQAF 124

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEA+H+HTFQYI+ SL LDEGELFNMYREVPSIT KA WAL+YTQ L S  F T +++  
Sbjct: 125 EEAIHTHTFQYIVESLDLDEGELFNMYREVPSITDKAAWALKYTQNLESGHFDTTSREGA 184

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL+DL  FYVVFEGMWFYTGFAQILSLGR NKM GIAE YQYI+RDES+HLNFGIDVI
Sbjct: 185 QSFLRDLVAFYVVFEGMWFYTGFAQILSLGRQNKMTGIAEMYQYILRDESIHLNFGIDVI 244

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQI+ ENP LWT +F+Q+  TML EA  LE+AYA +TMP+G +GLNA  CE+YM FI NR
Sbjct: 245 NQIRHENPELWTNDFEQEVLTMLREAVELEVAYARDTMPRGMLGLNADMCEEYMHFITNR 304

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL+ L+    NPFPWMSEV+DL+KEKNFFETRVT+Y+ G  L+WD
Sbjct: 305 RCAQLGLKELYPGATNPFPWMSEVMDLQKEKNFFETRVTDYRTGGALQWD 354


>gi|284032753|ref|YP_003382684.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
 gi|283812046|gb|ADB33885.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
          Length = 354

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/353 (73%), Positives = 288/353 (81%), Gaps = 4/353 (1%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            T   PI  G  RV V DK M+NAR+DVNQLLPLKY WAW+KYL+ACNNHWMPTEV MQ 
Sbjct: 2   TTTTPPIAVGATRVEVADKAMINARADVNQLLPLKYQWAWDKYLAACNNHWMPTEVSMQA 61

Query: 64  DLALWK----SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
           D+ALW+    +K+GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YR LSNPECRQYLLR
Sbjct: 62  DIALWRRPAGAKDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLSNPECRQYLLR 121

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           QAFEEAVH+HTFQYI TSLGLDEGELFNMYREVPSI AK  WAL+YT+ L+   F TGT 
Sbjct: 122 QAFEEAVHTHTFQYICTSLGLDEGELFNMYREVPSIAAKDAWALKYTRHLTDGDFRTGTP 181

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +AD +FL+DL  FYVVFEGMWFYTGFAQIL LGR NKMVGIAEQYQYI+RDESLHLNFGI
Sbjct: 182 EADTDFLRDLIAFYVVFEGMWFYTGFAQILVLGRRNKMVGIAEQYQYILRDESLHLNFGI 241

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           D INQIK+ENPHLWT  FQ + R ML EA  LE+AY   T+P G +GL A  CEQYM FI
Sbjct: 242 DCINQIKLENPHLWTPAFQAEVRRMLTEACELEVAYGRATLPNGMLGLTAELCEQYMHFI 301

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +RR  Q+GL PLF  T NPF WMSEV+DLKKEKNFFETRV EYQ G  L WD
Sbjct: 302 TDRRAEQLGLAPLFGETRNPFGWMSEVMDLKKEKNFFETRVIEYQSGGGLSWD 354


>gi|261855609|ref|YP_003262892.1| ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
 gi|261836078|gb|ACX95845.1| Ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
          Length = 398

 Score =  544 bits (1402), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 253/348 (72%), Positives = 287/348 (82%), Gaps = 1/348 (0%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I  G  RV+V  KR++NA +DVNQLLP+KY WAWEKYL+ CNNHWMPTEV MQ D
Sbjct: 51  TGLEGIAQGAGRVDVSAKRIINATADVNQLLPMKYTWAWEKYLAGCNNHWMPTEVSMQAD 110

Query: 65  LALWKSKNG-LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           +ALWK ++G LT DER MI RNLGFFA++ESLVANNIVLAIY+ ++NPECRQYLLRQAFE
Sbjct: 111 IALWKGRDGGLTADERAMIMRNLGFFATAESLVANNIVLAIYKQVTNPECRQYLLRQAFE 170

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EAVH+HTFQYI+ SLGL EGELFNMYRE+PSITAK  WAL+YT+ L+   F T T    Q
Sbjct: 171 EAVHTHTFQYIVESLGLAEGELFNMYREIPSITAKDEWALKYTKNLADGDFDTSTTKGAQ 230

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           +FL+DL  FYVVFEGMWFYTGFAQILSLGR NKM GIAEQYQYIMRDES+H+NFGIDVIN
Sbjct: 231 DFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMTGIAEQYQYIMRDESIHMNFGIDVIN 290

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT++F+ +   ML EA  LEIAYA +TMP G +GLNA  C +Y+ FIANRR
Sbjct: 291 QIKIENPHLWTEDFKAEVTRMLKEAAELEIAYARDTMPHGLLGLNAEMCAEYLHFIANRR 350

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           C+QIGL  LF    NPFPWMSEVIDLKKEKNFFETRVT+YQ G  L W
Sbjct: 351 CNQIGLAELFPGATNPFPWMSEVIDLKKEKNFFETRVTDYQTGGALNW 398


>gi|300113307|ref|YP_003759882.1| ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
 gi|299539244|gb|ADJ27561.1| Ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
          Length = 412

 Score =  524 bits (1349), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 231/347 (66%), Positives = 284/347 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYLS C NHWMP E+ M  D+
Sbjct: 66  GVEDIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLSGCANHWMPQEINMNADI 125

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 126 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 185

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 186 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPQFHTGTAENDQKL 245

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 246 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 305

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW+  F+Q++  M+ EA  LE  YAH+TMP+G +GLNAP  E+Y++FIANRRC 
Sbjct: 306 KLENPHLWSDSFKQETLRMIQEAVSLETQYAHDTMPRGVLGLNAPMFEEYLKFIANRRCA 365

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 366 QIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|77165986|ref|YP_344511.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosococcus
           oceani ATCC 19707]
 gi|254436303|ref|ZP_05049809.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
 gi|76884300|gb|ABA58981.1| Ribonucleoside-diphosphate reductase [Nitrosococcus oceani ATCC
           19707]
 gi|207087993|gb|EDZ65266.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
          Length = 412

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 231/347 (66%), Positives = 284/347 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYLS C NHWMP E+ M  D+
Sbjct: 66  GVEDIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLSGCANHWMPQEINMNADI 125

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 126 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 185

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 186 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPQFHTGTAENDQKL 245

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 246 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 305

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW+  F+Q++  M+ EA  LE  YAH+TMP+G +GLNAP  E+Y++FIANRRC 
Sbjct: 306 KLENPHLWSDSFKQETLRMIQEAVSLETQYAHDTMPRGVLGLNAPMFEEYLKFIANRRCA 365

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 366 QIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|292490774|ref|YP_003526213.1| ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
 gi|291579369|gb|ADE13826.1| Ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 230/347 (66%), Positives = 285/347 (82%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYL+ C NHWMP E+ M  D+
Sbjct: 69  GIENIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLNGCANHWMPQEINMNADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 129 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 189 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQYLADPQFHTGTDENDQKL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 249 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT  F+Q++  M+ EA  LE  YA++TMP+G +GLNAP  ++Y++FIANRRC 
Sbjct: 309 KIENPHLWTDSFKQETIQMIREAVSLETQYAYDTMPRGVLGLNAPMFDEYLKFIANRRCA 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSE++DLKKEKNFFETRVTEYQ G  LKWD
Sbjct: 369 QIGLPEQYPGASNPFPWMSEILDLKKEKNFFETRVTEYQTGGALKWD 415


>gi|288941383|ref|YP_003443623.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
 gi|288896755|gb|ADC62591.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
          Length = 458

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 232/348 (66%), Positives = 283/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  +  G  RV VDDKR++N R+D+NQL+P KY WAW+KYL AC NHWMP E+ M  D
Sbjct: 111 TGLESLAMGASRVRVDDKRIINCRADLNQLVPFKYDWAWQKYLDACANHWMPQEISMNAD 170

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           LALWK  +GLT+DERL++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 171 LALWKDPHGLTEDERLIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 230

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY++ SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+
Sbjct: 231 ALHTHAYQYVVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPHFQTGTPENDQK 290

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 291 LLRELVAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYILRDESMHMNFGIDVINQ 350

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+Q+   M+ EA  LE  YAH+TMP+G +GLNA   E Y+ FIANRRC
Sbjct: 351 IKIENPHLWTPEFRQELVGMIREAVELEARYAHDTMPRGVLGLNAQMFEDYLHFIANRRC 410

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 411 AQIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALNWD 458


>gi|220935777|ref|YP_002514676.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997087|gb|ACL73689.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 408

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 226/349 (64%), Positives = 287/349 (82%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           NTGL  I+ G +R+ VDDK+++N R+D+NQL+P KY WAW+KYL  C NHWMP E+ M  
Sbjct: 60  NTGLEDIELGAERIRVDDKKIINCRADLNQLVPFKYQWAWQKYLDGCANHWMPQEINMNA 119

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT+DER ++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 120 DIALWKDPNGLTEDERTIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 179

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +T+ L+ P F TGT + DQ
Sbjct: 180 EALHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTRYLADPDFHTGTPENDQ 239

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L++L  FYV+FEG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVIN
Sbjct: 240 KLLRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGVAEQFQYILRDESMHMNFGIDVIN 299

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENPHLWT  F+++ RTM+ +A  LE  YA +TMP+G +G+NA   E+Y+ FIANRR
Sbjct: 300 QIKVENPHLWTAAFKEEMRTMIRDAVELEAQYARDTMPRGVLGMNAAMFEEYLHFIANRR 359

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL  ++   ENPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 360 CAQIGLAEIYPGAENPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 408


>gi|53804295|ref|YP_114081.1| ribonucleotide-diphosphate reductase subunit beta [Methylococcus
           capsulatus str. Bath]
 gi|53758056|gb|AAU92347.1| ribonucleoside-diphosphate reductase, beta subunit [Methylococcus
           capsulatus str. Bath]
          Length = 403

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 229/348 (65%), Positives = 286/348 (82%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  I+ G +R+ VDDKR++N R+D+NQL+P KY WAW+KYL AC NHWMP E+ M  D
Sbjct: 56  TGLENIEMGARRIQVDDKRIINCRADLNQLVPFKYQWAWQKYLDACANHWMPQEINMNAD 115

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS +GLT DER++IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 116 IALWKSADGLTPDERIIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 175

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY++ SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+
Sbjct: 176 ALHTHAYQYVVESLGLDEGEVFNMYREVPAVARKAEWALPFTQYLADPYFKTGTPENDQK 235

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQ
Sbjct: 236 LLRELIAFYVIFEGIFFYVGFTQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQ 295

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLWT  F+ +   M+ EA  +E  YA++TMP+G +GLNAP  ++Y+QFIANRRC
Sbjct: 296 IKVENPHLWTDGFKVEMVQMIREAVDIETQYAYDTMPRGILGLNAPMFKEYLQFIANRRC 355

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 356 AQIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGTLSWD 403


>gi|289208615|ref|YP_003460681.1| ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
 gi|288944246|gb|ADC71945.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
          Length = 412

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 288/348 (82%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G +R+ VDDK+++N  +D+NQL+P KY WAW+KYL  C NHWMP E+ M  D
Sbjct: 65  TGLEDLEMGAERIRVDDKKIINCHADLNQLVPFKYKWAWQKYLDGCANHWMPQEINMNAD 124

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGLT+DER ++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 125 IALWKDPNGLTEDERTIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 184

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY + SLGLDEGE+FNMYREVPS+  KA WAL +T+ L+ P+F TGT +ADQ+
Sbjct: 185 ALHTHAYQYCVESLGLDEGEIFNMYREVPSVATKAEWALPFTKHLADPNFRTGTPEADQK 244

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FYVVFEG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 245 LLRELIAFYVVFEGIFFYVGFVQILSMGRRNKMTGVAEQFQYILRDESMHMNFGIDVINQ 304

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLWT+EF+ + RT++ +A  LE  YA +TMP+G +G+NA   E+Y+ FIANRRC
Sbjct: 305 IKVENPHLWTEEFKNEMRTLISDAVELEAQYARDTMPRGVLGMNAQMFEEYLHFIANRRC 364

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL  ++   +NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 365 AQIGLAEMYPGADNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|254496936|ref|ZP_05109775.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
 gi|254353845|gb|EET12541.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
          Length = 369

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TG   I+ G  R++VDDKR++N R+D+NQL+P KY WAW+KYLSAC NHWMP E+ M  D
Sbjct: 17  TGYESIEMGAARIHVDDKRIINCRADLNQLVPFKYTWAWDKYLSACANHWMPNEISMSAD 76

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGLTDDERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 77  VALWKDPNGLTDDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 136

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY+I SLGLDE E+FNMYRE+PS+  KA WAL YTQ+L   SF TGT + DQ 
Sbjct: 137 ALHTHAYQYVIESLGLDEAEVFNMYREIPSVATKAAWALPYTQSLGDESFHTGTIENDQR 196

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYV+FEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 197 LLRDLIAFYVIFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVINQ 256

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+++   ++ +   +E  YA +TMP G +G+NA   E+Y+ FIANRR 
Sbjct: 257 IKIENPHLWTPEFKEEIIQLIKDGVAMEYQYAKDTMPHGILGMNAEMFEEYLHFIANRRL 316

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 317 NQIGLPEQYPGAENPFPWMSEMMDLKKEKNFFETRVIEYQAGGTLSWD 364


>gi|192360823|ref|YP_001982048.1| ribonucleotide-diphosphate reductase subunit beta [Cellvibrio
           japonicus Ueda107]
 gi|190686988|gb|ACE84666.1| ribonucleoside reductase, beta subunit [Cellvibrio japonicus
           Ueda107]
          Length = 429

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 222/347 (63%), Positives = 284/347 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 83  GLEELEMGAARIQVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 142

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKSK+GLT+DER ++ R+LG+F++++SLVANN+VLAIYR ++NPECRQY+LRQ+FEEA
Sbjct: 143 ALWKSKDGLTEDERRIVMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYILRQSFEEA 202

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W+L +T +L +P+FTTGT + DQE 
Sbjct: 203 IHTHAYQYCIESLGMDEGEVFNMYRELPSVANKAAWSLHHTHSLGNPTFTTGTPETDQEL 262

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYVV EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 263 LRNLVAFYVVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 322

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT EFQQ+   M+ E T LEI YA ++MP+G +G+NA   E+Y+ FIANRRC 
Sbjct: 323 KLENPHLWTAEFQQEVLQMILEGTELEIQYARDSMPRGVLGMNAAMMEEYLHFIANRRCA 382

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL+  F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 383 QLGLKEQFPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 429


>gi|262373382|ref|ZP_06066661.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
 gi|262313407|gb|EEY94492.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
          Length = 427

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 281/346 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA+W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKASWGLKYTQSLSDPTFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|52842002|ref|YP_095801.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629113|gb|AAU27854.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 381

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  D
Sbjct: 32  TGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSAD 91

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 92  VALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 151

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ 
Sbjct: 152 ALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQR 211

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 212 LLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVINQ 271

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR 
Sbjct: 272 IKIENPHLWTPEFKNEMIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRRL 331

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 332 NQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 379


>gi|270156779|ref|ZP_06185436.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|289164772|ref|YP_003454910.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           longbeachae NSW150]
 gi|269988804|gb|EEZ95058.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|288857945|emb|CBJ11805.1| putative ribonucleoside-diphosphate reductase, beta subunit
           [Legionella longbeachae NSW150]
          Length = 366

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 223/352 (63%), Positives = 282/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +   TG   ++ G  R++VDDKR++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ 
Sbjct: 13  LTGATGYESLEMGAARIHVDDKRIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEIS 72

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+ ERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQ
Sbjct: 73  MSADVALWKDPNGLTEAERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQ 132

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY+I SLGLDE E+FNMYRE+PS+  KA WAL YTQ+L+  +F TGT +
Sbjct: 133 AFEEALHTHAYQYVIESLGLDEAEVFNMYREIPSVATKAAWALPYTQSLADETFHTGTVE 192

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGID
Sbjct: 193 NDQRLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGID 252

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWT EF+++   ++ +   LE  YA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 253 VINQIKIENPHLWTSEFKEEIIQLIRQGVDLEYQYAKDTMPQGILGMNAEMFEEYLHFIA 312

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL   +    NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 313 NRRLTQIGLAEQYPGAVNPFPWMSEMMDLKKEKNFFETRVIEYQAGGTLSWD 364


>gi|148359319|ref|YP_001250526.1| ribonucleoside-diphosphate reductase subunit beta [Legionella
           pneumophila str. Corby]
 gi|296107366|ref|YP_003619066.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281092|gb|ABQ55180.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila str. Corby]
 gi|295649267|gb|ADG25114.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610475|emb|CBX00047.1| hypothetical protein LPW_18021 [Legionella pneumophila 130b]
          Length = 367

 Score =  504 bits (1298), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  D
Sbjct: 18  TGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSAD 77

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 78  VALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 137

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ 
Sbjct: 138 ALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQR 197

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 198 LLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVINQ 257

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR 
Sbjct: 258 IKIENPHLWTPEFKNEMIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRRL 317

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 318 NQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|54294662|ref|YP_127077.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Lens]
 gi|53754494|emb|CAH15978.1| hypothetical protein lpl1739 [Legionella pneumophila str. Lens]
          Length = 367

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  D
Sbjct: 18  TGLEALEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSAD 77

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 78  VALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 137

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ 
Sbjct: 138 ALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQR 197

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 198 LLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVINQ 257

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR 
Sbjct: 258 IKIENPHLWTPEFKNEIIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRRL 317

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 318 NQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|54297688|ref|YP_124057.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Paris]
 gi|53751473|emb|CAH12891.1| hypothetical protein lpp1739 [Legionella pneumophila str. Paris]
          Length = 367

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  D
Sbjct: 18  TGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSAD 77

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 78  VALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 137

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ 
Sbjct: 138 ALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQR 197

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 198 LLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVINQ 257

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR 
Sbjct: 258 IKIENPHLWTPEFKNEIIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRRL 317

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 318 NQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|332872596|ref|ZP_08440564.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6014059]
 gi|332739125|gb|EGJ69984.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6014059]
          Length = 440

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 95  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 154

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 155 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 214

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 215 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 274

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 275 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 334

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 335 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 394

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 395 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 440


>gi|332852155|ref|ZP_08433982.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013150]
 gi|332867554|ref|ZP_08437707.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013113]
 gi|332729527|gb|EGJ60866.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013150]
 gi|332733971|gb|EGJ65116.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013113]
          Length = 440

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 95  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 154

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 155 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 214

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 215 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 274

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 275 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 334

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 335 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 394

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 395 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 440


>gi|260551040|ref|ZP_05825245.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
 gi|260405988|gb|EEW99475.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
          Length = 427

 Score =  504 bits (1297), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|90022104|ref|YP_527931.1| ribonucleotide-diphosphate reductase subunit beta [Saccharophagus
           degradans 2-40]
 gi|89951704|gb|ABD81719.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 423

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/352 (62%), Positives = 285/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    GL  ++ G +R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 72  MDPTLGLEELEIGAERIEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 131

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WKS +GL++DER +I R+LG+F++++SLVANN+VLAIYRH++NPE RQYLLRQ
Sbjct: 132 MTADVATWKSPDGLSEDERRIIMRSLGYFSTADSLVANNLVLAIYRHITNPEARQYLLRQ 191

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P+F TGT +
Sbjct: 192 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSIAHTQGMSDPTFKTGTPE 251

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQE L++L  FYV+ EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 252 ADQELLRNLIGFYVITEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 311

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT+EFQ +++ M+ E T LEIAYA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 312 VINQIKLENPHLWTEEFQAETKQMILEGTELEIAYARDTMPRGVLGMNAAMMEEYLHFIA 371

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 372 NRRMAQLGLAEAYPGAKNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWE 423


>gi|169797064|ref|YP_001714857.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AYE]
 gi|213156529|ref|YP_002318190.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|215484526|ref|YP_002326761.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|239501302|ref|ZP_04660612.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB900]
 gi|260555643|ref|ZP_05827863.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|301345633|ref|ZP_07226374.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB056]
 gi|301512780|ref|ZP_07238017.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB058]
 gi|301596291|ref|ZP_07241299.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB059]
 gi|169149991|emb|CAM87885.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AYE]
 gi|193076530|gb|ABO11186.2| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055689|gb|ACJ40591.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|213987168|gb|ACJ57467.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|260410554|gb|EEX03852.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
          Length = 427

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|293609145|ref|ZP_06691448.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
 gi|292829718|gb|EFF88080.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
          Length = 427

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|169634186|ref|YP_001707922.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii SDF]
 gi|169152978|emb|CAP02026.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii]
          Length = 427

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|184157022|ref|YP_001845361.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ACICU]
 gi|183208616|gb|ACC56014.1| Ribonucleotide reductase, beta subunit [Acinetobacter baumannii
           ACICU]
          Length = 427

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|255318309|ref|ZP_05359544.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262379054|ref|ZP_06072210.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
 gi|255304621|gb|EET83803.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262298511|gb|EEY86424.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
          Length = 427

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 281/346 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFKTGTPENDQIL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR +
Sbjct: 322 KIENPHLWTAEFQQEIIQMILEGTMLEIEYARDTMPRGVLGMNAAMMEEYLKFICNRRLN 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|110833571|ref|YP_692430.1| ribonucleotide-diphosphate reductase subunit beta [Alcanivorax
           borkumensis SK2]
 gi|110646682|emb|CAL16158.1| ribonucleoside reductase, beta subunit [Alcanivorax borkumensis
           SK2]
          Length = 430

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 278/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G++ ++    RV VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  DL
Sbjct: 84  GVAELEGAAGRVEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADL 143

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK  +GLTDDER ++KRNLGFFA+++SLVANN+VLAIYR ++NPECRQY+LRQ+FEEA
Sbjct: 144 ALWKKADGLTDDERRIVKRNLGFFATADSLVANNLVLAIYRLITNPECRQYILRQSFEEA 203

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY+E+PS+  KA W +QYT+ LS P FTTGT + D+  
Sbjct: 204 IHTHAYQYCIESLGMDEGEIFNMYQEIPSVAKKAQWGIQYTRDLSDPEFTTGTPETDKAL 263

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVINQI
Sbjct: 264 LENLIAFYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHVNFGIDVINQI 323

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW  + + K+  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIANRR  
Sbjct: 324 KLENPHLWDAQMRDKATQMILEGTELEIQYARDTMPRGVLGMNAAMMEEYLQFIANRRLA 383

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   FK   NPFPWMSE++DL+KEKNFFETRVTEYQ G  L W+
Sbjct: 384 QLGLPEQFKGVNNPFPWMSEIMDLRKEKNFFETRVTEYQVGGALSWE 430


>gi|126640804|ref|YP_001083788.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ATCC 17978]
 gi|322506921|gb|ADX02375.1| nrdB [Acinetobacter baumannii 1656-2]
 gi|323516789|gb|ADX91170.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 361

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 16  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 75

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 76  ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 135

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 136 IHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRL 195

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 196 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 255

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 256 KIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 315

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 316 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 361


>gi|325121074|gb|ADY80597.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 370

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 25  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 84

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 85  ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 144

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT + DQ  
Sbjct: 145 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPENDQRL 204

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 205 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 264

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 265 KIENPHLWTAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 324

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 325 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 370


>gi|50083944|ref|YP_045454.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. ADP1]
 gi|49529920|emb|CAG67632.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           sp. ADP1]
          Length = 427

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/347 (63%), Positives = 280/347 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  I+ G  RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D
Sbjct: 81  AGLQEIETGAARVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHD 140

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS+NGLT+DER+++KRNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQAFEE
Sbjct: 141 IALWKSENGLTEDERVIVKRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQAFEE 200

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YTQ+LS P F TGT + DQ+
Sbjct: 201 AIHTHAYQYCIESLGMDEGEIFNMYHEIPSVARKAAWGLKYTQSLSDPKFETGTPETDQQ 260

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF QILS+GR NKM G++EQ+QYI+RDES+H+NFGID+INQ
Sbjct: 261 LLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVSEQFQYILRDESMHVNFGIDMINQ 320

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EFQQ+   M+ E TLLEI YA +TMP+G +G+NA   E+Y++FI NRR 
Sbjct: 321 IKIENPHLWTAEFQQEVIQMIVEGTLLEIEYARDTMPRGVLGMNAAMMEEYLKFICNRRL 380

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            Q+GL   ++   NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 381 AQLGLPEQYRGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|88812072|ref|ZP_01127324.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790576|gb|EAR21691.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
          Length = 370

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/348 (63%), Positives = 278/348 (79%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL   + G  R+ VDDKR++N R+D+NQL+P KY WAWEKYL    NHWMP E+PM  D
Sbjct: 23  TGLDAPERGAARIRVDDKRIINCRADLNQLVPFKYHWAWEKYLQGSANHWMPQEIPMGRD 82

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           + LWK ++GLT+DER ++KR+LGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 83  IELWKRRDGLTEDERTIVKRSLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 142

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY+I SL +DEGE+FNMYREVPS+  KA WAL +T++L  P F TGT  ADQ 
Sbjct: 143 ALHTHAYQYVIESLAMDEGEVFNMYREVPSVARKAEWALPFTESLGDPDFRTGTPAADQR 202

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYV FEG++FYTGFAQ+L++GR NKM G AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 203 LLRDLIAFYVCFEGIFFYTGFAQVLAMGRRNKMTGTAEQFQYILRDESIHLNFGIDVINQ 262

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK ENPHLWT EFQ  ++  + E+  LE+ YA +T+P+G +GLNA   E+Y++FI NRR 
Sbjct: 263 IKQENPHLWTAEFQATAQRTILESMALEVDYARDTLPRGVLGLNAAMIEEYLRFITNRRL 322

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   ENP PWMSE++DLKKEKNFFETRVTEY+ G  L W+
Sbjct: 323 AQIGLTEAFPGAENPLPWMSELVDLKKEKNFFETRVTEYRTGGALSWE 370


>gi|262280153|ref|ZP_06057938.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260504|gb|EEY79237.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
          Length = 427

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/346 (63%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNLDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW+ EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWSAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|92112799|ref|YP_572727.1| ribonucleotide-diphosphate reductase subunit beta [Chromohalobacter
           salexigens DSM 3043]
 gi|91795889|gb|ABE58028.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens
           DSM 3043]
          Length = 420

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/348 (63%), Positives = 284/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  ++ G  R+ VDDK+M+NAR+D+NQL+P KY WAW+KYL    NHWMP EV M  D
Sbjct: 73  AGLEELEMGAARIEVDDKQMINARADLNQLVPFKYEWAWQKYLDGSANHWMPQEVNMNAD 132

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS +GLT+DER +++R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEE
Sbjct: 133 IALWKSNDGLTEDERRIVERSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQAFEE 192

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY + SLG+DEGE+FNMYREVPS+ AK+ W+L++TQ+L+ P F TGT + DQE
Sbjct: 193 AIHTHAYQYCVESLGMDEGEVFNMYREVPSVAAKSAWSLKHTQSLARPDFHTGTPETDQE 252

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D+INQ
Sbjct: 253 LLRNLIAFYCVTEGIFFYCGFSQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVDMINQ 312

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EFQ +   M+ E T LEIAYA ++MP+G +G+NA   E+Y+ FI NRR 
Sbjct: 313 IKIENPHLWTPEFQDEVTQMIIEGTELEIAYARDSMPRGVLGMNAAIMEEYLHFICNRRL 372

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL+  +   ENPFPWMSE+IDL+KEKNFFETRVTEYQ G  L WD
Sbjct: 373 AQIGLKEQYPGAENPFPWMSEIIDLRKEKNFFETRVTEYQVGGALSWD 420


>gi|307546480|ref|YP_003898959.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
 gi|307218504|emb|CBV43774.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
          Length = 415

 Score =  501 bits (1289), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 219/348 (62%), Positives = 283/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  ++ G  R+ VDDK+M+NAR+D+NQL+P KY WAW+KYL    NHWMP EV M  D
Sbjct: 68  AGLEELEMGAARIEVDDKQMINARADLNQLVPFKYEWAWQKYLDGSANHWMPQEVNMNAD 127

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWKS +GLTDDER +++R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEE
Sbjct: 128 IALWKSADGLTDDERRIVERSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQAFEE 187

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY + SL +DEGE+FNMYRE+PS+ AK+ W+L++TQ+L+ P F TGT + DQE
Sbjct: 188 AIHTHAYQYCVESLAMDEGEVFNMYREIPSVAAKSAWSLKHTQSLARPDFHTGTPETDQE 247

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D+INQ
Sbjct: 248 LLRNLVAFYCVTEGIFFYCGFSQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVDMINQ 307

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLWT EFQ +   M+ E T LEIAYA ++MP+G +G+NA   E+Y+ FI NRR 
Sbjct: 308 IKIENPHLWTPEFQDECTQMILEGTELEIAYARDSMPRGVLGMNAAIMEEYLHFICNRRL 367

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL+  F   +NPFPWMSE+IDL+KEKNFFETRVTEYQ G  L WD
Sbjct: 368 AQIGLKEQFPGAQNPFPWMSEIIDLRKEKNFFETRVTEYQVGGALSWD 415


>gi|226953559|ref|ZP_03824023.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|294649451|ref|ZP_06726876.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226835696|gb|EEH68079.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|292824656|gb|EFF83434.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 427

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 279/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER +I R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIIMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFHTGTPENDQIL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT  FQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWTATFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLA 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|254429337|ref|ZP_05043044.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
 gi|196195506|gb|EDX90465.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
          Length = 355

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/347 (62%), Positives = 277/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G++ ++    RV VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  DL
Sbjct: 9   GVAELEGASGRVEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADL 68

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK  +GLTDDER ++KRNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQ+FEEA
Sbjct: 69  ALWKKADGLTDDERRIVKRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQSFEEA 128

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY+E+PS+  KA W +QYT+ LS P FTTGT + D+  
Sbjct: 129 IHTHAYQYCIESLGMDEGEIFNMYQEIPSVAKKAQWGIQYTRDLSDPEFTTGTVETDKAL 188

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVINQI
Sbjct: 189 LENLIAFYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHVNFGIDVINQI 248

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW  + + K+  M+ E   LEI YA +TMP+G +G+NA   E+Y+QFIANRR  
Sbjct: 249 KLENPHLWDAQMRDKATQMILEGAELEIQYARDTMPRGVLGMNAAMMEEYLQFIANRRLA 308

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   FK   NPFPWMSE++DL+KEKNFFETRVTEYQ G  L W+
Sbjct: 309 QLGLPEQFKGVNNPFPWMSEIMDLRKEKNFFETRVTEYQVGGALSWE 355


>gi|299771426|ref|YP_003733452.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
 gi|298701514|gb|ADI92079.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
          Length = 427

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 221/346 (63%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNLDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPENDQRL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW+ EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPHLWSAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLS 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|256822964|ref|YP_003146927.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
 gi|256796503|gb|ACV27159.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
          Length = 421

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/347 (62%), Positives = 280/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  R+ VDDK+M+N R+D+NQL+P KY WAW+KYL  C+NHWMP E+ M  D+
Sbjct: 75  GLEELEMGAARIEVDDKKMINCRADLNQLVPFKYDWAWQKYLDGCSNHWMPQEINMTKDV 134

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A WK  NGLTDDER ++ R+LG+F++++SLVANN+VLAIYR ++NPECRQY+LRQAFEEA
Sbjct: 135 ATWKDPNGLTDDERKIVMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYILRQAFEEA 194

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY + SLG+DE E+FNMYREVPSI  KA W++++TQ +S+P+F TGT +ADQE 
Sbjct: 195 IHTHAYQYCVESLGMDEAEVFNMYREVPSIAKKAAWSIKHTQGISNPTFKTGTDEADQEL 254

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D+INQI
Sbjct: 255 LRNLIGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVDIINQI 314

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT EF+Q+   M+ E T LEI YA +TMP+G +G+NA   E+Y+QFI NRR  
Sbjct: 315 KLENPHLWTAEFKQEVLQMILEGTQLEIEYARDTMPRGVLGMNAGMMEEYLQFICNRRLA 374

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   FK   NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 375 QLGLPEQFKNVSNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 421


>gi|327480258|gb|AEA83568.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri DSM 4166]
          Length = 415

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/347 (62%), Positives = 281/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLNELEGEAARVRVDEKRMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKSK+GL++DER ++KRNLGFF++++SLVANN+VLA YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKSKDGLSEDERRIVKRNLGFFSTADSLVANNLVLATYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY EVPS+  KA+W L+YT+++S P+F TGT + D++F
Sbjct: 189 IHTHAYQYCIESLGMDEGEIFNMYHEVPSVAKKASWGLKYTRSISDPTFQTGTPETDKQF 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 249 LKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWNAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|262376783|ref|ZP_06070011.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
 gi|262308493|gb|EEY89628.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
          Length = 427

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 281/346 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFKTGTPENDQIL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFSQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENP LWT EFQ++   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FIANRR  
Sbjct: 322 KIENPGLWTTEFQEEIIQMILEGTMLEIEYARDTMPRGVLGMNAGMMEEYLKFIANRRLA 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|254784923|ref|YP_003072351.1| ribonucleotide-diphosphate reductase subunit beta [Teredinibacter
           turnerae T7901]
 gi|237687536|gb|ACR14800.1| ribonucleoside-diphosphate reductase [Teredinibacter turnerae
           T7901]
          Length = 453

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 108 GLEELEMGAARIEVDDKRMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMTADV 167

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A+WKS+ GL+ DER ++ R+LG+F++++SLVANN+VLAIYRH++NPE RQYLLRQAFEEA
Sbjct: 168 AIWKSEEGLSADERKIVMRSLGYFSTADSLVANNLVLAIYRHITNPEARQYLLRQAFEEA 227

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P F TGT +ADQE 
Sbjct: 228 IHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSITHTQGISDPQFHTGTPEADQEL 287

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+ EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 288 LRNLIGFYVITEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 347

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT+ FQQ+ + M+ E T LEI YA +TMP+G +G+NA   E+Y+ FIANRR  
Sbjct: 348 KLENPHLWTESFQQEVKQMVLEGTELEIGYARDTMPRGVLGMNAAIMEEYLHFIANRRLA 407

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL+  +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W
Sbjct: 408 QLGLKEAYPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSW 453


>gi|262369327|ref|ZP_06062655.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
 gi|262315395|gb|EEY96434.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
          Length = 427

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 221/346 (63%), Positives = 280/346 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 82  GLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDI 141

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQAFEEA
Sbjct: 142 ALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEA 201

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT + DQ  
Sbjct: 202 IHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFQTGTPENDQIL 261

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 262 LRNLIAFYCVLEGIFFYCGFSQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQI 321

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENP LWT EFQ++   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI NRR  
Sbjct: 322 KIENPSLWTAEFQEEIIQMILEGTMLEIEYARDTMPRGVLGMNAAMMEEYLKFICNRRLA 381

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 382 QLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|212212091|ref|YP_002303027.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuG_Q212]
 gi|212010501|gb|ACJ17882.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuG_Q212]
          Length = 401

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/348 (63%), Positives = 279/348 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  D
Sbjct: 53  TGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTAD 112

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFEE
Sbjct: 113 IALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFEE 172

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+ 
Sbjct: 173 ALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDRR 232

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 233 LLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVINQ 292

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRRC
Sbjct: 293 IKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRRC 352

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 353 AQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|153208286|ref|ZP_01946665.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165919229|ref|ZP_02219315.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212219268|ref|YP_002306055.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuK_Q154]
 gi|120576070|gb|EAX32694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917090|gb|EDR35694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212013530|gb|ACJ20910.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuK_Q154]
          Length = 401

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/348 (63%), Positives = 279/348 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  D
Sbjct: 53  TGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTAD 112

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFEE
Sbjct: 113 IALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFEE 172

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+ 
Sbjct: 173 ALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDRR 232

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 233 LLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVINQ 292

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRRC
Sbjct: 293 IKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRRC 352

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 353 AQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|29654845|ref|NP_820537.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 493]
 gi|154705923|ref|YP_001423853.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii Dugway 5J108-111]
 gi|161831080|ref|YP_001597389.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 331]
 gi|29542113|gb|AAO91051.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           RSA 493]
 gi|154355209|gb|ABS76671.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           Dugway 5J108-111]
 gi|161762947|gb|ABX78589.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 331]
          Length = 401

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/348 (63%), Positives = 279/348 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  D
Sbjct: 53  TGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTAD 112

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFEE
Sbjct: 113 IALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFEE 172

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+ 
Sbjct: 173 ALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDRR 232

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVINQ
Sbjct: 233 LLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVINQ 292

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRRC
Sbjct: 293 IKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRRC 352

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 353 AQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|146282010|ref|YP_001172163.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri A1501]
 gi|145570215|gb|ABP79321.1| ribonucleoside reductase, small chain [Pseudomonas stutzeri A1501]
          Length = 415

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/347 (62%), Positives = 281/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLNELEGEAARVRVDEKRMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKSK+GL++DER ++KRNLGFF++++SLVANN+VLA YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKSKDGLSEDERRIVKRNLGFFSTADSLVANNLVLATYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT + D++F
Sbjct: 189 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFQTGTPETDKQF 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 249 LKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNASMMEDYLKFIANRRLT 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|330811278|ref|YP_004355740.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379386|gb|AEA70736.1| Ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 415

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTPDTDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|254483523|ref|ZP_05096750.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
 gi|214036244|gb|EEB76924.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
          Length = 425

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 218/348 (62%), Positives = 282/348 (81%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  ++ G  RV+VD+K M+N R+D+NQL+PLKY WAW+KYL  C NHWMP E+ M  D
Sbjct: 78  AGLEELEMGASRVSVDEKAMINCRADLNQLVPLKYDWAWQKYLDGCANHWMPQEINMTAD 137

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +A WKS +GL+DDER ++ R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEE
Sbjct: 138 VATWKSADGLSDDERRIVMRSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQAFEE 197

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY I SLG+DEGE+FNMYREVPS+ AKA+W+L +T +LS P+F TGT++ DQE
Sbjct: 198 AIHTHAYQYCIESLGMDEGEVFNMYREVPSVAAKASWSLSHTHSLSDPTFNTGTQETDQE 257

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 258 LLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQ 317

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENP+LWT+ FQQ+   M+ E T +EI YA +TMP+G +G+NA   E+Y+ FIANRR 
Sbjct: 318 IKLENPNLWTETFQQEVIQMILEGTEIEIQYARDTMPRGVLGMNAAIMEEYLHFIANRRL 377

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 378 SQLGLPEQFAGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 425


>gi|70731866|ref|YP_261608.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf-5]
 gi|68346165|gb|AAY93771.1| ribonucleoside-diphosphate reductase, beta subunit, putative
           [Pseudomonas fluorescens Pf-5]
          Length = 415

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVDTDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|312960686|ref|ZP_07775192.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
 gi|311285212|gb|EFQ63787.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
          Length = 416

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGASARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 190 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVDTDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|254516739|ref|ZP_05128798.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
 gi|219675162|gb|EED31529.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
          Length = 441

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/348 (62%), Positives = 279/348 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  ++ G  RV++D+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV M  D
Sbjct: 94  AGLEELEMGAARVSIDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVNMTAD 153

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +A WK+  GLTDDER +I R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEE
Sbjct: 154 VATWKNPEGLTDDERRIILRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQAFEE 213

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W+L +T  LS P+F TGT ++DQ 
Sbjct: 214 AIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSLSHTHELSDPNFNTGTMESDQT 273

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 274 LLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQ 333

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLWT+EF+Q++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIANRR 
Sbjct: 334 IKLENPHLWTEEFKQEAIQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFIANRRL 393

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 394 SQIGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 441


>gi|77460516|ref|YP_350023.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf0-1]
 gi|77384519|gb|ABA76032.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens Pf0-1]
          Length = 416

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 275/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAEMKEEASQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|148546452|ref|YP_001266554.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida F1]
 gi|148510510|gb|ABQ77370.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida F1]
          Length = 415

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|229590245|ref|YP_002872364.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229362111|emb|CAY49013.1| putative ribonucleoside-diphosphate reductase beta chain
           [Pseudomonas fluorescens SBW25]
          Length = 416

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|28868867|ref|NP_791486.1| ribonucleoside-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213969520|ref|ZP_03397656.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301385974|ref|ZP_07234392.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058701|ref|ZP_07250242.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato K40]
 gi|302134408|ref|ZP_07260398.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28852106|gb|AAO55181.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213925616|gb|EEB59175.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|330960626|gb|EGH60886.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. maculicola str. ES4326]
 gi|331016758|gb|EGH96814.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 415

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 274/347 (78%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK   GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKDPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVDTDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|66046950|ref|YP_236791.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae B728a]
 gi|237798938|ref|ZP_04587399.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|237806191|ref|ZP_04592895.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|63257657|gb|AAY38753.1| Ribonucleoside-diphosphate reductase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330980156|gb|EGH78342.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aptata str. DSM 50252]
 gi|331021792|gb|EGI01849.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331027304|gb|EGI07359.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 415

 Score =  494 bits (1272), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 275/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVDTDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|330880140|gb|EGH14289.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330966559|gb|EGH66819.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 415

 Score =  494 bits (1272), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 274/347 (78%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK   GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKDPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVDTDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|119504228|ref|ZP_01626308.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119459736|gb|EAW40831.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 419

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/347 (63%), Positives = 279/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV M  D+
Sbjct: 73  GLEELEMGAARVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVNMTADV 132

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A WK  +GL+DDER +I R+LG+F++++SLVANN+VLAIYR ++NPECRQYLLRQAFEEA
Sbjct: 133 ATWKDPDGLSDDERRIIMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYLLRQAFEEA 192

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+ AKA W+L  T +LS P+F TGT + DQE 
Sbjct: 193 IHTHAYQYCIESLGMDEGEVFNMYREVPSVAAKATWSLGKTHSLSDPNFRTGTLETDQEL 252

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 253 LRNLIGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 312

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENP LWT EFQQ++  M+ E T LEIAYA +TMP+G +G+NA   E+Y+QFI NRR +
Sbjct: 313 KLENPLLWTPEFQQEAIQMILEGTELEIAYARDTMPRGVLGMNAAMMEEYLQFICNRRLN 372

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 373 QVGLPEQFPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 419


>gi|15596352|ref|NP_249846.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAO1]
 gi|107100605|ref|ZP_01364523.1| hypothetical protein PaerPA_01001630 [Pseudomonas aeruginosa PACS2]
 gi|116049087|ref|YP_792111.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152988648|ref|YP_001349579.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PA7]
 gi|218892881|ref|YP_002441750.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa LESB58]
 gi|254239525|ref|ZP_04932847.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|296390475|ref|ZP_06879950.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAb1]
 gi|313106126|ref|ZP_07792381.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
 gi|9947077|gb|AAG04544.1|AE004545_7 NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa PAO1]
 gi|115584308|gb|ABJ10323.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126192903|gb|EAZ56966.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|150963806|gb|ABR85831.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa PA7]
 gi|187939552|gb|ACD38699.1| ribonucleoside reductase small chain [Pseudomonas aeruginosa]
 gi|218773109|emb|CAW28921.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa LESB58]
 gi|310878883|gb|EFQ37477.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
          Length = 415

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 278/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLDDLEGSAARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKSK+GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKSKDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P F TGT + D++F
Sbjct: 189 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPMFQTGTPETDRQF 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|170720377|ref|YP_001748065.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida W619]
 gi|169758380|gb|ACA71696.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida W619]
          Length = 416

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|229592166|ref|YP_002874285.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229364032|emb|CAY51597.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens SBW25]
          Length = 416

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|26987912|ref|NP_743337.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida KT2440]
 gi|167035231|ref|YP_001670462.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida GB-1]
 gi|24982621|gb|AAN66801.1|AE016309_3 ribonucleoside reductase, beta subunit [Pseudomonas putida KT2440]
 gi|166861719|gb|ABZ00127.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida GB-1]
 gi|313497534|gb|ADR58900.1| NrdB [Pseudomonas putida BIRD-1]
          Length = 416

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|325272776|ref|ZP_08139120.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
 gi|324102083|gb|EGB99585.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
          Length = 416

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|146308172|ref|YP_001188637.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina ymp]
 gi|145576373|gb|ABP85905.1| Ribonucleoside-diphosphate reductase [Pseudomonas mendocina ymp]
          Length = 416

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 278/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLDDLEGAAARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSTDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT + D++F
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFNTGTPETDRQF 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|320323423|gb|EFW79511.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327620|gb|EFW83632.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330876273|gb|EGH10422.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 415

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C+NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCSNHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|104780527|ref|YP_607025.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           entomophila L48]
 gi|95109514|emb|CAK14215.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           entomophila L48]
          Length = 415

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 275/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKSMDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|330983931|gb|EGH82034.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 388

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/355 (61%), Positives = 283/355 (79%), Gaps = 8/355 (2%)

Query: 6   GLSPIQAGEK--------RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPT 57
           G   I AGE+        RV V  K+M+NAR+DVNQL+P KY WAW+KYL  C+NHWMP 
Sbjct: 34  GEMDIGAGERELEEGRQNRVQVGQKQMINARADVNQLVPFKYEWAWQKYLDGCSNHWMPQ 93

Query: 58  EVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYL 117
           EV M  D+ALWK  NGLTDDERL++KRNLG+F++++SLVANN+VLA+YR ++NPECRQY+
Sbjct: 94  EVNMSADIALWKDPNGLTDDERLILKRNLGYFSTADSLVANNLVLAVYRLITNPECRQYI 153

Query: 118 LRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
           LRQAFEEA+H+H +QY + SLGLD+GE+FNMY+EVPS+  KA W++++   ++ P+F TG
Sbjct: 154 LRQAFEEAIHTHAYQYCVESLGLDDGEIFNMYQEVPSVARKAAWSIKHMDAITDPAFQTG 213

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
           T +AD  FL++L  +Y V EG++FY GF Q LS+GR NK+VG+AEQ+QYI+RDES+HLNF
Sbjct: 214 TVEADTTFLKNLIAYYCVTEGIFFYCGFTQTLSMGRRNKLVGVAEQFQYILRDESMHLNF 273

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
           GID+INQIKIENPHLWT E ++++  M+ + T LEIAYA +TMP+G +G+NA   E+Y+Q
Sbjct: 274 GIDMINQIKIENPHLWTDELKREATVMIIQGTQLEIAYARDTMPRGVLGMNAAMMEEYLQ 333

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           FIANRR  QIGL  ++   +NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 334 FIANRRLTQIGLPEVYAGAKNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 388


>gi|71737432|ref|YP_275887.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485935|ref|ZP_05639976.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289628680|ref|ZP_06461634.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648392|ref|ZP_06479735.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298487941|ref|ZP_07005980.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302184861|ref|ZP_07261534.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae 642]
 gi|71557985|gb|AAZ37196.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157492|gb|EFH98573.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330866023|gb|EGH00732.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330896997|gb|EGH28545.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330986742|gb|EGH84845.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331010341|gb|EGH90397.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 415

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 275/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|330504346|ref|YP_004381215.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
 gi|328918632|gb|AEB59463.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
          Length = 416

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 277/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 70  GLDDLEGASARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSTDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P F TGT + D++F
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPQFQTGTPETDRQF 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDVINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLT 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|226945386|ref|YP_002800459.1| ribonucleotide-diphosphate reductase subunit beta [Azotobacter
           vinelandii DJ]
 gi|226720313|gb|ACO79484.1| Ribonucleoside-diphosphate reductase beta subunit [Azotobacter
           vinelandii DJ]
          Length = 416

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP E+ M  D+
Sbjct: 70  GLEDLEGAAARVRVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEINMNADI 129

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF++++SLVANN+ LAIYR ++NPECRQY+LRQAFEEA
Sbjct: 130 ALWKSADGLTEDERRIIKRNLGFFSTADSLVANNLALAIYRLITNPECRQYILRQAFEEA 189

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT + D++ 
Sbjct: 190 IHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFDTGTPETDRQL 249

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 250 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQI 309

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 310 KIENPHLWDAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNATMMEDYLKFIANRRLS 369

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 QLGLPEQYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|331006663|ref|ZP_08329944.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
 gi|330419531|gb|EGG93916.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
          Length = 444

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/347 (61%), Positives = 279/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  ++ G  RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 98  GIEELEMGAARVGVDEKAMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 157

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           +LWK  +GL+DDER +I R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEEA
Sbjct: 158 SLWKDPDGLSDDERRIIMRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQAFEEA 217

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P+F TGT + DQE 
Sbjct: 218 IHTHAYQYCIESLGMDEGEIFNMYREVPSVANKAAWSIAHTQGISDPTFNTGTTETDQEL 277

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID+INQI
Sbjct: 278 LRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDIINQI 337

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT+EF+ +   M+ E T LEIAYA +TMP+G +G+NA   E+Y+QFI+NRR  
Sbjct: 338 KLENPHLWTEEFKAEVTQMVLEGTELEIAYARDTMPRGVLGMNAAMMEEYLQFISNRRLA 397

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 398 QLGLTEQYPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWE 444


>gi|119478322|ref|ZP_01618353.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119448662|gb|EAW29907.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 422

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 281/348 (80%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            GL  ++ G  R+ V+DK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D
Sbjct: 75  AGLEELELGAARLTVEDKAMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTAD 134

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALWK  NGL+DDER ++ R+LG+F++++SLVANN++LAIYRH++NPECRQYLLRQAFEE
Sbjct: 135 VALWKDPNGLSDDERRIVMRSLGYFSTADSLVANNLILAIYRHITNPECRQYLLRQAFEE 194

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY + SL +DEGE+FNMYRE+PSI  KA W+L++T +LS P+F TGT + DQE
Sbjct: 195 AIHTHAYQYCVESLAMDEGEVFNMYRELPSIAKKAAWSLRHTHSLSDPNFKTGTPETDQE 254

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 255 LLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQ 314

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENP LW+++FQQ+   M+ E T LEI YA ++MP+G +G+NA   E+Y+QFI+NRR 
Sbjct: 315 IKLENPQLWSEKFQQEIIQMILEGTQLEIEYARDSMPRGVLGMNAAMMEEYLQFISNRRL 374

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +Q+GL   ++  +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 375 NQLGLPEQYQGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALNWE 422


>gi|160871658|ref|ZP_02061790.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
 gi|159120457|gb|EDP45795.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
          Length = 362

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 277/348 (79%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  RV+VDDK+++N R+D+NQL+P KY WAWEKYL+AC NHWMP E+ M  D
Sbjct: 14  TGLETLEVGAARVHVDDKKIINCRADLNQLVPFKYKWAWEKYLAACANHWMPQEINMSAD 73

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALW+   GL +DERL+++R+LGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 74  IALWRDAKGLREDERLIVERSLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 133

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY+I SLG+DE  +FNMYRE+P++  K  WAL +TQ+L+ P+F TGT + DQ 
Sbjct: 134 ALHTHAYQYVIESLGMDEARIFNMYRELPTVAKKTEWALPFTQSLADPNFRTGTPETDQR 193

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF+QILS+GR NKM G AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 194 LLRDLIAFYVVFEGIFFYVGFSQILSMGRQNKMTGTAEQFQYILRDESMHLNFGIDVINQ 253

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLWT EF++    ++ E   LE  YA +T+P+G +GLNA     Y++FI NRR 
Sbjct: 254 IKLENPHLWTPEFKRYVINLIKEGVDLEYQYALDTLPRGILGLNANLMWDYLRFIGNRRF 313

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   +    NP PWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 314 TQIGLAEQYPGVSNPLPWMSEIIDLKKEKNFFETRVTEYQTGGSLNWD 361


>gi|76808925|ref|YP_334881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1710b]
 gi|254208116|ref|ZP_04914466.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
 gi|76578378|gb|ABA47853.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei 1710b]
 gi|147752010|gb|EDK59077.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
          Length = 376

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 271/345 (78%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 32  SAAVASEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 91

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 92  WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 151

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+
Sbjct: 152 THAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLK 211

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 212 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 271

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 272 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 331

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 332 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 376


>gi|254282900|ref|ZP_04957868.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
 gi|219679103|gb|EED35452.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
          Length = 421

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 278/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G +RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV M  D+
Sbjct: 75  GLEELEMGAQRVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVNMTADV 134

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A WKS +GLT+DER ++ R+LG+F++++SLVANN+VL IYR ++NPECRQYLLRQAFEEA
Sbjct: 135 ATWKSSDGLTEDERRIVLRSLGYFSTADSLVANNLVLGIYRLITNPECRQYLLRQAFEEA 194

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEG +FNMYREVPS+  KA W+L +T +LS P+F TGT + DQ+ 
Sbjct: 195 IHTHAYQYCIESLGMDEGAVFNMYREVPSVARKATWSLSHTHSLSDPNFKTGTVETDQQL 254

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 255 LRNLVGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 314

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT EFQ++   M+ E T LEI YA +TMP+G +G+NA   E+Y+QFI NRR +
Sbjct: 315 KLENPHLWTAEFQEEVVQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFICNRRLN 374

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 375 QLGLSEQYPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 421


>gi|167825888|ref|ZP_02457359.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 9]
 gi|167924622|ref|ZP_02511713.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei BCC215]
 gi|254180586|ref|ZP_04887184.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
 gi|254190977|ref|ZP_04897483.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938651|gb|EDO94321.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|184211125|gb|EDU08168.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
          Length = 372

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 271/345 (78%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 28  SAAVASEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 87

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 88  WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 147

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+
Sbjct: 148 THAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLK 207

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 208 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 267

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 268 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 327

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 328 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 372


>gi|121598515|ref|YP_991780.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei SAVP1]
 gi|124385654|ref|YP_001027273.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10229]
 gi|126439848|ref|YP_001060484.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 668]
 gi|126451145|ref|YP_001082790.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10247]
 gi|126453692|ref|YP_001067748.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1106a]
 gi|134280207|ref|ZP_01766918.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|166998593|ref|ZP_02264451.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|167721297|ref|ZP_02404533.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei DM98]
 gi|167740266|ref|ZP_02413040.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 14]
 gi|167817486|ref|ZP_02449166.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 91]
 gi|167847373|ref|ZP_02472881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei B7210]
 gi|167895962|ref|ZP_02483364.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 7894]
 gi|167904346|ref|ZP_02491551.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei NCTC 13177]
 gi|167912606|ref|ZP_02499697.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 112]
 gi|217420440|ref|ZP_03451945.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|226196790|ref|ZP_03792369.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813879|ref|YP_002898330.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238561262|ref|ZP_00442338.2| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242316188|ref|ZP_04815204.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|254178822|ref|ZP_04885476.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|254199038|ref|ZP_04905453.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|254202774|ref|ZP_04909137.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|254259655|ref|ZP_04950709.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
 gi|254299327|ref|ZP_04966777.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|121227325|gb|ABM49843.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei SAVP1]
 gi|124293674|gb|ABN02943.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10229]
 gi|126219341|gb|ABN82847.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 668]
 gi|126227334|gb|ABN90874.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106a]
 gi|126244015|gb|ABO07108.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10247]
 gi|134248214|gb|EBA48297.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|147747021|gb|EDK54098.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|157808756|gb|EDO85926.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|160694736|gb|EDP84744.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|169656868|gb|EDS88265.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|217395852|gb|EEC35869.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|225931050|gb|EEH27058.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506031|gb|ACQ98349.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238524965|gb|EEP88395.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242139427|gb|EES25829.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|243065276|gb|EES47462.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|254218344|gb|EET07728.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
          Length = 403

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 271/345 (78%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 59  SAAVASEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 118

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 119 WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 178

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+
Sbjct: 179 THAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLK 238

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 239 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 298

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 299 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 358

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 359 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|53720599|ref|YP_109585.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei K96243]
 gi|53726102|ref|YP_104055.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei ATCC 23344]
 gi|52211013|emb|CAH37001.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei K96243]
 gi|52429525|gb|AAU50118.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 23344]
          Length = 350

 Score =  491 bits (1263), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 222/352 (63%), Positives = 274/352 (77%), Gaps = 2/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MA N   S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 1   MAPNA--SAAVASEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 58

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQ
Sbjct: 59  MSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQ 118

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +
Sbjct: 119 AFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLE 178

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID
Sbjct: 179 ADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGID 238

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+
Sbjct: 239 LINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFIS 298

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 299 NRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 350


>gi|88705571|ref|ZP_01103281.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
 gi|88700084|gb|EAQ97193.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
          Length = 469

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 278/347 (80%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  RV++D+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV M  D+
Sbjct: 123 GLEELEMGASRVSIDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVNMTADV 182

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A WK+  GLTDDER ++ R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQAFEEA
Sbjct: 183 ATWKNPEGLTDDERRIVLRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQAFEEA 242

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +T  LS P+F TGT ++DQ  
Sbjct: 243 IHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSISHTHELSDPNFRTGTLESDQTL 302

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 303 LRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 362

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENP LWT+EF+Q++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIANRR  
Sbjct: 363 KLENPQLWTEEFKQEAIQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFIANRRLS 422

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 423 QIGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 469


>gi|325519933|gb|EGC99191.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           TJI49]
          Length = 403

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 218/352 (61%), Positives = 272/352 (77%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A      P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 52  VAPQASAVPAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 111

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQ
Sbjct: 112 MSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQ 171

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +
Sbjct: 172 AFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLE 231

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID
Sbjct: 232 ADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGID 291

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+
Sbjct: 292 LINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFIS 351

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 352 NRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|161525957|ref|YP_001580969.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|160343386|gb|ABX16472.1| Ribonucleoside-diphosphate reductase [Burkholderia multivorans ATCC
           17616]
          Length = 396

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 53  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 112

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 113 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 172

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 173 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 232

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 233 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 292

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 293 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 352

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 353 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 396


>gi|189349324|ref|YP_001944952.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|221213238|ref|ZP_03586213.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
 gi|189333346|dbj|BAG42416.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           multivorans ATCC 17616]
 gi|221166690|gb|EED99161.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
          Length = 403

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|254253304|ref|ZP_04946622.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
 gi|124895913|gb|EAY69793.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
          Length = 403

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 300 NPHLWTPEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|83719302|ref|YP_441701.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
 gi|83653127|gb|ABC37190.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           thailandensis E264]
          Length = 377

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 218/345 (63%), Positives = 270/345 (78%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 33  SAAVASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 92

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 93  WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 152

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+
Sbjct: 153 THAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLK 212

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 213 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 272

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 273 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 332

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 333 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 377


>gi|221202418|ref|ZP_03575450.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
 gi|221208122|ref|ZP_03581127.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221172025|gb|EEE04467.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221177695|gb|EEE10110.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
          Length = 372

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 29  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 88

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 89  KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 148

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 149 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 208

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 209 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 268

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 269 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 328

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 329 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 372


>gi|30250346|ref|NP_842416.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           europaea ATCC 19718]
 gi|30181141|emb|CAD86334.1| Ribonucleotide reductase [Nitrosomonas europaea ATCC 19718]
          Length = 382

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/338 (63%), Positives = 271/338 (80%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV+V+DKR++N ++DVNQL+P KY WAWEKYLSAC NHWMP E+ M  D+ALWK  NGL
Sbjct: 45  RRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLSACANHWMPQEINMTRDIALWKDPNGL 104

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QYI
Sbjct: 105 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQYI 164

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FN Y E+ SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 165 VESIGLDEGEIFNAYHEIGSIRDKDEFLIPFIDTLTDPSFRTGTLETDQQLLKSLIVFAC 224

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLWT
Sbjct: 225 IMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLWT 284

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           +EF+++   ++ +A  LE  YA +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF 
Sbjct: 285 REFREEISALMRKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLFP 344

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              NPFPWMSE+IDLKKEKNFFETRV EYQ G  L WD
Sbjct: 345 EAGNPFPWMSEMIDLKKEKNFFETRVIEYQTGGVLSWD 382


>gi|82703584|ref|YP_413150.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosospira
           multiformis ATCC 25196]
 gi|82411649|gb|ABB75758.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 408

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 272/338 (80%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV+V+DKR++N ++DVNQL+P KY WAWEKYL+AC NHWMP E+ M  D+ALWK  NGL
Sbjct: 71  RRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLAACANHWMPQEINMSRDIALWKDPNGL 130

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QYI
Sbjct: 131 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHVTNPECRQYLLRQAFEEAIHTHAYQYI 190

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EV SI  K  + + +  TL+ PSF TGT +ADQ+ L+ L VF  
Sbjct: 191 VESLGLDEGEIFNAYHEVRSIREKDEFLIPFIDTLTDPSFRTGTLEADQKLLKSLIVFAC 250

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDV+NQIK+ENPHLWT
Sbjct: 251 IMEGLFFYVGFIQILALGRQNKMTGSAEQYQYILRDESMHCNFGIDVVNQIKMENPHLWT 310

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           KEF+ +   ++ +A  LE  YA +TMP+G +GLNAP  ++Y+++IANRRC QIGL+ L+ 
Sbjct: 311 KEFRSEISALMQKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRYIANRRCQQIGLDILYP 370

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 371 GASNPFPWMSEMIDLKKEKNFFETRVTEYQTGGVLNWD 408


>gi|312795100|ref|YP_004028022.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           rhizoxinica HKI 454]
 gi|312166875|emb|CBW73878.1| Ribonucleoside-diphosphate reductase beta chain (EC 1.17.4.1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 416

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/345 (63%), Positives = 268/345 (77%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           SP  A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 72  SPAPAPEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 131

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 132 WKDPNGLTDDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 191

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ PSF TGT +ADQ+ L+
Sbjct: 192 THAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPSFKTGTLEADQKLLK 251

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 252 SLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 311

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT  F+++   +   A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QI
Sbjct: 312 ENPHLWTPAFREEICGLFKHAVELEYRYAEDTMPRGVLGLNAGMFKSYLRFICNRRCQQI 371

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 372 GLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 416


>gi|114332419|ref|YP_748641.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           eutropha C91]
 gi|114309433|gb|ABI60676.1| Ribonucleoside-diphosphate reductase [Nitrosomonas eutropha C91]
          Length = 377

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/338 (63%), Positives = 272/338 (80%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV+V+DKR++N ++DVNQL+P KY WAWEKYLSAC NHWMP E+ M  D+ALWK  NGL
Sbjct: 40  RRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLSACANHWMPQEINMTRDIALWKDPNGL 99

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QYI
Sbjct: 100 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQYI 159

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FN Y E+ SI  K  + + +  TL++P+F TGT + DQ+ L+ L VF  
Sbjct: 160 VESIGLDEGEIFNAYHEIKSIRDKDEFLIPFIDTLTNPTFQTGTLETDQQLLKSLIVFAC 219

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QILSLGR NKM G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLWT
Sbjct: 220 IMEGLFFYVGFVQILSLGRQNKMTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLWT 279

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           +EF+++   ++ +A  LE  YA +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF 
Sbjct: 280 REFREEISALMRKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLFP 339

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 340 EAGNPFPWMSEMVDLKKEKNFFETRVIEYQTGGVLSWD 377


>gi|167580513|ref|ZP_02373387.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis TXDOH]
 gi|167618621|ref|ZP_02387252.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis Bt4]
 gi|257137870|ref|ZP_05586132.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
          Length = 350

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/352 (62%), Positives = 273/352 (77%), Gaps = 2/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MA N   S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 1   MAPNA--SAAVASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 58

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQ
Sbjct: 59  MSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQ 118

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +
Sbjct: 119 AFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLE 178

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID
Sbjct: 179 ADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGID 238

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+
Sbjct: 239 LINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFIS 298

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 299 NRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 350


>gi|330892405|gb|EGH25066.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 415

 Score =  488 bits (1255), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 274/347 (78%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV    D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNKTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVA+N+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVAHNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR  
Sbjct: 309 KIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLS 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 369 QIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|206561765|ref|YP_002232530.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia J2315]
 gi|254246390|ref|ZP_04939711.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|124871166|gb|EAY62882.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|198037807|emb|CAR53751.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           cenocepacia J2315]
          Length = 403

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 216/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|329893650|ref|ZP_08269784.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
 gi|328923577|gb|EGG30889.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
          Length = 432

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 276/347 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  ++ G  RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP E+ M  D+
Sbjct: 86  GLEELELGAARVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEINMTADV 145

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           A WKS + L+DDER ++ R+LG+F++++SLVANN+VL IYR ++NPECRQYLLRQAFEEA
Sbjct: 146 ATWKSADVLSDDERRIVMRSLGYFSTADSLVANNLVLGIYRLITNPECRQYLLRQAFEEA 205

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W+L +T +LS P+F TGT + DQ  
Sbjct: 206 IHTHAYQYCIESLGMDEGEVFNMYREIPSVAKKATWSLSHTHSLSDPNFKTGTTENDQTL 265

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 266 LRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 325

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLWT++FQ++   ML E T +EI YA +TMP+G +G+NA   E+Y+QFI NRR  
Sbjct: 326 KLENPHLWTEDFQKEVIQMLLEGTQIEIEYARDTMPRGVLGMNAAMMEEYLQFICNRRLA 385

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 386 QLGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 432


>gi|170699976|ref|ZP_02891003.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
 gi|170135124|gb|EDT03425.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
          Length = 403

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAAGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|209521089|ref|ZP_03269819.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
 gi|209498472|gb|EDZ98597.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
          Length = 411

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 272/358 (75%), Gaps = 7/358 (1%)

Query: 2   ANNTGLSPIQAGEK-------RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHW 54
           AN+  ++P+            RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHW
Sbjct: 54  ANDIAVAPVAHAGNAAAASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHW 113

Query: 55  MPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECR 114
           MP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECR
Sbjct: 114 MPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECR 173

Query: 115 QYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           Q+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F
Sbjct: 174 QFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAF 233

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
            TGT +ADQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H
Sbjct: 234 KTGTLEADQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMH 293

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + 
Sbjct: 294 CNFGIDLINQIKLENPHLWTAEFRAEIRAIFQQAVELEYRYAEDTMPRGVLGLNASMFKS 353

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 354 YLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 411


>gi|295677726|ref|YP_003606250.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
 gi|295437569|gb|ADG16739.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
          Length = 411

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 272/358 (75%), Gaps = 7/358 (1%)

Query: 2   ANNTGLSPIQAGEK-------RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHW 54
           AN+  ++P+            RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHW
Sbjct: 54  ANDIAVAPVAHAGNAAAASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHW 113

Query: 55  MPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECR 114
           MP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECR
Sbjct: 114 MPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECR 173

Query: 115 QYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           Q+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F
Sbjct: 174 QFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAF 233

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
            TGT +ADQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H
Sbjct: 234 KTGTLEADQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMH 293

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + 
Sbjct: 294 CNFGIDLINQIKLENPHLWTAEFRAEIRAIFQQAVELEYRYAEDTMPRGVLGLNASMFKS 353

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 354 YLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 411


>gi|115350552|ref|YP_772391.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria AMMD]
 gi|172059584|ref|YP_001807236.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria MC40-6]
 gi|115280540|gb|ABI86057.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria AMMD]
 gi|171992101|gb|ACB63020.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           MC40-6]
          Length = 403

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAAGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|78065156|ref|YP_367925.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           383]
 gi|77965901|gb|ABB07281.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383]
          Length = 403

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|171318520|ref|ZP_02907672.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
 gi|171096306|gb|EDT41212.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
          Length = 403

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|307731037|ref|YP_003908261.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
 gi|307585572|gb|ADN58970.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
          Length = 411

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 271/358 (75%), Gaps = 7/358 (1%)

Query: 2   ANNTGLSPIQAG-------EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHW 54
           AN+  ++P+  G       E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHW
Sbjct: 54  ANDIAVAPVARGAGTAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHW 113

Query: 55  MPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECR 114
           MP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECR
Sbjct: 114 MPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECR 173

Query: 115 QYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           Q+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P F
Sbjct: 174 QFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYINVLTDPGF 233

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
            TGT + DQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H
Sbjct: 234 KTGTLETDQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMH 293

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + 
Sbjct: 294 CNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKS 353

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 354 YLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 411


>gi|167564160|ref|ZP_02357076.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis EO147]
          Length = 369

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 217/345 (62%), Positives = 269/345 (77%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 25  SAAVASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 84

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 85  WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 144

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+
Sbjct: 145 THAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLK 204

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 205 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 264

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 265 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 324

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 325 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 369


>gi|170731918|ref|YP_001763865.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia MC0-3]
 gi|169815160|gb|ACA89743.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           MC0-3]
          Length = 403

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|119713586|gb|ABL97637.1| ribonucleotide-diphosphate reductase beta subunit [uncultured
           marine bacterium EB0_39H12]
          Length = 412

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 270/337 (80%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV VDDK M+N R+D+NQL+P KY WAW+KYL    NHWMP EV M  D+ALWKS +GLT
Sbjct: 76  RVQVDDKAMINCRADLNQLVPFKYDWAWQKYLDGSANHWMPQEVNMTADIALWKSNDGLT 135

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++ RNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQ FEEA+H+H +QY I
Sbjct: 136 EDERTIVMRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQGFEEAIHTHAYQYCI 195

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLG+DEG +FNMYRE+PS+  KA+W L+YT+ +S P FTTGT + D+  L++L  FY V
Sbjct: 196 ESLGMDEGAIFNMYREIPSVAKKASWGLKYTKEISDPGFTTGTDETDKLLLKNLIAFYCV 255

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID+INQIK+ENPHLW +
Sbjct: 256 LEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQIKLENPHLWDE 315

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           + + ++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIANRR  QIGLE  F+ 
Sbjct: 316 QMRHEAAQMILEGTELEIQYARDTMPRGILGMNAGMMEEYLQFIANRRLVQIGLEEEFEG 375

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 376 ASNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 412


>gi|107021673|ref|YP_620000.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia AU 1054]
 gi|116688619|ref|YP_834242.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia HI2424]
 gi|105891862|gb|ABF75027.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia AU
           1054]
 gi|116646708|gb|ABK07349.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           HI2424]
          Length = 382

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 39  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 98

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 99  KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 158

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 159 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 218

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 219 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 278

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 279 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 338

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 339 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 382


>gi|134294683|ref|YP_001118418.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           vietnamiensis G4]
 gi|134137840|gb|ABO53583.1| Ribonucleoside-diphosphate reductase [Burkholderia vietnamiensis
           G4]
          Length = 403

 Score =  484 bits (1246), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/344 (62%), Positives = 268/344 (77%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVASIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKHAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|167574685|ref|ZP_02367559.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis C6786]
          Length = 369

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/345 (62%), Positives = 268/345 (77%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S   A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 25  SAAVASEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIAL 84

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 85  WKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 144

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT  ADQ+ L+
Sbjct: 145 THAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPAFKTGTLVADQKLLK 204

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+
Sbjct: 205 SLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKL 264

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QI
Sbjct: 265 ENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQI 324

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 325 GLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 369


>gi|323527395|ref|YP_004229548.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
 gi|323384397|gb|ADX56488.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
          Length = 414

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 265/341 (77%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
             E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  
Sbjct: 74  VSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDP 133

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 134 NGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 193

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F TGT +ADQ  L+ L V
Sbjct: 194 QYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIV 253

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP 
Sbjct: 254 FACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQ 313

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+P
Sbjct: 314 LWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDP 373

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 374 LYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 414


>gi|238026167|ref|YP_002910398.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           glumae BGR1]
 gi|237875361|gb|ACR27694.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           glumae BGR1]
          Length = 407

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/339 (62%), Positives = 268/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           ++RVN+ DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 69  QERVNIADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 128

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +++RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 129 LTEDERRIVRRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 188

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI  K  + + +  TL+ P+F TGT+DADQ+ L+ L VF 
Sbjct: 189 IVESLGLDEGEIFNAYHEVSSIRDKDEFLIPFIHTLTDPAFVTGTQDADQKLLKSLIVFA 248

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 249 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 308

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FIANRRC QIGL+PL+
Sbjct: 309 TPEFRAEIRELFKRAVELEYRYAEDTMPRGVLGLNAAMFKSYLRFIANRRCQQIGLDPLY 368

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 369 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|296160506|ref|ZP_06843322.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
 gi|295889255|gb|EFG69057.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
          Length = 415

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/349 (61%), Positives = 265/349 (75%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           N         E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  
Sbjct: 67  NAAAGTAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSR 126

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFE
Sbjct: 127 DIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFE 186

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYI+ SLGLDEGE+FN Y EV SI AK  + + Y   L+ P+F TGT +ADQ
Sbjct: 187 EAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLTDPAFKTGTLEADQ 246

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN
Sbjct: 247 TLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLIN 306

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENP LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRR
Sbjct: 307 QIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRR 366

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 367 CQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 415


>gi|187925407|ref|YP_001897049.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phytofirmans PsJN]
 gi|187716601|gb|ACD17825.1| Ribonucleoside-diphosphate reductase [Burkholderia phytofirmans
           PsJN]
          Length = 415

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 271/362 (74%), Gaps = 11/362 (3%)

Query: 2   ANNTGLSPIQ-----------AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSAC 50
           AN+  ++P+              E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C
Sbjct: 54  ANDMAVAPVAHVTHAAAETAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGC 113

Query: 51  NNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSN 110
            NHWMP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ 
Sbjct: 114 ANHWMPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITA 173

Query: 111 PECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLS 170
           PECRQ+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV SI AK  + + Y   L+
Sbjct: 174 PECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLT 233

Query: 171 SPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRD 230
            P+F TGT +ADQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RD
Sbjct: 234 DPAFKTGTLEADQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRD 293

Query: 231 ESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAP 290
           ES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA 
Sbjct: 294 ESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNAS 353

Query: 291 SCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L 
Sbjct: 354 MFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALT 413

Query: 351 WD 352
           W+
Sbjct: 414 WE 415


>gi|302877617|ref|YP_003846181.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
 gi|302580406|gb|ADL54417.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
          Length = 365

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 215/337 (63%), Positives = 271/337 (80%), Gaps = 1/337 (0%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R+ V+DKR++N ++DVNQL+P KY WAWEKYL+AC NHWMP EV M  D+ALWKS + L+
Sbjct: 30  RIRVEDKRIINCKADVNQLVPFKYKWAWEKYLAACANHWMPQEVNMTADIALWKS-DKLS 88

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           DDER +IKRNLGFF +++SL ANNIVL  YRH++NPECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 89  DDERRLIKRNLGFFTTADSLAANNIVLGSYRHITNPECRQFLLRQAFEEAIHTHAYQYIV 148

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FNMY EVPSI  K  + L Y   L++P F TGT +ADQ  L+ L VF  +
Sbjct: 149 ESLGLDEGEIFNMYHEVPSIRNKDEFLLPYIDVLTNPEFKTGTPEADQALLRSLIVFACI 208

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+HLNFG+D+INQIK+ENPHLWT 
Sbjct: 209 MEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHLNFGVDLINQIKMENPHLWTA 268

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+++ R ++ +   LE AYA +TMP+G +GLNA   ++Y++FIANRRC QIG++ L++ 
Sbjct: 269 AFREEIRGLMQKGVELEYAYAEDTMPRGILGLNATMFKEYLRFIANRRCQQIGVDILYQG 328

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWMSE+IDLKKEKNFFE+RVTEYQ G  L WD
Sbjct: 329 ATNPFPWMSEMIDLKKEKNFFESRVTEYQTGGTLSWD 365


>gi|91785256|ref|YP_560462.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           xenovorans LB400]
 gi|91689210|gb|ABE32410.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans
           LB400]
          Length = 411

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 271/362 (74%), Gaps = 11/362 (3%)

Query: 2   ANNTGLSPIQ-----------AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSAC 50
           AN+  ++P+              E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C
Sbjct: 50  ANDIAVAPVAHVTHAAAGTAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGC 109

Query: 51  NNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSN 110
            NHWMP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ 
Sbjct: 110 ANHWMPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITA 169

Query: 111 PECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLS 170
           PECRQ+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV SI AK  + + Y   L+
Sbjct: 170 PECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLT 229

Query: 171 SPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRD 230
            P+F TGT +ADQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RD
Sbjct: 230 DPAFKTGTLEADQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRD 289

Query: 231 ESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAP 290
           ES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA 
Sbjct: 290 ESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNAS 349

Query: 291 SCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L 
Sbjct: 350 MFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALT 409

Query: 351 WD 352
           W+
Sbjct: 410 WE 411


>gi|170695324|ref|ZP_02886470.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
 gi|170139724|gb|EDT07906.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
          Length = 414

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 215/339 (63%), Positives = 263/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 76  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 135

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 136 LTEDERRVVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 195

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P F TGT + DQ  L+ L VF 
Sbjct: 196 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYINVLTDPGFKTGTLETDQTLLRSLIVFA 255

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 256 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 315

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 316 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 375

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 376 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 414


>gi|291615085|ref|YP_003525242.1| ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585197|gb|ADE12855.1| Ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
          Length = 382

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 211/337 (62%), Positives = 268/337 (79%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R+ V+DKR++N+ +DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK+ NGLT
Sbjct: 46  RIRVEDKRIINSSADVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSADIALWKNPNGLT 105

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           DDER ++KRNLGFF +++SL ANNI L  YRH++NPECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 106 DDERRLVKRNLGFFTTADSLAANNIALGTYRHITNPECRQFLLRQAFEEAIHTHAYQYIV 165

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FNMY EV SI  K  + L +   L++P F TGT + DQ+ L+ L VF  +
Sbjct: 166 ESLGLDEGEVFNMYHEVQSIRDKDEFLLPFIDVLTNPDFKTGTPENDQKLLRSLIVFACI 225

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+HLNFG+DVINQIK+ENPHLWT 
Sbjct: 226 MEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHLNFGVDVINQIKLENPHLWTP 285

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+++ R ++ +   LE  YA +TMP+G +GLNA   ++Y++FIANRRC QIG++ L++ 
Sbjct: 286 AFREEVRGLIQKGVELEYRYAEDTMPRGVLGLNAGMFKEYLRFIANRRCQQIGVDMLYQG 345

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWM+E+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 346 ATNPFPWMAEMIDLKKEKNFFETRVTEYQTGGALSWD 382


>gi|297538242|ref|YP_003674011.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
 gi|297257589|gb|ADI29434.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
          Length = 376

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/344 (61%), Positives = 268/344 (77%), Gaps = 2/344 (0%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P  +G  RVN  DKRM+N ++DVNQL+P KY WAW+KYL+ C NHWMP EV M  D+A W
Sbjct: 35  PSHSG--RVNASDKRMINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEVSMSRDIAQW 92

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K    L+DDERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQ FEEA+H+
Sbjct: 93  KDSTALSDDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQGFEEAIHT 152

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDE E+FN Y+E+PSI AK ++ + +  TL+ P+F TGT +ADQE L+ 
Sbjct: 153 HAYQYIVESLGLDESEVFNAYQEIPSIKAKDDFLIPFINTLTDPAFKTGTAEADQELLRS 212

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVIN IK+E
Sbjct: 213 LIVFACIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDVINTIKLE 272

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+++ +T++ +   LE  YA  TMP+G +GLNA   ++Y++FIANRRC QIG
Sbjct: 273 NPHLWTAEFREEIKTLMQKGVELEYQYAEATMPRGVLGLNATMFKEYLRFIANRRCTQIG 332

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+ L+    NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 333 LDVLYPGATNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 376


>gi|167586060|ref|ZP_02378448.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ubonensis Bu]
          Length = 403

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 266/337 (78%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGLT
Sbjct: 67  RVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGLT 126

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 127 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 186

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ L VF  +
Sbjct: 187 ESLGLDEGEIFNAYHEVASIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACI 246

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT 
Sbjct: 247 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTA 306

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+  
Sbjct: 307 EFRAEIRELFKQAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPN 366

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 367 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|186477386|ref|YP_001858856.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phymatum STM815]
 gi|184193845|gb|ACC71810.1| Ribonucleoside-diphosphate reductase [Burkholderia phymatum STM815]
          Length = 407

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 265/340 (77%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
            E RVNV DKR++N ++DVNQL+P KY WAWEKYLS C NHWMP E+ M  D+ALWK  N
Sbjct: 68  SEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLSGCANHWMPQEINMSRDIALWKDPN 127

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +Q
Sbjct: 128 GLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQ 187

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y EV SI  K  + + +  TL+ P+F TGT +ADQ+ L+ L VF
Sbjct: 188 YIVESLGLDEGEIFNAYHEVQSIRDKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVF 247

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHL
Sbjct: 248 ACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHL 307

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG++PL
Sbjct: 308 WTPEFRAEIREIFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGIDPL 367

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 368 YPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|33593916|ref|NP_881560.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           pertussis Tohama I]
 gi|33598411|ref|NP_886054.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           parapertussis 12822]
 gi|33603351|ref|NP_890911.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           bronchiseptica RB50]
 gi|33563990|emb|CAE43255.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           pertussis Tohama I]
 gi|33574540|emb|CAE39187.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           parapertussis]
 gi|33577475|emb|CAE34740.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           bronchiseptica RB50]
 gi|332383335|gb|AEE68182.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           pertussis CS]
          Length = 398

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 271/351 (77%), Gaps = 2/351 (0%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A + G S   AG  RV V DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M
Sbjct: 50  AASLGASDATAG--RVKVADKRIINGETDVNQLVPFKYKWAWEKYLATCANHWMPQEINM 107

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 108 SRDIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 167

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +A
Sbjct: 168 FEEAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFHTGTPEA 227

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+
Sbjct: 228 DQKLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDL 287

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           IN IK+ENPHLWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIAN
Sbjct: 288 INTIKLENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIAN 347

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC QIG+EPLF   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 348 RRCQQIGIEPLFPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 398


>gi|255019430|ref|ZP_05291537.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254971128|gb|EET28583.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 345

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 272/337 (80%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV V+DKR++N R+DVNQL+P KY WAW+KYL+AC NHWMP EV M  D+ALWK   GLT
Sbjct: 8   RVRVEDKRIINGRADVNQLVPFKYQWAWDKYLAACANHWMPQEVQMARDIALWKDPKGLT 67

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 68  EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 127

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FNMY EVPS+ AK  + + + +TL+ P F TGT++ DQ+ L+ L VF  +
Sbjct: 128 ESLGLDEGEIFNMYHEVPSVRAKDEFLIPFIETLADPDFQTGTRENDQKLLRSLIVFATI 187

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+INQIK+ENP LWT+
Sbjct: 188 MEGLFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTE 247

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            FQQ+   ++ +   LE AYA +TMP+G +GLNAP  ++Y+++I NRR  QIGL+P ++ 
Sbjct: 248 GFQQEIVGLIRQGVELECAYADDTMPRGILGLNAPMFKEYVRYIGNRRLSQIGLKPQWEN 307

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +NPFPWMSE++DLKKEKNFFE+RVT+YQ G  L WD
Sbjct: 308 VQNPFPWMSEMMDLKKEKNFFESRVTDYQTGGALSWD 344


>gi|330815478|ref|YP_004359183.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
 gi|327367871|gb|AEA59227.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
          Length = 407

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 270/349 (77%), Gaps = 4/349 (1%)

Query: 8   SPIQAG----EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           +P QA     ++RVN+ DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  
Sbjct: 59  APAQASAAGSQERVNIADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSR 118

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFE
Sbjct: 119 DIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFE 178

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYI+ SLGLDEGE+FN Y E+ SI  K  + + +  TL+ P+F TGT +ADQ
Sbjct: 179 EAIHTHAYQYIVESLGLDEGEMFNAYHEITSIRDKDEFLIPFIHTLTDPAFVTGTPEADQ 238

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN
Sbjct: 239 KLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLIN 298

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FIANRR
Sbjct: 299 QIKLENPHLWTPEFRAEIRELFKHAVELEYRYAEDTMPRGVLGLNASMFKSYLRFIANRR 358

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL+ L+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 359 CQQIGLDALYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|300703002|ref|YP_003744604.1| ribonucleoside diphosphate reductase 1 subunit beta, ferritin-like
           [Ralstonia solanacearum CFBP2957]
 gi|299070665|emb|CBJ41960.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CFBP2957]
          Length = 402

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/352 (61%), Positives = 267/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 52  LGNNPNAAAAQSN-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 110

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 111 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 170

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 171 AFEEAIHTHAYQYIVESLGLDEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 230

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 231 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 290

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 291 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFIC 350

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 351 NRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 402


>gi|163854887|ref|YP_001629185.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           petrii DSM 12804]
 gi|163258615|emb|CAP40914.1| ribonucleoside-diphosphate reductase beta chain [Bordetella petrii]
          Length = 396

 Score =  477 bits (1228), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 268/341 (78%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ 
Sbjct: 56  AAAHRVKVADKRIINGKTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNP 115

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 116 NGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 175

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SL LDE E+FN Y EVPSI AK  + + + + ++ P+F TGT ++DQ+ L+ L V
Sbjct: 176 QYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIEAIADPTFHTGTPESDQKLLKSLIV 235

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN IK+ENPH
Sbjct: 236 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKLENPH 295

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EP
Sbjct: 296 LWTPEFREEIRGLFQKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEP 355

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 356 LYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 396


>gi|317402620|gb|EFV83180.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans C54]
          Length = 399

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 267/341 (78%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A  +RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ 
Sbjct: 59  ATSQRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNP 118

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 119 NGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 178

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L V
Sbjct: 179 QYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEADQTLLKSLIV 238

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN +K+ENPH
Sbjct: 239 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTVKLENPH 298

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EP
Sbjct: 299 LWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEP 358

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 359 LYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 399


>gi|325983070|ref|YP_004295472.1| ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
 gi|325532589|gb|ADZ27310.1| Ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
          Length = 381

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 211/346 (60%), Positives = 270/346 (78%), Gaps = 2/346 (0%)

Query: 9   PIQAGE--KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           P  AG   +R+ V+DK+++N  +DVNQL+P KY WAW+KYL AC NHWMP E+ M  D+A
Sbjct: 36  PAVAGSANRRIAVEDKQIINCNADVNQLVPFKYKWAWDKYLGACANHWMPQEISMSRDIA 95

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
           LW+  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+
Sbjct: 96  LWRDPNGLTEDERRLVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAI 155

Query: 127 HSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           H+H +QYI+ SLGLDEGE+FN Y EV SI  K  + + +  TL++P F TGT + DQ+ L
Sbjct: 156 HTHAYQYIVESLGLDEGEIFNAYHEVSSIRDKDEFLIPFIDTLTNPHFKTGTLETDQQLL 215

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVINQIK
Sbjct: 216 RSLIVFACIMEGLFFYVGFTQILALGRQNKMTGSAEQYQYILRDESMHCNFGIDVINQIK 275

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
           +ENP LWTK F+++   ++ +A  LE  YA +TMP+G +G+NAP  ++Y+++IANRRC Q
Sbjct: 276 MENPQLWTKAFREEIAALMQKAVALEYRYAEDTMPRGVLGMNAPMFKEYLRYIANRRCQQ 335

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           IGL+ L+    NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 336 IGLDTLYPNANNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 381


>gi|83746810|ref|ZP_00943858.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|207721465|ref|YP_002251905.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
 gi|83726579|gb|EAP73709.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|206586625|emb|CAQ17211.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
          Length = 402

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 267/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 52  LGNNPNAAAAQSN-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 110

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 111 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 170

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 171 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 230

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 231 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 290

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 291 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFIC 350

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 351 NRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 402


>gi|207744360|ref|YP_002260752.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595765|emb|CAQ62692.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
          Length = 410

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 267/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 60  LGNNPNAAAAQSN-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 118

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 119 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 178

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 179 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 238

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 239 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 298

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 299 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFIC 358

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 359 NRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 410


>gi|187479453|ref|YP_787478.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella avium
           197N]
 gi|115424040|emb|CAJ50593.1| ribonucleoside-diphosphate reductase beta chain [Bordetella avium
           197N]
          Length = 394

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 209/338 (61%), Positives = 266/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ NGL
Sbjct: 57  QRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNGL 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 117 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 176

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L VF  
Sbjct: 177 VESLDLDESEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEADQTLLKSLIVFAC 236

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN IK+ENPHLWT
Sbjct: 237 LMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWT 296

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+ 
Sbjct: 297 PEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYP 356

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 357 QEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 394


>gi|152980709|ref|YP_001354668.1| ribonucleotide-diphosphate reductase subunit beta
           [Janthinobacterium sp. Marseille]
 gi|151280786|gb|ABR89196.1| ribonucleoside-diphosphate reductase beta chain [Janthinobacterium
           sp. Marseille]
          Length = 392

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 269/338 (79%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +R++  DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D+ LWK+ NGL
Sbjct: 55  RRMDAADKRVINGQTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRDIELWKNPNGL 114

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 115 TDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYI 174

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EV SI  K  + + + +TL+ P F TGT + DQ+ L+ L VF  
Sbjct: 175 VESLGLDEGEIFNAYNEVESIRDKDQFLIPFIETLTDPEFKTGTTENDQKLLRSLIVFAC 234

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GFAQIL+LGR NKM+G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT
Sbjct: 235 LMEGLFFYVGFAQILALGRQNKMMGAAEQYQYILRDESMHCNFGIDLINTIKLENPHLWT 294

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            +F+++ +T+   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+F+
Sbjct: 295 PQFREEIKTLFLRAVELEYRYAEDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPMFE 354

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 355 QEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALNWE 392


>gi|311103857|ref|YP_003976710.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
 gi|310758546|gb|ADP13995.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
          Length = 399

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 208/338 (61%), Positives = 266/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ NGL
Sbjct: 62  QRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNGL 121

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 122 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 181

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L VF  
Sbjct: 182 VESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEADQTLLKSLIVFAC 241

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN +K+ENPHLWT
Sbjct: 242 LMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLWT 301

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+ 
Sbjct: 302 PEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYP 361

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 362 QEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 399


>gi|226940720|ref|YP_002795794.1| ribonucleotide-diphosphate reductase subunit beta [Laribacter
           hongkongensis HLHK9]
 gi|226715647|gb|ACO74785.1| Ribonucleoside-diphosphate reductase beta chain [Laribacter
           hongkongensis HLHK9]
          Length = 357

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 267/349 (76%), Gaps = 1/349 (0%)

Query: 5   TGLSPIQAGEK-RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
             +SP  +G   RVN  DKR++N  +DVNQL+P KY WAW+KYL+ C NHWMP EV MQ 
Sbjct: 9   VAVSPAGSGTGGRVNAVDKRIINGDTDVNQLVPFKYHWAWDKYLATCANHWMPQEVNMQR 68

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ LWK  NGLTDDER ++ RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFE
Sbjct: 69  DIELWKRPNGLTDDERRIVIRNLGFFTTADSLAANNIVLGTYRHITAPECRQFLLRQAFE 128

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYI+ SLGLDEGE+FN Y E+ SI AK  + + +  TL  P+F TGT ++DQ
Sbjct: 129 EAIHTHAYQYIVESLGLDEGEVFNAYHEIASIRAKDEFLIPFIDTLCDPAFKTGTPESDQ 188

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN
Sbjct: 189 LLLKSLIVFACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLIN 248

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            IK ENPHLWT EFQ++   +  +A  LE AYA +TMP+G +GLNA   ++Y+ FIANRR
Sbjct: 249 SIKQENPHLWTVEFQEELYGLFRKAIDLEYAYAEDTMPRGVLGLNAAMFKEYLDFIANRR 308

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             QIGLEPLF + +NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 309 MQQIGLEPLFTHVDNPFPWMSEMIDLKKEKNFFETRVTEYQSGGALDWD 357


>gi|134095932|ref|YP_001101007.1| ribonucleotide-diphosphate reductase subunit beta [Herminiimonas
           arsenicoxydans]
 gi|133739835|emb|CAL62886.1| Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide
           reductase small subunit) [Herminiimonas arsenicoxydans]
          Length = 395

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/360 (59%), Positives = 274/360 (76%), Gaps = 9/360 (2%)

Query: 2   ANNTGLSP-IQAGE--------KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNN 52
           A +  L P + AG+        +R++  DKR++N ++DVNQL+P KY WAW+KYL+ C N
Sbjct: 36  AQDVALDPAVMAGKPAATVDPTRRMDAADKRIINGKTDVNQLVPFKYKWAWDKYLAGCAN 95

Query: 53  HWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPE 112
           HWMP E+ MQ D+ LWK+ NGLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PE
Sbjct: 96  HWMPQEINMQRDIELWKNPNGLTDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPE 155

Query: 113 CRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSP 172
           CRQYLLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y E+ SI  K  + + +   L+ P
Sbjct: 156 CRQYLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYNEIESIRDKDQFLIPFIDVLTDP 215

Query: 173 SFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDES 232
           +FTTGT + DQ  L+ L VF  + EG++FY GFAQIL+LGR NKM+G AEQYQYI+RDES
Sbjct: 216 NFTTGTTENDQTLLRSLIVFACLMEGLFFYVGFAQILALGRQNKMMGAAEQYQYILRDES 275

Query: 233 LHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSC 292
           +H NFGID+IN IK+ENPHLWT +F+ + + +   A  LE  YA +TMP+G +GLNAP  
Sbjct: 276 MHCNFGIDLINTIKLENPHLWTPQFRDEIKALFLRAVELEYRYAEDTMPRGVLGLNAPMF 335

Query: 293 EQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           + Y++FIANRR  QIGLEP+F+  ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 336 KGYLRFIANRRAQQIGLEPMFEQEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALNWE 395


>gi|332286774|ref|YP_004418685.1| ribonucleoside-diphosphate reductase beta chain [Pusillimonas sp.
           T7-7]
 gi|330430727|gb|AEC22061.1| ribonucleoside-diphosphate reductase beta chain [Pusillimonas sp.
           T7-7]
          Length = 387

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 212/356 (59%), Positives = 268/356 (75%), Gaps = 7/356 (1%)

Query: 4   NTGLSPIQA-------GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMP 56
           N  ++P  A       G  RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP
Sbjct: 32  NDAMAPTPAAAGSTADGSGRVRAADKRIINGKTDVNQLVPFKYKWAWEKYLATCANHWMP 91

Query: 57  TEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQY 116
            E+ M  D++LWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+
Sbjct: 92  QEINMSRDISLWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQF 151

Query: 117 LLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT 176
           LLRQAFEEA+H+H +QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P F T
Sbjct: 152 LLRQAFEEAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPHFQT 211

Query: 177 GTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLN 236
           GT +ADQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H N
Sbjct: 212 GTPEADQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCN 271

Query: 237 FGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           FGID+IN IK+ENPHLWT EF+++ R +  +A  LE AYA +TMP+G +GLNA   + Y+
Sbjct: 272 FGIDLINTIKLENPHLWTAEFREELRELFKKAVDLEYAYAEDTMPRGVLGLNASMFKSYL 331

Query: 297 QFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +FIANRRC QIGLEPLF   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 332 RFIANRRCQQIGLEPLFGQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGALSWE 387


>gi|293603286|ref|ZP_06685715.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
 gi|292818321|gb|EFF77373.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
          Length = 398

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 264/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV V DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ NGL
Sbjct: 61  QRVKVADKRIINGETDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNGL 120

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 121 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 180

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L VF  
Sbjct: 181 VESLDLDEAEIFNAYNEVPSIRAKDQFLIPFIDAIADPNFKTGTPEADQTLLKSLIVFAC 240

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN +K+ENPHLWT
Sbjct: 241 LMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLWT 300

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
             F+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+ 
Sbjct: 301 PAFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYP 360

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 361 QEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 398


>gi|194290770|ref|YP_002006677.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224605|emb|CAQ70616.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Cupriavidus taiwanensis LMG 19424]
          Length = 396

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 46  LGNNPNAAAAQSN-RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 104

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 105 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 164

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 165 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 224

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 225 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 284

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 285 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFIC 344

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 345 NRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 396


>gi|94312018|ref|YP_585228.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           metallidurans CH34]
 gi|93355870|gb|ABF09959.1| Ribonucleoside-diphosphate reductase beta subunit [Cupriavidus
           metallidurans CH34]
          Length = 395

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 45  LGNNPNAAAAQS-TRRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 103

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 104 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 163

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 164 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 223

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 224 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 283

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 284 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFIC 343

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 344 NRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 395


>gi|300309722|ref|YP_003773814.1| transmembrane ribonucleoside reductase small subunit
           [Herbaspirillum seropedicae SmR1]
 gi|300072507|gb|ADJ61906.1| transmembrane ribonucleoside reductase (small chain) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 388

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/358 (59%), Positives = 272/358 (75%), Gaps = 8/358 (2%)

Query: 3   NNTGLSP-IQAGE-------KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHW 54
           +N  L+P + AG        +RVN  DKR++N  +DVNQL+P KY WAW+KYL+ C NHW
Sbjct: 31  SNAALNPALMAGNSEQVDTTRRVNAADKRIINGHTDVNQLVPFKYKWAWDKYLAGCANHW 90

Query: 55  MPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECR 114
           MP E+ MQ D+ LWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECR
Sbjct: 91  MPQEINMQRDIELWKNPNGLTEDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECR 150

Query: 115 QYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           QYLLRQAFEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + +  TL+ P F
Sbjct: 151 QYLLRQAFEEAIHTHAYQYIVESLGLDEAEIFNAYHEVASIRDKDEFLIPFIDTLTDPEF 210

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
            TGT + DQ+ L+ L VF  + EG++FY GF QIL+LGR NKM+G AEQYQYI+RDES+H
Sbjct: 211 KTGTMENDQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMMGAAEQYQYILRDESMH 270

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            NFGID+IN +K+ENPHLWT EF+++ +++   A  LE  YA +TMP+G +GLNAP  + 
Sbjct: 271 CNFGIDLINTVKMENPHLWTPEFREEIKSLFLRAVELEYRYAEDTMPRGVLGLNAPMFKS 330

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Y++FIANRR  QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 331 YLRFIANRRAQQIGLDPLFAQEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 388


>gi|113869188|ref|YP_727677.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha H16]
 gi|113527964|emb|CAJ94309.1| Ribonucleoside-diphosphate reductase beta subunit [Ralstonia
           eutropha H16]
          Length = 395

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 58  RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 117

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 118 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 177

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 178 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 237

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 238 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 297

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 298 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFP 357

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 358 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 395


>gi|73542624|ref|YP_297144.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha JMP134]
 gi|72120037|gb|AAZ62300.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134]
          Length = 394

 Score =  471 bits (1211), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 265/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 44  LGNNPNAAAAQSN-RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 102

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 103 MSRDIATWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 162

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 163 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 222

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 223 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 282

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 283 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFIC 342

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 343 NRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 394


>gi|299065648|emb|CBJ36820.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CMR15]
          Length = 398

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 48  LGNNPNAAAAQSS-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 106

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 107 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 166

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 167 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 226

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 227 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 286

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 287 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFIC 346

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   +NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 347 NRRCQQIGLDALFPNEDNPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 398


>gi|329902475|ref|ZP_08273120.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548767|gb|EGF33404.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 416

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 262/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +R+N  DKR++N  +DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D+ LWKS NGL
Sbjct: 79  RRMNAADKRIINGNTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRDIELWKSPNGL 138

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 139 TDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYI 198

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
             SLGLDE E+FN Y EV SI  K  + + +   L+ P FTTGT   DQ+ L+ L VF  
Sbjct: 199 TESLGLDEAEIFNAYHEVKSIRDKDEFLIPFIDALTDPLFTTGTTINDQKLLKSLIVFSC 258

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GFAQIL+LGR NKMVG AEQYQYI+RDES+H NFGID++N IK+ENPHLWT
Sbjct: 259 LMEGLFFYVGFAQILALGRQNKMVGAAEQYQYILRDESMHCNFGIDLVNTIKMENPHLWT 318

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + + +   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+F+
Sbjct: 319 PEFRDEIKALFLTAVELEYRYAEDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPMFE 378

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 379 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 416


>gi|17547523|ref|NP_520925.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           solanacearum GMI1000]
 gi|17429827|emb|CAD16511.1| putative transmembrane ribonucleoside reductase (small chain)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 400

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 50  LGNNPNAAAAQSS-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 108

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 109 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 168

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 169 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 228

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 229 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 288

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 289 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFIC 348

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   +NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 349 NRRCQQIGLDALFPNEDNPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 400


>gi|253997287|ref|YP_003049351.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
 gi|253983966|gb|ACT48824.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
          Length = 377

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 265/349 (75%), Gaps = 4/349 (1%)

Query: 8   SPIQAGEK----RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           +P+ A +     RVN  DKRM+N ++DVNQL+P KY WAW+KYL+ C NHWMP EV M  
Sbjct: 29  TPVAANQPSISGRVNASDKRMINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEVSMSR 88

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+A WK    LTDDERL++KRNLGFF +++SL ANNIVL  YRH++ PE RQYLLRQ FE
Sbjct: 89  DIAQWKDSTALTDDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPEARQYLLRQGFE 148

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYI+ SLGLDE E+FN Y+EV SI  K ++ + +  TL++P F TGT +ADQ
Sbjct: 149 EAIHTHAYQYIVESLGLDESEVFNAYQEVASIKDKDDFLIPFINTLTNPEFKTGTAEADQ 208

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVIN
Sbjct: 209 QLLRSLIVFACIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDVIN 268

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            IK+ENPHLWT EF+ + + ++     LE  YA  TMP+G +GLNA   ++Y++FIANRR
Sbjct: 269 TIKLENPHLWTAEFRDEIKGLIQHGVELEYRYAEATMPRGVLGLNATMFKEYLRFIANRR 328

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL+ L++   NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 329 CQQIGLDVLYQGATNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 377


>gi|300690381|ref|YP_003751376.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
 gi|299077441|emb|CBJ50067.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
          Length = 402

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 52  LGNNPNAAAAQSN-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 110

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 111 MSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 170

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 171 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 230

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 231 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 290

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 291 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFIC 350

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 351 NRRCQQIGLDALFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|255019898|ref|ZP_05291973.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970678|gb|EET28165.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 374

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/338 (61%), Positives = 267/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP EV M  D+ALWK   GL
Sbjct: 37  ERVRAEDKRIINGSADVNQLVPFKYHWAWDKYLAACANHWMPQEVQMARDIALWKDPKGL 96

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 97  TEDERRIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYI 156

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPSI AK  + L + +TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 157 VESIGLDEGEIFNMYHEVPSIRAKDEFLLPFIRTLTDPSFHTGTPENDQKLLRSLIVFAA 216

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+INQIK+ENP LWT
Sbjct: 217 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDLINQIKVENPDLWT 276

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQ++  +++ +   LE AYA +TMP+G +GLNAP  + Y+++I NRR  Q+GL   + 
Sbjct: 277 EPFQEEIVSLIRKGVELECAYADDTMPRGVLGLNAPIFKDYVKYIGNRRLQQLGLPVQWA 336

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 337 GIQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 374


>gi|89902117|ref|YP_524588.1| ribonucleotide-diphosphate reductase subunit beta [Rhodoferax
           ferrireducens T118]
 gi|89346854|gb|ABD71057.1| Ribonucleoside-diphosphate reductase [Rhodoferax ferrireducens
           T118]
          Length = 400

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/351 (60%), Positives = 267/351 (76%), Gaps = 1/351 (0%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           AN  G + +    +RVN  DKR++N ++DVNQL+P KY WAWEKYLS+C NHWMP EV M
Sbjct: 51  ANQRG-AAVSISPRRVNAADKRIINGKTDVNQLVPFKYKWAWEKYLSSCANHWMPQEVNM 109

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 110 TRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 169

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT +A
Sbjct: 170 FEEAIHTHAYQYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPAFKTGTHEA 229

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ  L+ L VF  + EG++FY GFAQIL+LGR NKM G AEQYQYI+RDES+H NFGID+
Sbjct: 230 DQTLLKSLIVFACLMEGLFFYVGFAQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDL 289

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQ+K+ENP LWT EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IAN
Sbjct: 290 INQLKLENPQLWTSEFKAEIKALFEQAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIAN 349

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  QIGLE LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 350 RRATQIGLETLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 400


>gi|145588393|ref|YP_001154990.1| ribonucleotide-diphosphate reductase subunit beta [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046799|gb|ABP33426.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 394

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/354 (59%), Positives = 268/354 (75%), Gaps = 6/354 (1%)

Query: 5   TGLSPIQAGEK------RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTE 58
           T  +P++A         RVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP E
Sbjct: 41  TAPAPVEAANLSGGAALRVNAADKRVINAKTDVNQLVPFKYKWAWEKYLAGCANHWMPQE 100

Query: 59  VPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLL 118
           + M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQYLL
Sbjct: 101 INMNRDIALWKDPNGLTEDERRIIKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLL 160

Query: 119 RQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
           RQAFEEA+H+H +QYI+ SLGLD+ E+FN Y E+ SI AK  + + Y   L++P+F TGT
Sbjct: 161 RQAFEEAIHTHAYQYIVESLGLDQSEIFNAYNEIESIRAKDEFLIPYIDVLTNPNFKTGT 220

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            + DQ  L+ L VF  V EG++FY GF QIL++GR NKM G AEQYQYI+RDES+H NFG
Sbjct: 221 LETDQTLLRSLIVFACVMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESMHCNFG 280

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
           ID+INQIK+ENP LWT  F+ + +++  +A  LE  YA +TMP+G +GLNAP  + Y+++
Sbjct: 281 IDLINQIKLENPQLWTSAFKDEIKSIFEKAVELEYRYAEDTMPRGVLGLNAPMFKGYLRY 340

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           I NRRC QIGL+ +F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 341 ICNRRCLQIGLDAMFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 394


>gi|187930114|ref|YP_001900601.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12J]
 gi|187727004|gb|ACD28169.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12J]
          Length = 402

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 265/352 (75%), Gaps = 1/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + NN   +  Q+  +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ 
Sbjct: 52  LGNNPNAAAAQSN-RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEIN 110

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQ
Sbjct: 111 MSRDIATWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQ 170

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT +
Sbjct: 171 AFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPE 230

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID
Sbjct: 231 NDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGID 290

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI 
Sbjct: 291 LINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFIC 350

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 351 NRRCQQIGLDALFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|241664219|ref|YP_002982579.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12D]
 gi|309783064|ref|ZP_07677783.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|240866246|gb|ACS63907.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|308918172|gb|EFP63850.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 402

 Score =  468 bits (1203), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|158341282|ref|YP_001522354.1| ribonucleotide-diphosphate reductase subunit beta [Acaryochloris
           marina MBIC11017]
 gi|158311523|gb|ABW33134.1| ribonucleoside-diphosphate reductase, beta subunit [Acaryochloris
           marina MBIC11017]
          Length = 384

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 205/338 (60%), Positives = 263/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +R+NV DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+ALWK+ +GL
Sbjct: 47  RRINVADKRIINGQTDVNQLVPFKYQWAWDKYLAGCANHWMPQEINMSRDIALWKTTDGL 106

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 107 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYI 166

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN YREV  I  K  + + + +TL+ P+F TGT + DQ+ L+ L  F  
Sbjct: 167 VESLGLDEGEIFNAYREVDCIREKDEFLIPFVETLTDPTFETGTPENDQKLLKSLIAFSC 226

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID++N IK ENPHLWT
Sbjct: 227 LMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLVNAIKQENPHLWT 286

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF ++ R +   A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGL+P+F 
Sbjct: 287 PEFCEEIRDLFKRAVELEYRYAEDTMPRGVLGLNASMFKSYLRYIANRRSQQIGLDPIFA 346

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE++DLKKE+NFFETRV EYQ G  L WD
Sbjct: 347 SEENPFPWMSEMVDLKKERNFFETRVLEYQTGGALSWD 384


>gi|332526550|ref|ZP_08402662.1| ribonucleotide-diphosphate reductase subunit beta [Rubrivivax
           benzoatilyticus JA2]
 gi|332110818|gb|EGJ10995.1| ribonucleotide-diphosphate reductase subunit beta [Rubrivivax
           benzoatilyticus JA2]
          Length = 385

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 211/353 (59%), Positives = 265/353 (75%), Gaps = 5/353 (1%)

Query: 5   TGLSPIQ-----AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           T  SP+      A  +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV
Sbjct: 33  TNASPVSRPAATAHTRRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEV 92

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLR
Sbjct: 93  NMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLR 152

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           QAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV +I  K  + + +   +  P+F+TGT 
Sbjct: 153 QAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVAAIRDKDEFLIPFIDAIMDPAFSTGTP 212

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +ADQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGI
Sbjct: 213 EADQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGI 272

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           D+INQIK+ENP LWT  F+ + R +   A  LE  YA +TMP+G +G+NA   + Y+++I
Sbjct: 273 DLINQIKLENPQLWTPAFKAEIRALFERAVELEYRYAEDTMPRGVLGMNASMFKGYLRYI 332

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           ANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFFETRV +YQ G  L WD
Sbjct: 333 ANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFFETRVIDYQSGGALSWD 385


>gi|160896947|ref|YP_001562529.1| ribonucleotide-diphosphate reductase subunit beta [Delftia
           acidovorans SPH-1]
 gi|160362531|gb|ABX34144.1| Ribonucleoside-diphosphate reductase [Delftia acidovorans SPH-1]
          Length = 363

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 262/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 26  KRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMNRDIALWKDPNGL 85

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 86  TEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 145

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EVPSI  K  + + + + +  P+F TGT + DQ  L+ L VF  
Sbjct: 146 VESLGLDEGEIFNAYLEVPSIRDKDEFLIPFIEAIMDPAFKTGTFETDQTLLKSLIVFAC 205

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT
Sbjct: 206 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWT 265

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+++   +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 266 PEFKEEITALFVKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFP 325

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 326 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|299533977|ref|ZP_07047329.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
 gi|298717886|gb|EFI58891.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
          Length = 363

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/338 (61%), Positives = 261/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 26  KRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 85

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 86  TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 145

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + DQ  L+ L VF  
Sbjct: 146 VESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPETDQTLLKSLIVFAC 205

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT
Sbjct: 206 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWT 265

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+Q+   +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 266 AEFKQEITELFQKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFP 325

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 326 GEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|221065168|ref|ZP_03541273.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
 gi|220710191|gb|EED65559.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
          Length = 363

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/338 (61%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 26  KRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 85

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 86  TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 145

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + DQ  L+ L VF  
Sbjct: 146 VESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPETDQTLLKSLIVFAC 205

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT
Sbjct: 206 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWT 265

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+Q+   +   A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 266 AEFKQEITELFQRAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFP 325

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 326 GEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|241764092|ref|ZP_04762129.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
 gi|241366556|gb|EER61044.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
          Length = 398

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/338 (61%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 61  RRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 120

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 121 TDDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 180

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT +ADQ  L+ L VF  
Sbjct: 181 VESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFKTGTPEADQRLLKSLIVFAC 240

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT
Sbjct: 241 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWT 300

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + + +   A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 301 AEFKAEIKALFMRAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLETLFP 360

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 361 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 398


>gi|121595925|ref|YP_987821.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax sp.
           JS42]
 gi|222112113|ref|YP_002554377.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           ebreus TPSY]
 gi|120608005|gb|ABM43745.1| Ribonucleoside-diphosphate reductase [Acidovorax sp. JS42]
 gi|221731557|gb|ACM34377.1| Ribonucleoside-diphosphate reductase [Acidovorax ebreus TPSY]
          Length = 396

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 262/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV+  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 59  RRVSAVDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 118

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 119 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 178

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EV SI  K  + + + + +  P FTTGT ++DQ  L+ L VF  
Sbjct: 179 VESLGLDEGEIFNAYNEVQSIRDKDEFLIPFIEAIMDPRFTTGTPESDQTLLKSLIVFAC 238

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT
Sbjct: 239 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWT 298

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 299 AEFKDEIKALFIKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFP 358

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 359 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 396


>gi|91787004|ref|YP_547956.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas sp.
           JS666]
 gi|91696229|gb|ABE43058.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666]
          Length = 406

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/337 (61%), Positives = 258/337 (76%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 70  RVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLT 129

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI 
Sbjct: 130 EDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIT 189

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y EV SI  K  + + + + +S P F TGT +ADQ  L+ L VF  +
Sbjct: 190 ESLGLDEAEIFNAYNEVQSIKDKDQFLIPFIEVISDPHFKTGTTEADQTLLKSLIVFACL 249

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT 
Sbjct: 250 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTA 309

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE LF  
Sbjct: 310 EFKAEIKALFLKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLETLFPN 369

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 370 EENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 406


>gi|326315613|ref|YP_004233285.1| ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372449|gb|ADX44718.1| Ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 387

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/341 (60%), Positives = 261/341 (76%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A  +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  
Sbjct: 47  AQHRRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDP 106

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 107 NGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 166

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P F TGT + DQ  L+ L V
Sbjct: 167 QYIVESLGLDESEIFNAYNEVDSIRNKDEFLIPFIEAIMDPDFKTGTPETDQTLLKSLIV 226

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPH
Sbjct: 227 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPH 286

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+++ + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE 
Sbjct: 287 LWTAEFKEEIKGLFMKAVELEYQYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEA 346

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 347 LFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|294339031|emb|CAZ87378.1| putative Ribonucleoside-diphosphate reductase (ribonucleoside
           diphosphate reductase, beta subunit) [Thiomonas sp. 3As]
          Length = 410

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 264/345 (76%), Gaps = 4/345 (1%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   RV  +DKR++N   DVNQL+P KY WAW+KYL++C NHWMP EV M  D+A+WK  
Sbjct: 66  ASTARVRAEDKRIINCSVDVNQLVPFKYKWAWDKYLASCANHWMPQEVNMSRDIAMWKDP 125

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLTDDERL+IKRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +
Sbjct: 126 NGLTDDERLIIKRNLGFFTTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAY 185

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT----GTKDADQEFLQ 187
           QYI+ S+GLDE E+FN Y E+ SI  K  + + +  TL++P F T    G++  DQE L+
Sbjct: 186 QYIVESIGLDESEIFNSYHEITSIREKDEFLIPFIDTLTNPEFRTSAFGGSERNDQELLR 245

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            + VF  + EG++FY GF QILS+GR NKM G AEQYQYI+RDES+H NFGID++NQIK+
Sbjct: 246 SIIVFACLMEGLFFYVGFTQILSMGRQNKMTGAAEQYQYILRDESMHTNFGIDLVNQIKL 305

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+++   + H+A  LE  YA +TMP+G +GLNA   + Y++FIANRR  QI
Sbjct: 306 ENPHLWTPEFKRELTGLFHQAVELEYRYAEDTMPRGVLGLNASMFKGYLRFIANRRAVQI 365

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+ +F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 366 GLDAIFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWE 410


>gi|121606275|ref|YP_983604.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas
           naphthalenivorans CJ2]
 gi|120595244|gb|ABM38683.1| Ribonucleoside-diphosphate reductase [Polaromonas naphthalenivorans
           CJ2]
          Length = 387

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/343 (60%), Positives = 260/343 (75%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           I A  KRV   DKR++N ++DVNQL+P KY WAWEKYL++C NHWMP EV M  D+ALWK
Sbjct: 45  IPAKAKRVKASDKRIINGQTDVNQLVPFKYKWAWEKYLASCANHWMPQEVNMTRDIALWK 104

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             NGL+DDER ++ RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H
Sbjct: 105 DPNGLSDDERRLVMRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTH 164

Query: 130 TFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +QYI  SLGLDEGE+FN Y EV SI  K  + + + + +S P F TGT ++DQ  L+ L
Sbjct: 165 AYQYITESLGLDEGEIFNAYNEVQSIKDKDQFLIPFIEAISDPGFKTGTLESDQTLLKSL 224

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+EN
Sbjct: 225 IVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLEN 284

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           P LWT EF+ +   +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGL
Sbjct: 285 PQLWTAEFKAEINALFMKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGL 344

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           E LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 345 ETLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|296135014|ref|YP_003642256.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
 gi|295795136|gb|ADG29926.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
          Length = 402

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 264/345 (76%), Gaps = 4/345 (1%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   RV  +DKR++N   DVNQL+P KY WAW+KYL++C NHWMP E+ M  D+A+WK  
Sbjct: 58  ASTARVRAEDKRIINCSVDVNQLVPFKYKWAWDKYLASCANHWMPQEINMSRDIAMWKDP 117

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLTDDERL+IKRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +
Sbjct: 118 NGLTDDERLIIKRNLGFFTTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAY 177

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT----GTKDADQEFLQ 187
           QYI+ S+GLDE E+FN Y E+ SI  K  + + +  TL++P F T    G++  DQE L+
Sbjct: 178 QYIVESIGLDESEIFNSYHEIASIRDKDEFLIPFIDTLTNPEFRTSAFGGSERNDQELLR 237

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            + VF  + EG++FY GF QILS+GR NKM G AEQYQYI+RDES+H NFGID++NQIK+
Sbjct: 238 SIIVFACLMEGLFFYVGFTQILSMGRQNKMTGAAEQYQYILRDESMHTNFGIDLVNQIKL 297

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+++   + H+A  LE  YA +TMP+G +GLNA   + Y++FIANRR  QI
Sbjct: 298 ENPHLWTPEFKRELTGLFHQAVELEYRYAEDTMPRGVLGLNASMFKGYLRFIANRRAVQI 357

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GL+ +F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 358 GLDAIFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWE 402


>gi|171463021|ref|YP_001797134.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192559|gb|ACB43520.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 394

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 205/337 (60%), Positives = 260/337 (77%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGLT
Sbjct: 58  RVKAADKRVINAKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMNRDIALWKDPNGLT 117

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 118 EDERRIIKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 177

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLD+ E+FN Y E+ SI AK  + + Y   L++P+F TGT +ADQ  L+ L VF  V
Sbjct: 178 ESLGLDQSEIFNAYHEIDSIRAKDEFLIPYIDVLTNPNFKTGTLEADQTLLRSLIVFACV 237

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL++GR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW  
Sbjct: 238 MEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWIS 297

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+ + +++  +A  LE  YA +TMP+G +GLNAP  +  +++I NRRC QIGL+ +F  
Sbjct: 298 AFKDEIKSIFEKAVELEYRYAEDTMPRGVLGLNAPMFKGCLRYICNRRCLQIGLDAMFPN 357

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 358 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 394


>gi|74317993|ref|YP_315733.1| ribonucleotide-diphosphate reductase subunit beta [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057488|gb|AAZ97928.1| ribonucleoside-diphosphate reductase beta chain [Thiobacillus
           denitrificans ATCC 25259]
          Length = 376

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 204/337 (60%), Positives = 258/337 (76%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK    LT
Sbjct: 40  RVRASDKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIAQWKDPTALT 99

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 100 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 159

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y E+ SI  K ++ + +  TL++P F TGT + DQ+ L+ L VF  +
Sbjct: 160 ESLGLDEAEIFNAYHEIESIRDKDDFLIPFIDTLTNPEFKTGTPENDQKLLKSLIVFACI 219

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK ENPHLWT 
Sbjct: 220 MEGIFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTIKQENPHLWTS 279

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + RT++ +   LE  YA +TMP+G +GLN+   ++Y++FI+NRRC QIGL+ +F  
Sbjct: 280 EFKAEIRTLIQKGVELEFRYAEDTMPRGVLGLNSAQFKEYLRFISNRRCQQIGLDEMFPG 339

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWM+E+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 340 VSNPFPWMAEMIDLKKEKNFFETRVTEYQTGGALSWD 376


>gi|239813962|ref|YP_002942872.1| ribonucleotide-diphosphate reductase subunit beta [Variovorax
           paradoxus S110]
 gi|239800539|gb|ACS17606.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus S110]
          Length = 391

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/337 (61%), Positives = 258/337 (76%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 55  RVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLT 114

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 115 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 174

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y EVPSI  K  + + +   +S P+F TGT + DQ  L+ L VF  +
Sbjct: 175 ESLGLDESEIFNAYNEVPSIREKDQFLIPFIDAISDPNFKTGTHETDQTLLKSLIVFACL 234

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT 
Sbjct: 235 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWTP 294

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF  
Sbjct: 295 EFKAEIKALFLKAVELEYKYAEDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFPN 354

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 355 EENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 391


>gi|253998799|ref|YP_003050862.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
 gi|253985478|gb|ACT50335.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
          Length = 383

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 262/337 (77%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+A WK  + LT
Sbjct: 47  RVQAVDKRVINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEISMSRDIAQWKDSSALT 106

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 107 EDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 166

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y+EV SI  K ++ + +  TL+ P F TGT  ADQ+ L+ L VF  +
Sbjct: 167 ESLGLDESEIFNAYQEVSSIRDKDDFLIPFINTLTDPEFKTGTTQADQQLLRSLIVFACI 226

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K+ENPHLWT 
Sbjct: 227 MEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHLWTP 286

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+++ + ++ +A  LE  YA +TMP+G +GLNA   ++Y++FIANRR  QIG++ L+  
Sbjct: 287 EFREEIKRLMQQAVELEYRYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDALYPG 346

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 347 ASNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 383


>gi|120609557|ref|YP_969235.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           citrulli AAC00-1]
 gi|120588021|gb|ABM31461.1| Ribonucleoside-diphosphate reductase [Acidovorax citrulli AAC00-1]
          Length = 387

 Score =  461 bits (1185), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/338 (60%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 50  RRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 109

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 110 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 169

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + + + +  P F TGT + DQ  L+ L VF  
Sbjct: 170 VESLGLDESEIFNAYNEVDSIRHKDEFLIPFIEAIMDPDFKTGTPETDQTLLKSLIVFAC 229

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT
Sbjct: 230 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWT 289

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+++ + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 290 AEFKEEIKGLFMKAVELEYQYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFP 349

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 350 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|268316001|ref|YP_003289720.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
 gi|262333535|gb|ACY47332.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
          Length = 347

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 207/341 (60%), Positives = 271/341 (79%), Gaps = 3/341 (0%)

Query: 13  GEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           G +R+ V+DKR++N    DVNQL+P+KY WAWE YL+ C NHWMP+E+PM  D+ LW+S 
Sbjct: 8   GSRRIRVEDKRLINCHEVDVNQLMPIKYAWAWEHYLNGCKNHWMPSEIPMARDIELWRS- 66

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           + LTDDERL+I RNLGFFA++ESLV NNIVLAI+RH++NPECRQYLLRQAFEEA+H+H F
Sbjct: 67  DKLTDDERLVILRNLGFFATAESLVGNNIVLAIFRHVTNPECRQYLLRQAFEEAIHTHAF 126

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
            YI+ SLGLDEGE+FNMYRE+P++  K  + ++ T+ +  P FTT T +  Q FL++L  
Sbjct: 127 LYIVESLGLDEGEVFNMYREIPAVARKDEFEMELTREVLRPDFTTATVEGAQAFLKNLIG 186

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           +YV+ EG++FY+GFA ILS  R NKM GI EQ+QYI+RDE++HLNFGID+IN IK ENP 
Sbjct: 187 YYVIMEGIFFYSGFAMILSFHRQNKMTGIGEQFQYILRDETIHLNFGIDLINGIKAENPE 246

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EFQ++ + ++ EA  LE+AYA++ +P+G +GL AP   +Y+Q+IA+RR  +IGL+ 
Sbjct: 247 LWTPEFQREVQQLIEEAVELEVAYAYDCLPRGVLGLTAPMFREYVQYIADRRLERIGLKA 306

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +  ++NPFPWMSE IDL KEKNFFETRVTEYQQ A L WD
Sbjct: 307 RYG-SKNPFPWMSETIDLLKEKNFFETRVTEYQQAAALSWD 346


>gi|313200886|ref|YP_004039544.1| ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
 gi|312440202|gb|ADQ84308.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
          Length = 381

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 262/337 (77%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+A WK  + LT
Sbjct: 45  RVQAVDKRVINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEISMSRDIAQWKDSSALT 104

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 105 EDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 164

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y+EV SI  K ++ + +  TL+ P F TGT  ADQ+ L+ L VF  +
Sbjct: 165 ESLGLDESEIFNAYQEVSSIRDKDDFLIPFINTLTDPEFKTGTTQADQQLLRSLIVFACI 224

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K+ENPHLWT 
Sbjct: 225 MEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHLWTP 284

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+++ + ++ +A  LE  YA +TMP+G +GLNA   ++Y++FIANRR  QIG++ L+  
Sbjct: 285 EFREEIKRLMQQAVELEYRYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDALYPG 344

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 345 ASNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 381


>gi|124268397|ref|YP_001022401.1| ribonucleotide-diphosphate reductase subunit beta [Methylibium
           petroleiphilum PM1]
 gi|124261172|gb|ABM96166.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum
           PM1]
          Length = 403

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/341 (60%), Positives = 260/341 (76%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           AG +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK  
Sbjct: 63  AGTRRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMSRDIATWKDP 122

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGL++DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 123 NGLSEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 182

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGLDE E+FN Y EV SI  K  + + +   +  P+F TGT + D+  L+ L V
Sbjct: 183 QYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIGAIMDPNFHTGTLENDRTLLKSLIV 242

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP 
Sbjct: 243 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQ 302

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE 
Sbjct: 303 LWTAEFKAEIKALFMKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEE 362

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 363 LFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 403


>gi|171057074|ref|YP_001789423.1| ribonucleotide-diphosphate reductase subunit beta [Leptothrix
           cholodnii SP-6]
 gi|170774519|gb|ACB32658.1| Ribonucleoside-diphosphate reductase [Leptothrix cholodnii SP-6]
          Length = 402

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/338 (61%), Positives = 255/338 (75%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK  NGL
Sbjct: 65  RRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMSRDIATWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER +IKRNLGFF +++SL ANNI L  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 125 TDDERRLIKRNLGFFVTADSLAANNITLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + Y   +  P F TGT + DQ  L+ L VF  
Sbjct: 185 VESLGLDESEIFNAYHEVASIREKDEFLIPYIDAIMDPHFKTGTPENDQTLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT
Sbjct: 245 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINAIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
             F+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE LF 
Sbjct: 305 PAFKAEIKALFLKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEELFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 402


>gi|264680215|ref|YP_003280125.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
 gi|262210731|gb|ACY34829.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
          Length = 336

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 206/336 (61%), Positives = 259/336 (77%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +N  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT+
Sbjct: 1   MNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLTE 60

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+ 
Sbjct: 61  DERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVE 120

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + DQ  L+ L VF  + 
Sbjct: 121 SLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPETDQTLLKSLIVFACLM 180

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT E
Sbjct: 181 EGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAE 240

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
           F+Q+   +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   
Sbjct: 241 FKQEITELFQKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFPGE 300

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 301 ENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 336


>gi|218665361|ref|YP_002427016.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517574|gb|ACK78160.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 380

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP E+ M  D+ALWK   GL
Sbjct: 43  ERVRAEDKRIINGHADVNQLVPFKYQWAWDKYLAACANHWMPQEIQMSRDIALWKDPKGL 102

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQY+LRQAFEEA+H+H +QYI
Sbjct: 103 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYMLRQAFEEAIHTHAYQYI 162

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPS+  K  + + +   L+ P F TGT + DQ+ L+ L VF  
Sbjct: 163 VESIGLDEGEIFNMYHEVPSVRDKDQFLMPFIDVLADPHFKTGTLENDQKLLRSLIVFAA 222

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT
Sbjct: 223 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWT 282

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQQ+   ++     LE AYA +TMP+G +GLNAP   +Y+++I NRR  Q+GL   + 
Sbjct: 283 EAFQQEIIDLIRRGVELECAYADDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYP 342

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L W+
Sbjct: 343 GVQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWE 380


>gi|198284354|ref|YP_002220675.1| ribonucleotide-diphosphate reductase subunit beta
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198248875|gb|ACH84468.1| Ribonucleoside-diphosphate reductase [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 374

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP E+ M  D+ALWK   GL
Sbjct: 37  ERVRAEDKRIINGHADVNQLVPFKYQWAWDKYLAACANHWMPQEIQMSRDIALWKDPKGL 96

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQY+LRQAFEEA+H+H +QYI
Sbjct: 97  TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYMLRQAFEEAIHTHAYQYI 156

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPS+  K  + + +   L+ P F TGT + DQ+ L+ L VF  
Sbjct: 157 VESIGLDEGEIFNMYHEVPSVRDKDQFLMPFIDVLADPHFKTGTLENDQKLLRSLIVFAA 216

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT
Sbjct: 217 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWT 276

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQQ+   ++     LE AYA +TMP+G +GLNAP   +Y+++I NRR  Q+GL   + 
Sbjct: 277 EAFQQEIIDLIRRGVELECAYADDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYP 336

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L W+
Sbjct: 337 GVQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWE 374


>gi|319791701|ref|YP_004153341.1| ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
 gi|315594164|gb|ADU35230.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
          Length = 411

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 206/338 (60%), Positives = 256/338 (75%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 74  QRVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 133

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 134 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 193

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + L +   +S P F TGT + DQ  L+ L VF  
Sbjct: 194 VESLGLDESEIFNAYNEVQSIREKDQFLLPFIDAISDPHFKTGTHETDQTLLKSLIVFAC 253

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT
Sbjct: 254 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWT 313

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + + +   A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 314 PEFKAEIKDLFMRAVELEYKYAEDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFP 373

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 374 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 411


>gi|332530699|ref|ZP_08406630.1| ribonucleotide-diphosphate reductase subunit beta [Hylemonella
           gracilis ATCC 19624]
 gi|332039867|gb|EGI76262.1| ribonucleotide-diphosphate reductase subunit beta [Hylemonella
           gracilis ATCC 19624]
          Length = 399

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 258/341 (75%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           +G  R+   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  
Sbjct: 59  SGTHRIKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMNRDIALWKDP 118

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGL++DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 119 NGLSEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 178

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGLDE E+F+ Y EV SI  K  + L +   +  P+F TGT + DQ  L+ L V
Sbjct: 179 QYIVESLGLDESEIFSAYLEVQSIRDKDEFLLPFINAIMDPNFHTGTLETDQTLLKSLIV 238

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP 
Sbjct: 239 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQ 298

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+ + R +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE 
Sbjct: 299 LWTPEFKAEIRGLFEKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEA 358

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 359 LFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 399


>gi|149927167|ref|ZP_01915424.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
 gi|149824106|gb|EDM83327.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
          Length = 399

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/346 (59%), Positives = 259/346 (74%), Gaps = 2/346 (0%)

Query: 9   PIQAGEK--RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           P   G K  RVN  DKR++N  +DVNQL+P KY WAWEKYLS C NHWMP E+ M  D+A
Sbjct: 54  PAAEGAKAGRVNAADKRVINGTTDVNQLVPFKYKWAWEKYLSQCANHWMPQEINMDRDIA 113

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
           LWK  NGLT+DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAF+EA+
Sbjct: 114 LWKDPNGLTEDERLIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFDEAI 173

Query: 127 HSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           H+H +QYI+ SLG+ E E FN Y E+  I AK ++ L +   L+ PSF TGT +ADQ  L
Sbjct: 174 HTHAYQYIVESLGIPEAETFNAYNEISCIKAKDDFLLPFIDVLTDPSFKTGTLEADQTLL 233

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F  + EGM+FY GF QIL+LGR NKM+G AEQ+QYI+RDES H  FGID+IN +K
Sbjct: 234 KSLIAFACIMEGMFFYVGFVQILALGRQNKMIGAAEQFQYILRDESAHCTFGIDLINTVK 293

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
           +ENPHLWT EF+++ + M  +A  LE AYA +TMP+G +GLN+    +YM+FI NRR +Q
Sbjct: 294 LENPHLWTPEFKEEIKAMFRKAVELEHAYAVDTMPRGVLGLNSAQFMEYMKFICNRRSNQ 353

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           IGL  L++   NPFPWMSE++DLKKE NFFE RVTEYQ G  L WD
Sbjct: 354 IGLGTLYEGATNPFPWMSEMMDLKKETNFFERRVTEYQTGGALSWD 399


>gi|319764328|ref|YP_004128265.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|330826374|ref|YP_004389677.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
 gi|317118889|gb|ADV01378.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|329311746|gb|AEB86161.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
          Length = 396

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV+  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 59  RRVSAVDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMTRDIALWKDPNGL 118

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 119 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 178

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EV SI AK  + + + + +  P+F TGT + DQ  L+ L VF  
Sbjct: 179 VESLGLDEGEIFNAYNEVESIRAKDEFLIPFIEAIMDPAFKTGTPENDQTLLKSLIVFAC 238

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT
Sbjct: 239 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWT 298

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
             F+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGL+ LF 
Sbjct: 299 PAFKDEIKGLFLKAVDLEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLDALFP 358

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 359 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 396


>gi|121608466|ref|YP_996273.1| ribonucleotide-diphosphate reductase subunit beta
           [Verminephrobacter eiseniae EF01-2]
 gi|121553106|gb|ABM57255.1| Ribonucleoside-diphosphate reductase [Verminephrobacter eiseniae
           EF01-2]
          Length = 399

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/357 (58%), Positives = 264/357 (73%), Gaps = 9/357 (2%)

Query: 5   TGLSPIQAG---------EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWM 55
           TG++P  +G         ++RVN  DKR++N ++DVNQL+PLKY WAWEKYL++C NHWM
Sbjct: 43  TGIAPASSGTRHQAPDAAQRRVNAADKRIINGQTDVNQLVPLKYKWAWEKYLASCANHWM 102

Query: 56  PTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQ 115
           P EV M  D+ALWK+  GL+DDER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ
Sbjct: 103 PQEVNMTRDIALWKTPGGLSDDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQ 162

Query: 116 YLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFT 175
           +LLRQAFEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P F 
Sbjct: 163 FLLRQAFEEAIHTHAYQYIVESLGLDESEIFNAYNEVRSIRDKDQFLIPFIEAIMDPHFH 222

Query: 176 TGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHL 235
           TG+   DQ  L+ L VF  + EG++FY GFAQIL+LGR NKM G AEQYQYI+RDES+H 
Sbjct: 223 TGSAANDQTLLKSLIVFACLMEGLFFYVGFAQILALGRQNKMTGAAEQYQYILRDESMHC 282

Query: 236 NFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQY 295
           NFGID+INQIK+ENP LWT  F+ +   +  +A  LE  YA +TMP G +G+NA   + Y
Sbjct: 283 NFGIDLINQIKLENPLLWTTAFKAEIEALFLQAVELEYRYAEDTMPHGVLGMNASMFKGY 342

Query: 296 MQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +++IANRR  QIGLE LF    NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 343 LRYIANRRATQIGLETLFPQETNPFPWMSEMIDLKKERNFFETRVIEYQSGGALCWD 399


>gi|224825450|ref|ZP_03698555.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
 gi|224602371|gb|EEG08549.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
          Length = 360

 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 257/340 (75%), Gaps = 1/340 (0%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV MQ D+  WK+  
Sbjct: 22  GTGRVNASDKRVINGQTDVNQLVPFKYKWAWEKYLAQCANHWMPQEVNMQRDIEQWKTGQ 81

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++DE  ++KRNLGFF +++SL ANNIVL  YR ++ PECRQ+LLRQAF+EA+H+H +Q
Sbjct: 82  -LSEDEMRLVKRNLGFFVTADSLAANNIVLGTYRQITAPECRQFLLRQAFDEAIHTHAYQ 140

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y E+ SI  K  + + +  TL +P F TGT + DQ+ L+ L VF
Sbjct: 141 YIVESLGLDEGEVFNAYHEIKSIRDKDEFLIPFIDTLCNPEFKTGTTETDQQLLKSLIVF 200

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K ENP L
Sbjct: 201 ACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTVKQENPQL 260

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT+EF+ +   +   A  LE AYA +TMP+G +GLNA   ++Y++FIANRR  QIGLEP+
Sbjct: 261 WTEEFKAEITGLFKHAVELEYAYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGLEPM 320

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F    NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 321 FPGVTNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 360


>gi|34497739|ref|NP_901954.1| ribonucleotide-diphosphate reductase subunit beta [Chromobacterium
           violaceum ATCC 12472]
 gi|34103595|gb|AAQ59956.1| ribonucleoside-diphosphate reductase system [Chromobacterium
           violaceum ATCC 12472]
          Length = 360

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 257/340 (75%), Gaps = 1/340 (0%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RVNV DK+++N  +DVNQL+P K+ WAWEKYL+ C NHWMP EV MQ D+  WK+  
Sbjct: 22  GTGRVNVVDKKVINGTTDVNQLVPFKHKWAWEKYLAQCANHWMPQEVNMQRDIEQWKTGQ 81

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT+DE  ++KRNLGFF +++SL ANNIVL  YR +++PECRQ+LLRQAF+EA+H+H +Q
Sbjct: 82  -LTEDEMRIVKRNLGFFVTADSLAANNIVLGTYRQITSPECRQFLLRQAFDEAIHTHAYQ 140

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y EV SI  K  + + +   L +P F TGT + DQ+ L+ L VF
Sbjct: 141 YIVESLGLDEGEVFNAYHEVKSIRDKDEFLIPFIDVLCNPEFKTGTVENDQKLLKSLIVF 200

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK+ENP L
Sbjct: 201 ACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTIKLENPLL 260

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT  F+ +   +  +A  LE AYA +TMP+G +GLNA   ++Y++FIANRR  QIGL+PL
Sbjct: 261 WTDSFKAEIVDLFKQAVELEYAYAEDTMPRGVLGLNASMFKEYLRFIANRRMQQIGLDPL 320

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F    NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 321 FPGVNNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 360


>gi|167837963|ref|ZP_02464822.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis MSMB43]
          Length = 303

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 238/303 (78%)

Query: 50  CNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLS 109
           C NHWMP E+ M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++
Sbjct: 1   CANHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHIT 60

Query: 110 NPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTL 169
            PECRQ+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV +I AK  + + +  TL
Sbjct: 61  APECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVAAIRAKDEFLIPFIHTL 120

Query: 170 SSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMR 229
           + P+FTTGT +ADQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+R
Sbjct: 121 TDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILR 180

Query: 230 DESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNA 289
           DES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA
Sbjct: 181 DESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNA 240

Query: 290 PSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
              + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L
Sbjct: 241 SMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGAL 300

Query: 350 KWD 352
            W+
Sbjct: 301 SWE 303


>gi|283779060|ref|YP_003369815.1| ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
 gi|283437513|gb|ADB15955.1| Ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
          Length = 357

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 257/334 (76%), Gaps = 3/334 (0%)

Query: 20  DDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++KR++N  + DVNQL+P+KY WAWE Y + C NHWMP+EVPM  D+  W++ + LTDDE
Sbjct: 26  EEKRLINCSTVDVNQLMPIKYHWAWEHYQNGCANHWMPSEVPMGKDIETWRTGS-LTDDE 84

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +L+I RNLGFF+++ESLV NN+VLAI+RH++NPECRQYLLRQAFEEA+H+HTF YI+ SL
Sbjct: 85  KLVILRNLGFFSTAESLVGNNLVLAIFRHVTNPECRQYLLRQAFEEAIHTHTFLYIVESL 144

Query: 139 GLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           GLD+ E+FNMYRE+PSI  K  + +Q T  L  P+FTT T +  Q+FL++L  +Y++ EG
Sbjct: 145 GLDDREVFNMYREIPSIARKDAFEMQLTTGLLDPNFTTETAEGAQKFLENLIGYYLIMEG 204

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++FYTGF  ILS  R N+M GI EQ+QYI+RDE++HLNFGID+IN ++ ENP +WT +FQ
Sbjct: 205 IFFYTGFVMILSFHRQNRMTGIGEQFQYILRDETIHLNFGIDLINGVRAENPGIWTADFQ 264

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++ EA  LE+AYA + +P+G VGLN      Y+Q IA+RR  +IGL P    + N
Sbjct: 265 ERVIKLVREAVELEVAYAWDCLPRGIVGLNGELFRDYVQHIADRRLERIGL-PTQYGSAN 323

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PFPWMSE +DL KEKNFFETRVTEYQ  A L WD
Sbjct: 324 PFPWMSETMDLGKEKNFFETRVTEYQSAASLAWD 357


>gi|118500933|gb|ABK97635.1| ribonucleoside diphosphate reductase beta subunit [Allochromatium
           vinosum DSM 180]
          Length = 280

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/280 (66%), Positives = 233/280 (83%)

Query: 29  SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGF 88
           +D+NQL+P KY WAW+KYL AC NHWMP E+ M  DLALWK  +GLT+DERL++KRNLGF
Sbjct: 1   ADLNQLVPFKYDWAWQKYLDACANHWMPQEISMNADLALWKDPHGLTEDERLIVKRNLGF 60

Query: 89  FASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNM 148
           F++++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA+H+H +QY++ SLGLDEGE+FNM
Sbjct: 61  FSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEALHTHAYQYVVESLGLDEGEIFNM 120

Query: 149 YREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQI 208
           YREVP++  KA WAL +TQ L+ P F TGT + DQ+ L +L  FYV+FEG++FY GF QI
Sbjct: 121 YREVPAVARKAEWALPFTQHLADPHFQTGTPENDQKLLCELVAFYVIFEGIFFYVGFVQI 180

Query: 209 LSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEA 268
           LS+GR NKM G AEQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT +F+Q+   M+ EA
Sbjct: 181 LSMGRRNKMTGTAEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPDFRQELVGMIREA 240

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
             LE  YAH+TMP+G +GLNA   E Y+ FIANRRC QIG
Sbjct: 241 VELEARYAHDTMPRGVLGLNAQMFEDYLHFIANRRCAQIG 280


>gi|325110864|ref|YP_004271932.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
 gi|324971132|gb|ADY61910.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
          Length = 353

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/344 (57%), Positives = 257/344 (74%), Gaps = 3/344 (0%)

Query: 10  IQAGEKRVNVDDKRMLN-ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           + A   R    +KR++N A+ DVNQL+P+KY WAWE YL+ C NHWMPTEVPM  D+ +W
Sbjct: 12  LDAPTGRFKASEKRLINCAQVDVNQLMPIKYAWAWEHYLNGCANHWMPTEVPMTKDIEVW 71

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L+DDERL+I RNLGFF+++ESLV NN+VLAI++H++N ECRQYLLRQAFEEAVH+
Sbjct: 72  KS-NKLSDDERLVIMRNLGFFSTAESLVGNNLVLAIFKHVTNAECRQYLLRQAFEEAVHT 130

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF Y++ SLGL EGE+FNMY EVP+I  K  + ++ T  + S  FTT T +  Q FL++
Sbjct: 131 HTFLYVVDSLGLHEGEVFNMYHEVPAIARKDEFEMKLTAEVLSEDFTTETYEGRQTFLRN 190

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FYTGF  ILS  R N + GI EQ+QYI+RDE+ HLNFGID+IN IK E
Sbjct: 191 LIGYYLIMEGIFFYTGFVMILSFHRRNLLTGIGEQFQYILRDETTHLNFGIDLINGIKHE 250

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT++FQQ+   ++ EA  LEI YA + +P+G +GLN      Y+Q IA+RR  +IG
Sbjct: 251 NPDIWTEKFQQEIIDLVKEAVELEIDYARDCLPRGVLGLNGNLFRDYVQHIADRRLERIG 310

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L  L+  + NPFPWMSE +DL KEKNFFETRVTEYQ G  L WD
Sbjct: 311 LPTLYN-SSNPFPWMSETMDLAKEKNFFETRVTEYQTGGTLSWD 353


>gi|269839640|ref|YP_003324332.1| ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791370|gb|ACZ43510.1| Ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 353

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/339 (58%), Positives = 254/339 (74%), Gaps = 3/339 (0%)

Query: 15  KRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           +R+ V+DKR++N ++ DVNQL PLKY WAWE YL+ C NHWMPTEVPM  D+ LW+S N 
Sbjct: 17  QRIRVEDKRLINCKAVDVNQLWPLKYAWAWEHYLNGCANHWMPTEVPMHKDIELWRS-NA 75

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT DERL+I RNLGFF++ ESLV NNIVLAI++H++NPE RQYLLRQAFEEA+H+H F Y
Sbjct: 76  LTPDERLVIMRNLGFFSTGESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAIHTHAFHY 135

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLD  E+FNMYREV SI  K  + +  T+ +  P FTT T +  Q+F+++L  FY
Sbjct: 136 IVESLGLDGREVFNMYREVDSIKGKDEFVMSLTERVLDPDFTTETLEGIQDFIRNLVGFY 195

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           V+ EG++FY+GF  ILS  R N+M GI EQ+QYI+RDE++HLNFGID+IN IK ENP  W
Sbjct: 196 VIMEGIFFYSGFVMILSFHRQNRMTGIGEQFQYILRDETVHLNFGIDLINTIKEENPEAW 255

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T+E ++    M+ +A   EIAYA E +P G +GLNA    +Y+Q+IA+RR  +I L P+ 
Sbjct: 256 TEELRRDLVGMIRQAVEYEIAYARECLPNGVLGLNADLFREYVQYIADRRLERIEL-PVQ 314

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             + NPFPWMSE +DL KEKNFFETRVTEYQ    L WD
Sbjct: 315 YRSRNPFPWMSETMDLPKEKNFFETRVTEYQNAGTLVWD 353


>gi|298243909|ref|ZP_06967716.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
 gi|297556963|gb|EFH90827.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
          Length = 361

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 251/332 (75%), Gaps = 3/332 (0%)

Query: 22  KRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KR++N    DVNQL+PLKY WAWE YL+ C NHWMPTEVPM  D+  W+S N LT  ERL
Sbjct: 32  KRLINGWHVDVNQLMPLKYRWAWEHYLNGCANHWMPTEVPMTKDIETWRS-NKLTAGERL 90

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I RNLGFFA++ESLV NN+VLAI++H++N ECRQYLLRQAFEEA+H+HTF YI+ SLGL
Sbjct: 91  VIMRNLGFFATAESLVGNNLVLAIFKHITNAECRQYLLRQAFEEAIHTHTFLYIVESLGL 150

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
            E E+FNMY E+PSI  K  + +Q T  +  P F+T T +  Q+FLQ+L  +Y++ EG++
Sbjct: 151 SEHEVFNMYHEIPSIKEKDEFEMQLTSAVLDPDFSTETFEGMQKFLQNLIGYYIIMEGIF 210

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY+GF  +LS  R N M G+ EQ+QYI+RDE++HLNFGID+IN IK ENP LWT EFQ  
Sbjct: 211 FYSGFVMMLSFHRRNLMTGVGEQFQYILRDETIHLNFGIDLINGIKAENPELWTTEFQAH 270

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++  A  LEIAYA++ +P G +GLNA S   Y+Q +A+RR  +IGL P+F ++ +PF
Sbjct: 271 IYDLIKRAVELEIAYAYDCLPNGILGLNAESFRSYVQHVADRRLERIGLAPIF-HSSHPF 329

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PWMSE +DL KEKNFFETRVTEYQ  + L+W+
Sbjct: 330 PWMSETMDLSKEKNFFETRVTEYQAASTLEWE 361


>gi|159899093|ref|YP_001545340.1| ribonucleotide-diphosphate reductase subunit beta [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892132|gb|ABX05212.1| Ribonucleoside-diphosphate reductase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 342

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 254/338 (75%), Gaps = 3/338 (0%)

Query: 16  RVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           R N  DKR++N  + DVNQL+PL+YGWAWE YL+ C NHWMP EV M  D+A+W+S + L
Sbjct: 7   RFNASDKRLINCNQVDVNQLMPLRYGWAWEHYLNGCANHWMPNEVSMTGDIAIWRSTS-L 65

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           + DERLM+ RNLGFFA++ESLV NNIVLAI+RH++N ECRQYLLRQAFEEA+H+H F +I
Sbjct: 66  SADERLMVLRNLGFFATAESLVGNNIVLAIFRHITNAECRQYLLRQAFEEAIHTHAFLHI 125

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FNMY E+P I+ K  + +Q T  +  P F+T T    Q F+++L  +YV
Sbjct: 126 VESLGLNEREIFNMYHEIPVISQKDQFEMQLTAAVLDPQFSTETLTGMQTFVKNLIGYYV 185

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY+GFA +LSL R N + GI EQ QYI+RDE++HLNFG+D+IN IK ENP +WT
Sbjct: 186 IMEGIFFYSGFAMLLSLHRRNVLTGIGEQIQYILRDETIHLNFGVDLINGIKAENPAIWT 245

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EFQ +   ++ ++  LE  YA E +P+G +GL+A     Y+Q+IA+RR  +IGL   + 
Sbjct: 246 NEFQAEIVQLIRQSVELEAQYAAECLPRGVMGLHAAMFRDYVQYIADRRLQRIGLAIQYG 305

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ++NPFPWMSE IDL KEKNFFETRVTEYQ  A L+WD
Sbjct: 306 -SQNPFPWMSETIDLTKEKNFFETRVTEYQSAASLEWD 342


>gi|15834835|ref|NP_296594.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270285001|ref|ZP_06194395.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270289024|ref|ZP_06195326.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Weiss]
 gi|301336399|ref|ZP_07224601.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum MopnTet14]
 gi|14195147|sp|Q9PL92|RIR2_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|7190253|gb|AAF39087.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydia
           muridarum Nigg]
          Length = 346

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+ M  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEISMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-NVLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  SI AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERASIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFIKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKMVGI EQYQYI+RDE++HLNFG+D+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMVGIGEQYQYILRDETIHLNFGVDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   M+  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTTELQQEIIEMIQRAVDLEIDYARDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVTEYQHAASLTW 346


>gi|166154172|ref|YP_001654290.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 434/Bu]
 gi|166155047|ref|YP_001653302.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
 gi|301335416|ref|ZP_07223660.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2tet1]
 gi|165930160|emb|CAP03644.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis 434/Bu]
 gi|165931035|emb|CAP06598.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
          Length = 346

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/343 (56%), Positives = 260/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVTEYQHAASLTW 346


>gi|189219089|ref|YP_001939730.1| ribonucleotide-diphosphate reductase subunit beta
           [Methylacidiphilum infernorum V4]
 gi|189185947|gb|ACD83132.1| Ribonucleotide reductase, beta subunit [Methylacidiphilum
           infernorum V4]
          Length = 361

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/339 (57%), Positives = 262/339 (77%), Gaps = 3/339 (0%)

Query: 14  EKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           +KR+NV++KR++N ++ DVNQL+PLKY WAWE YL+ C N+W+P+EVPMQ D+ LWKS N
Sbjct: 25  KKRINVEEKRLINCKAVDVNQLMPLKYKWAWEHYLNGCANNWLPSEVPMQRDVELWKS-N 83

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++DERL+I RNLGFFA+ ESLV NNIVLAI++ ++N E RQYLLRQA+EEAVH+H F 
Sbjct: 84  RLSNDERLVIMRNLGFFATGESLVGNNIVLAIFKFVTNAEARQYLLRQAYEEAVHTHAFL 143

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDE E+FNMY EV SI+ K  + +  T+ +    F T + +  Q+F+++L  F
Sbjct: 144 YIVESLGLDEREVFNMYHEVNSISNKDQFEMTLTEDILREGFNTESVENIQKFVKNLVGF 203

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           YV+ EG++FY+GFA ILS  R NKM GI EQ+QYI+RDE++HLNFGID+IN I+ ENP +
Sbjct: 204 YVIMEGIFFYSGFAMILSFHRQNKMTGIGEQFQYILRDETIHLNFGIDLINGIREENPEI 263

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT  FQ++   M+ E+  LE AYA + +P+G +GLN+   + Y+++IA+RR  +IG +  
Sbjct: 264 WTAGFQKEIEEMIDESVRLEYAYARDCLPRGILGLNSALFKDYVEYIADRRLERIGFKAK 323

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           +  ++NPFPWMSEV+DL KEKNFFETRVTEYQ GA L W
Sbjct: 324 YG-SKNPFPWMSEVMDLVKEKNFFETRVTEYQSGAVLNW 361


>gi|282890382|ref|ZP_06298910.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499764|gb|EFB42055.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 350

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/339 (58%), Positives = 253/339 (74%), Gaps = 3/339 (0%)

Query: 14  EKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           E       KR+LN +  DVNQL+PLKY WAWE YL+ C+N+WMP+EVPMQ D+ LWKS N
Sbjct: 14  EAEAAAQQKRILNCKQVDVNQLMPLKYHWAWEHYLNGCHNNWMPSEVPMQKDIELWKS-N 72

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++DERL+I RNLGFF+++ESLV NNIVLAI++HL+N E RQYLLRQAFEEAVH+HTF 
Sbjct: 73  RLSNDERLVIMRNLGFFSTAESLVGNNIVLAIFKHLTNAEARQYLLRQAFEEAVHTHTFH 132

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SL LD+ E+F+MY  V SI AK  + ++ T+ +    FTT T +  Q FL++L  F
Sbjct: 133 YIVESLSLDQREVFDMYNAVNSIHAKDAFEMKLTEEVMQEGFTTDTPEGVQTFLKNLIGF 192

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           Y++ EG++FY+GF  ILS  R N M GI EQ+QYI+RDES+HLNFGID+IN IK ENP +
Sbjct: 193 YIIMEGIFFYSGFVMILSFHRKNIMTGIGEQFQYILRDESIHLNFGIDLINTIKEENPEV 252

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EF+ +   M+ EA  LEI YA + +P G +GLNA     Y+ +IA+RR  +IGL+P 
Sbjct: 253 WTPEFKDQIIDMVKEAVELEIQYAADCLPNGILGLNAALFRDYVGYIADRRLERIGLKPQ 312

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           +  T NPFPWMSEV+DL KEKNFFETRVT+YQ GA L W
Sbjct: 313 YN-TANPFPWMSEVMDLDKEKNFFETRVTQYQSGAALVW 350


>gi|15605563|ref|NP_220349.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D/UW-3/CX]
 gi|255311668|ref|ZP_05354238.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276]
 gi|255317969|ref|ZP_05359215.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276s]
 gi|14195107|sp|O84835|RIR2_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|51247460|pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide
           Reductase From Chlamydia Trachomatis
 gi|3329298|gb|AAC68425.1| Ribonucleoside Reductase, Small Chain [Chlamydia trachomatis
           D/UW-3/CX]
 gi|296436383|gb|ADH18557.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9768]
 gi|296437314|gb|ADH19484.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11222]
 gi|296438242|gb|ADH20403.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11074]
 gi|297140743|gb|ADH97501.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9301]
 gi|297748957|gb|ADI51503.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-EC]
 gi|297749837|gb|ADI52515.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-LC]
          Length = 346

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|76789573|ref|YP_328659.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis A/HAR-13]
 gi|237803260|ref|YP_002888454.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/Jali20/OT]
 gi|237805181|ref|YP_002889335.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|255349232|ref|ZP_05381239.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70]
 gi|255503769|ref|ZP_05382159.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70s]
 gi|255507450|ref|ZP_05383089.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D(s)2923]
 gi|76168103|gb|AAX51111.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis A/HAR-13]
 gi|231273481|emb|CAX10397.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|231274494|emb|CAX11290.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/Jali20/OT]
 gi|289525874|emb|CBJ15356.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis Sweden2]
 gi|296435459|gb|ADH17637.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/150]
 gi|296439176|gb|ADH21329.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/11023]
          Length = 346

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPGIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|297621807|ref|YP_003709944.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
 gi|297377108|gb|ADI38938.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
          Length = 344

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 256/338 (75%), Gaps = 5/338 (1%)

Query: 16  RVNVDDKRMLN-ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           R   D K+++N +  DVNQLLPLKY WAWE YL+ C NHWMP+EVPM  D+  WKS + +
Sbjct: 11  RFRSDQKKLINCSEVDVNQLLPLKYKWAWEHYLNGCANHWMPSEVPMTKDIETWKS-DSI 69

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           ++DERL+IKRNLGFFA++ESLVANN+VLAI++H++N ECRQYLLRQAFEEA+HSH F YI
Sbjct: 70  SEDERLLIKRNLGFFATAESLVANNLVLAIFKHVTNAECRQYLLRQAFEEALHSHAFLYI 129

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FNMYRE+ +I+ K  + +Q T+ L      T T    Q+FL++L  +Y+
Sbjct: 130 VDSLGLEEQEIFNMYREISTISEKDEFEMQLTKGLIDGE--TKTLAGKQQFLKNLVGYYI 187

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY+GFA +LSL R N M GI EQ+QYI+RDE++HLNFGID+IN IK ENP +W 
Sbjct: 188 IMEGIFFYSGFAMVLSLHRRNIMPGIGEQFQYILRDETIHLNFGIDLINGIKAENPEIWN 247

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           ++   +   ++ +A  LEIAYA E +P G +GLNA    +Y+Q++A+RR  +IGL  ++K
Sbjct: 248 EDLTDEINGLVQQAVELEIAYAKECLPHGVLGLNAGLFVEYVQYVADRRLERIGLSAIYK 307

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            + NPFPWMSE +DL KEKNFFETRVTEYQ  A L WD
Sbjct: 308 -SSNPFPWMSETMDLTKEKNFFETRVTEYQSAAVLSWD 344


>gi|112489977|pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide
           Reductase R2 From Chlamydia Trachomatis
          Length = 346

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/343 (55%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HT+ YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTYLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|330949820|gb|EGH50080.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae Cit 7]
          Length = 359

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/291 (60%), Positives = 231/291 (79%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D+
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           KIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y+
Sbjct: 309 KIENPHLWDAEMKKEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYL 359


>gi|29840533|ref|NP_829639.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           caviae GPIC]
 gi|29834882|gb|AAP05517.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           caviae GPIC]
          Length = 346

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 258/338 (76%), Gaps = 3/338 (0%)

Query: 15  KRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV ++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LWKS N 
Sbjct: 11  KRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKS-ND 69

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+HTF Y
Sbjct: 70  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTHTFLY 129

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I  SLGLDEGE+FN Y E  +I AK ++ +  T  + +P+F+T + +  ++F+++L  +Y
Sbjct: 130 ICESLGLDEGEVFNAYNERATIKAKDDFQMTLTVDVLNPNFSTDSVEGLRQFIKNLVGYY 189

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP +W
Sbjct: 190 IIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVW 249

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           ++E Q +   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IGL+P++
Sbjct: 250 SQELQDEIIALIQKAVDLEIEYAKDCLPRGILGLKSSMFIDYVRHIADRRLERIGLKPIY 309

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            Y++NPFPWMSE IDL KEKNFFETRVTEYQ    L W
Sbjct: 310 -YSKNPFPWMSETIDLNKEKNFFETRVTEYQTSGNLSW 346


>gi|149173739|ref|ZP_01852368.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
 gi|148847269|gb|EDL61603.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
          Length = 359

 Score =  407 bits (1047), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/352 (56%), Positives = 250/352 (71%), Gaps = 4/352 (1%)

Query: 3   NNTGLSPI-QAGEKRVNVDDKRMLN-ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + T +SP+      R   D KR++N ++ DVNQL+PLKY WAWE YL+ C NHWMPTEV 
Sbjct: 10  SKTPVSPVGDTPTGRFKADKKRLINCSQVDVNQLMPLKYHWAWEHYLNGCANHWMPTEVG 69

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+  W+S   L++ ER +I RNLGFFA++ESLVANNIVLAI++H++N ECRQYLLRQ
Sbjct: 70  MTKDIETWRSSK-LSEGERFVIMRNLGFFATAESLVANNIVLAIFKHVTNAECRQYLLRQ 128

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVHSHTF YI+ SLGL+E E+FNMY EVP+I  K    ++ T  +    FTT T +
Sbjct: 129 AFEEAVHSHTFLYIVESLGLNESEVFNMYHEVPAIAKKDQLEMELTSEILDHDFTTDTFE 188

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
             Q FL++L  +Y++ EG++FYTGF  +LS  R N M GI EQ+QYI+RDE++HLNFGID
Sbjct: 189 GAQAFLKNLIGYYLIMEGLFFYTGFVMVLSFHRRNMMTGIGEQFQYILRDETIHLNFGID 248

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +IN IK ENP LWT EFQQ     +  A  LEI YA + +P G +GLN     +Y+Q IA
Sbjct: 249 LINGIKQENPDLWTPEFQQLIIDRMKYAAELEIEYAKDCLPTGILGLNGELFREYVQHIA 308

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +RR  +IGL P    + NPFPWMSE +DL KEKNFFETRVTEYQ    L WD
Sbjct: 309 DRRLERIGL-PAQYGSANPFPWMSETMDLSKEKNFFETRVTEYQSSGSLNWD 359


>gi|313848275|emb|CBY17276.1| putative ibonucleoside reductase small subunit [Chlamydophila
           psittaci RD1]
          Length = 349

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 256/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 128 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 248 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 308 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 349


>gi|329943118|ref|ZP_08291892.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|332287701|ref|YP_004422602.1| ribonucleotide reductase subunit beta [Chlamydophila psittaci 6BC]
 gi|325507260|gb|ADZ18898.1| ribonucleotide reductase subunit beta [Chlamydophila psittaci 6BC]
 gi|328814665|gb|EGF84655.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|328914953|gb|AEB55786.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           psittaci 6BC]
          Length = 346

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 256/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 6   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 125 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 245 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 346


>gi|89898045|ref|YP_515155.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           felis Fe/C-56]
 gi|89331417|dbj|BAE81010.1| ribonucleoside-diphosphate reductase beta chain [Chlamydophila
           felis Fe/C-56]
          Length = 349

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/343 (54%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIDLW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NELSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEVRQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T+ +  P+F+T T +  ++F+++
Sbjct: 128 HTFLYICESLGLDESEVFNAYNERATIKAKDDFQMDLTRDVLDPNFSTHTIENLRQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +W+++ Q +   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IG
Sbjct: 248 NPEVWSQQLQDEIVDLIQKAVDLEIEYARDCLPRGILGLRSSMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++  ++NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 308 LKPIYN-SKNPFPWMSETIDLNKEKNFFETRVTEYQTAANLNW 349


>gi|62185356|ref|YP_220141.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           abortus S26/3]
 gi|62148423|emb|CAH64191.1| putative ibonucleoside reductase small subunit [Chlamydophila
           abortus S26/3]
          Length = 349

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/343 (54%), Positives = 255/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N  + DVNQL+P+KY WAWE Y++ C N W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYVNGCANTWLPTEVPMARDIELW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 128 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 248 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 308 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 349


>gi|330443801|ref|YP_004376787.1| ribonucleoside-diphosphate reductase subunit beta [Chlamydophila
           pecorum E58]
 gi|328806911|gb|AEB41084.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pecorum E58]
          Length = 346

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 257/338 (76%), Gaps = 3/338 (0%)

Query: 15  KRVNVDDKRMLN-ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV++++KR++N ++ DVNQL+P+KY WAWE YL+ C N+W+PTE+ M  D+ LWKS NG
Sbjct: 11  KRVHINNKRLVNCSQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEISMARDIELWKS-NG 69

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+ TF Y
Sbjct: 70  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTQTFLY 129

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I  SL LDE E+FN Y E  SI AK ++ +  T  +  P+F+T + +  ++F+++L  +Y
Sbjct: 130 ICESLSLDEAEVFNAYNERESIKAKDDFQMTLTVDVLDPNFSTDSIEGLRKFIKNLVGYY 189

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP +W
Sbjct: 190 LIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVW 249

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           +KE Q++   ++  A  LEI YA + +PKG +GL +     Y++ IA+RR  +IGL+P++
Sbjct: 250 SKELQEEIIALIETAVGLEIDYAKDCLPKGILGLKSSMFIDYVRHIADRRLERIGLKPIY 309

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             ++NPFPWMSE +DL KEKNFFETRVTEYQ  A L W
Sbjct: 310 N-SKNPFPWMSETMDLNKEKNFFETRVTEYQTAASLSW 346


>gi|33242353|ref|NP_877294.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae TW-183]
 gi|33236864|gb|AAP98951.1| ribonucleoside reductase small chain [Chlamydophila pneumoniae
           TW-183]
          Length = 365

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 252/338 (74%), Gaps = 3/338 (0%)

Query: 15  KRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV V  K ++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LWKS + 
Sbjct: 30  KRVEVSKKGLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKS-DE 88

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+HTF Y
Sbjct: 89  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTHTFLY 148

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I  SLGLDEGE+FN Y E  SI AK ++ +  T  +  P+F+  + +   +F+++L  +Y
Sbjct: 149 ICESLGLDEGEVFNAYNERASIRAKDDFQMTLTVDVLDPNFSVQSSEGLGQFIKNLVGYY 208

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP +W
Sbjct: 209 IIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVW 268

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T E Q++   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IGL+P++
Sbjct: 269 TTELQEEIVALIEKAVELEIEYAKDCLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIY 328

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            ++ NPFPWMSE +DL KEKNFFETRVTEYQ    L W
Sbjct: 329 -HSRNPFPWMSETMDLNKEKNFFETRVTEYQTAGNLSW 365


>gi|15618893|ref|NP_225179.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae CWL029]
 gi|15836516|ref|NP_301040.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae J138]
 gi|16752043|ref|NP_445409.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae AR39]
 gi|14195165|sp|Q9Z6S4|RIR2_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|4377313|gb|AAD19122.1| Ribonucleoside Reductase, Small Chain [Chlamydophila pneumoniae
           CWL029]
 gi|7189783|gb|AAF38660.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae AR39]
 gi|8979358|dbj|BAA99192.1| ribonucleoside reductase, small chain [Chlamydophila pneumoniae
           J138]
 gi|269302786|gb|ACZ32886.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae LPCoLN]
          Length = 346

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 252/338 (74%), Gaps = 3/338 (0%)

Query: 15  KRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV V  K ++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LWKS + 
Sbjct: 11  KRVEVSKKGLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKS-DE 69

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+HTF Y
Sbjct: 70  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTHTFLY 129

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I  SLGLDEGE+FN Y E  SI AK ++ +  T  +  P+F+  + +   +F+++L  +Y
Sbjct: 130 ICESLGLDEGEVFNAYNERASIRAKDDFQMTLTVDVLDPNFSVQSSEGLGQFIKNLVGYY 189

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP +W
Sbjct: 190 IIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVW 249

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T E Q++   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IGL+P++
Sbjct: 250 TTELQEEIVALIEKAVELEIEYAKDCLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIY 309

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            ++ NPFPWMSE +DL KEKNFFETRVTEYQ    L W
Sbjct: 310 -HSRNPFPWMSETMDLNKEKNFFETRVTEYQTAGNLSW 346


>gi|241589542|ref|YP_002979567.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|240868254|gb|ACS65913.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
          Length = 328

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 178/293 (60%), Positives = 224/293 (76%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A  KRVNV +KR++N  +DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  
Sbjct: 17  ATAKRVNVAEKRIINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMARDIALWKDP 76

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +
Sbjct: 77  NGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAY 136

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + D++ L+ L V
Sbjct: 137 QYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDRKLLKSLIV 196

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPH
Sbjct: 197 FACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPH 256

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           LWT EF+ +   +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC
Sbjct: 257 LWTAEFKVEITELFKQAVDLEYRYAEDTMPRGVLGLNASMFKGYLRFICNRRC 309


>gi|330941351|gb|EGH44203.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 317

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 158/248 (63%), Positives = 202/248 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV M  D 
Sbjct: 69  GLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMTADT 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQAFEEA
Sbjct: 129 ALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           +H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT + D+E 
Sbjct: 189 IHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVETDKEL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGIDVINQI
Sbjct: 249 LRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGIDVINQI 308

Query: 246 KIENPHLW 253
           KIENPHLW
Sbjct: 309 KIENPHLW 316


>gi|87311395|ref|ZP_01093515.1| ribonucleotide-diphosphate reductase beta subunit [Blastopirellula
           marina DSM 3645]
 gi|87285807|gb|EAQ77721.1| ribonucleotide-diphosphate reductase beta subunit [Blastopirellula
           marina DSM 3645]
          Length = 313

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 225/296 (76%), Gaps = 2/296 (0%)

Query: 15  KRVNVDDKRMLN-ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           +RV  +DKR++N ++ DVNQL+PLKY WAWE Y++ C NHWMPTEVPM  D+  W+S + 
Sbjct: 16  QRVRANDKRLVNCSQVDVNQLMPLKYNWAWEHYMNGCANHWMPTEVPMTKDIETWRS-DK 74

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTDDERL+I RNLGFF+++ESLV NN+VLAI++H++N ECRQYLLRQAFEEAVHSHTF Y
Sbjct: 75  LTDDERLVIMRNLGFFSTAESLVGNNLVLAIFKHVTNAECRQYLLRQAFEEAVHSHTFLY 134

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           ++ SLGL+EGE+FNMY EVP+I  K  + ++ T  + SP F+T + +  Q FL++L  +Y
Sbjct: 135 VVESLGLNEGEIFNMYNEVPAIARKDQFEMKLTAEVLSPDFSTDSYEGLQAFLKNLIGYY 194

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FYTGF  +LS  R N M GI EQ+QYI+RDE++HLNFGID+IN IK ENP LW
Sbjct: 195 IIMEGIFFYTGFVMVLSFHRRNLMTGIGEQFQYILRDETVHLNFGIDLINGIKAENPDLW 254

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           T EFQ +   ++ +A  LEI YA + +P G +GLN      Y+ ++A+RR  +IGL
Sbjct: 255 TAEFQAEIIDLIKQAVELEIEYAGDCLPNGILGLNRDLFRDYVHYVADRRVERIGL 310


>gi|322368525|ref|ZP_08043093.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
 gi|320551809|gb|EFW93455.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
          Length = 330

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 225/322 (69%), Gaps = 2/322 (0%)

Query: 30  DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFF 89
           D N++LPL Y WA + Y +  NN+W+P E+PMQDD++ W   + L+D ER +I+ NLGFF
Sbjct: 11  DPNKILPLDYDWARDYYEAGVNNNWVPEEIPMQDDISQWNG-DALSDAERQLIEWNLGFF 69

Query: 90  ASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMY 149
           +++ESL ANNIVLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG D   L+ MY
Sbjct: 70  STAESLTANNIVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFDPDYLYGMY 129

Query: 150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQIL 209
             VPSI  K  + +  T+ +  P FT  T    +EFL+DL  FYV+ EG++FY GFA +L
Sbjct: 130 DRVPSIAEKDEFVVDLTRAIDRPDFTIETDADVREFLRDLVGFYVIMEGVFFYAGFAMML 189

Query: 210 SLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEAT 269
            L R NKMVGI +Q++YI+RDESLH+ FG+D+IN+I+ ENP+ WT  F  +   ++  A 
Sbjct: 190 GLKRQNKMVGIGQQFEYILRDESLHVGFGVDLINEIRAENPNAWTDAFGDEVTDLITNAV 249

Query: 270 LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 329
            LE  YA+E  P   +G++A    +Y++ IA+RR  Q+ L+  +  TENPFPWMSE +DL
Sbjct: 250 ELEKIYAYEACPDEILGMSAAQFAEYVEHIADRRLAQLDLDEQYG-TENPFPWMSEQVDL 308

Query: 330 KKEKNFFETRVTEYQQGAELKW 351
            KEKNFFET+VTEYQ G  L W
Sbjct: 309 NKEKNFFETQVTEYQSGGSLDW 330


>gi|257053403|ref|YP_003131236.1| ribonucleotide-diphosphate reductase subunit beta [Halorhabdus
           utahensis DSM 12940]
 gi|256692166|gb|ACV12503.1| Ribonucleoside-diphosphate reductase [Halorhabdus utahensis DSM
           12940]
          Length = 330

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 225/325 (69%), Gaps = 2/325 (0%)

Query: 27  ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNL 86
           A  D N++LP+ Y WA E Y +  NN+W+P E+PMQDD+A W     LTD ER +++ NL
Sbjct: 8   AEHDPNKILPIDYDWAREYYEAGVNNNWVPEEIPMQDDVAQWNGDE-LTDAERQLVEWNL 66

Query: 87  GFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELF 146
           GFF+++ESL ANN+VLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG +   L+
Sbjct: 67  GFFSTAESLTANNLVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFEPEYLY 126

Query: 147 NMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFA 206
            MY  VPSI  K  + +  T+++  P FT       ++ L+DL  FYV+ EG++FY GFA
Sbjct: 127 GMYDRVPSIEEKDQFVVDLTRSIDDPEFTIDGDSDVRDLLRDLVGFYVIMEGIFFYAGFA 186

Query: 207 QILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH 266
            +L L R NKMVGI +Q++YIMRDESLH+ FG+D+I+QI+ ENP +WT EF  +   ++ 
Sbjct: 187 MMLGLKRQNKMVGIGQQFEYIMRDESLHVGFGVDLIDQIRTENPGVWTDEFDSEVIDLIK 246

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           EA  LE  YA E  P+  +G++      Y+++IA+RR  Q+ L   +  TENPFPWMSE 
Sbjct: 247 EAVELEQIYAREACPEEILGMSGSQFADYVEYIADRRLDQLDLPEQYG-TENPFPWMSEQ 305

Query: 327 IDLKKEKNFFETRVTEYQQGAELKW 351
           +DL KEKNFFET+VTEYQ G  L+W
Sbjct: 306 VDLNKEKNFFETQVTEYQSGGSLEW 330


>gi|300709535|ref|YP_003735349.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
 gi|299123218|gb|ADJ13557.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
          Length = 330

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 228/330 (69%), Gaps = 4/330 (1%)

Query: 24  MLNARS--DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           ++N  S  D N++LP+ Y WA E Y +   N+W P EVPM DD+  W++   L+ +ER +
Sbjct: 3   LINTESHHDPNKILPIDYDWAREYYKAGVANNWTPEEVPMADDVHQWENDE-LSSEERQL 61

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           ++ NLGFF+++ESL ANNIVLA+Y H++ PECRQYLLRQA+EEA+H+ TF Y   SLG D
Sbjct: 62  VEWNLGFFSTAESLTANNIVLAVYDHVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFD 121

Query: 142 EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWF 201
              L+ MY  +P+I AK  + +  TQ +  P F   + +  +EFL+DL  FYV+ EG++F
Sbjct: 122 PEYLYGMYDRIPAIEAKDEFVVDLTQVIDDPDFEISSDEDVREFLRDLVGFYVIMEGIFF 181

Query: 202 YTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS 261
           Y GFA +L L R  KMVG+ EQ++YIMRDESLHLNFG+D+IN ++ EN  +WT  F+ + 
Sbjct: 182 YAGFAMMLGLKRQGKMVGVGEQFEYIMRDESLHLNFGVDLINTVREENSGIWTDVFEAEI 241

Query: 262 RTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP 321
             +L EA  LE  YA E  P+  +G+      +Y++++A+RR  Q+G+EP++  T+NPFP
Sbjct: 242 EGLLREAVELERTYAREACPEEVLGMGPAQFAEYVEYVADRRLDQLGMEPVYD-TDNPFP 300

Query: 322 WMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           WM+E +DL KEKNFFET V EYQ G  L+W
Sbjct: 301 WMAEQVDLNKEKNFFETNVAEYQSGGSLEW 330


>gi|289582310|ref|YP_003480776.1| ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
 gi|289531863|gb|ADD06214.1| Ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
          Length = 330

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 228/326 (69%), Gaps = 2/326 (0%)

Query: 26  NARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN 85
           +A  D N++LP+ Y WA E Y +  NN+W+P E+PMQDD++ W   + L+D ER +++ N
Sbjct: 7   DAEHDPNKILPIDYDWAREYYEAGVNNNWVPEEIPMQDDVSQWNG-DALSDAERQLVEWN 65

Query: 86  LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL 145
           LGFF+++ESL ANNIVLA+Y H++ PECRQYLLRQA+EEA+H+ TF Y   SLG +   +
Sbjct: 66  LGFFSTAESLTANNIVLAVYDHVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFEPDYM 125

Query: 146 FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGF 205
           + MY  +PSI  K  + +  T+ ++   F   T +  ++F++DL  FYV+ EG++FY GF
Sbjct: 126 YGMYDRIPSIAEKDEFVIDLTRVINQNGFVIETDEDLRDFIRDLVGFYVIMEGIFFYAGF 185

Query: 206 AQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML 265
           A +L L R NKMVGI +Q++YIMRDESLH+ FG+D+I+QI++ENP +WT  F  +   ++
Sbjct: 186 AMMLGLKRQNKMVGIGQQFEYIMRDESLHVGFGVDLIDQIRMENPDVWTDAFGDEVVELI 245

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            EA  LE  YA+E  P   +G++A    +Y++ IA+RR  Q+ L P    T+NPFPW+SE
Sbjct: 246 TEAVELEKIYAYEACPDEILGMSADQFAEYVEHIADRRLGQLDL-PTQYGTDNPFPWLSE 304

Query: 326 VIDLKKEKNFFETRVTEYQQGAELKW 351
            +DL KEKNFFET+VTEYQ G  L W
Sbjct: 305 QVDLNKEKNFFETQVTEYQSGGSLDW 330


>gi|313117005|ref|YP_004038129.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
 gi|312294957|gb|ADQ68993.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
          Length = 330

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 223/326 (68%), Gaps = 2/326 (0%)

Query: 26  NARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN 85
           +   D N++LP+ Y WA + Y     N+W+P E+PMQ+D+A W   + L+D E+ +++ N
Sbjct: 7   DTEHDPNKILPIDYDWARQYYRDGVANNWVPEEIPMQEDIAQWNG-DALSDSEKQLVEWN 65

Query: 86  LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL 145
           LGFF+++ESL ANNIVLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG D   +
Sbjct: 66  LGFFSTAESLTANNIVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFDPEYM 125

Query: 146 FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGF 205
           + MY  VPSI  K  + +  T+ L  P FT       ++ L+DL  FYVV EG++FY GF
Sbjct: 126 YGMYDRVPSIKEKDEFVVDLTRNLDDPDFTVEDTADVRDLLRDLVGFYVVMEGVFFYAGF 185

Query: 206 AQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML 265
           A +L+L R NKMVGI +Q++YIMRDESLH+ FG+D+INQI+ ENP  WT EF  + R ++
Sbjct: 186 AMMLALKRQNKMVGIGQQFEYIMRDESLHVGFGVDLINQIRAENPDAWTDEFGAEVRDLI 245

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            +A  LE  YA E  P   +G++     +Y++ +A+RR  Q+ L+  +  T+NPFPWMSE
Sbjct: 246 EKAVDLEQIYAREACPDDVLGMSPDQFAEYVEHVADRRLGQLDLDASYG-TDNPFPWMSE 304

Query: 326 VIDLKKEKNFFETRVTEYQQGAELKW 351
            +DL KEKNFFET+VTEYQ G  L W
Sbjct: 305 AVDLNKEKNFFETQVTEYQSGGSLDW 330


>gi|289677030|ref|ZP_06497920.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae FF5]
          Length = 243

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 153/243 (62%), Positives = 192/243 (79%)

Query: 110 NPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTL 169
           NPE RQY+LRQAFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++
Sbjct: 1   NPEGRQYILRQAFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSI 60

Query: 170 SSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMR 229
           S P F TGT D D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+R
Sbjct: 61  SDPKFETGTVDTDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILR 120

Query: 230 DESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNA 289
           DES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA
Sbjct: 121 DESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNA 180

Query: 290 PSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
              E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L
Sbjct: 181 AMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGAL 240

Query: 350 KWD 352
            WD
Sbjct: 241 SWD 243


>gi|15791173|ref|NP_280997.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           sp. NRC-1]
 gi|169236929|ref|YP_001690129.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           salinarum R1]
 gi|10581791|gb|AAG20477.1| ribonucleoside reductase small chain [Halobacterium sp. NRC-1]
 gi|167727995|emb|CAP14783.1| ribonucleoside-diphosphate reductase beta subunit [Halobacterium
           salinarum R1]
          Length = 331

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 159/327 (48%), Positives = 228/327 (69%), Gaps = 2/327 (0%)

Query: 26  NARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN 85
           +A  D N++LP+ Y WA E Y     N+W P EV MQ D++ W+  N LTD ER +++ N
Sbjct: 7   DAEHDPNKILPIDYDWAREYYQQGVANNWTPEEVAMQGDISQWQG-NELTDAERQLVEWN 65

Query: 86  LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL 145
           LGFF+++ESL ANNIVLAIY +++ PECRQYLLRQA+EEAVH+ TF Y   SLG D   +
Sbjct: 66  LGFFSTAESLTANNIVLAIYEYVTAPECRQYLLRQAYEEAVHTDTFIYCCDSLGFDPEHM 125

Query: 146 FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGF 205
           + MY  +PSI  K  + +  T+ +   +FT  T D  ++FL+DL  FYV+ EG++FY GF
Sbjct: 126 YGMYDRIPSIAEKDEFVVGLTRAVDDQAFTIDTDDDLRDFLRDLVGFYVIMEGIFFYAGF 185

Query: 206 AQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML 265
           A +L+L R  KMVG+ EQ++YIMRDESLHLNFG+D+INQI+ E+P +WT +F+ +  +++
Sbjct: 186 AMMLALKRRGKMVGVGEQFEYIMRDESLHLNFGVDLINQIRDEHPDVWTADFEAEVNSLM 245

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            +A  LE  YA +  P   +G+++     Y++++A+RR  Q+ ++P++  T+NPFPWM+E
Sbjct: 246 RDAVDLEQLYARDACPDDLLGMSSEQFADYVEYVADRRFQQLRMDPVYG-TDNPFPWMTE 304

Query: 326 VIDLKKEKNFFETRVTEYQQGAELKWD 352
            +DL  E NFFE  V+EYQQG  L WD
Sbjct: 305 QVDLNTETNFFERNVSEYQQGGSLDWD 331


>gi|115525181|ref|YP_782092.1| ribonucleotide reductase [Rhodopseudomonas palustris BisA53]
 gi|115519128|gb|ABJ07112.1| ribonucleotide reductase [Rhodopseudomonas palustris BisA53]
          Length = 223

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 153/189 (80%)

Query: 164 QYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQ 223
           ++TQ L  P+F TGT +AD+ FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQ
Sbjct: 35  KHTQHLDDPTFVTGTVEADRAFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQ 94

Query: 224 YQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG 283
           YQYI+RDES+HLNFGID+INQIKIENP LWT  FQ++ R ML EA  LE AY  +TMP+G
Sbjct: 95  YQYILRDESIHLNFGIDIINQIKIENPELWTAGFQEELRGMLREAAELEAAYCRDTMPRG 154

Query: 284 FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEY 343
           F GLNA  CEQYM FI NRRC Q+GL P+F   ENPFPWMSE +DLKKEKNFFETRV EY
Sbjct: 155 FFGLNAALCEQYMHFITNRRCAQLGLAPIFAEVENPFPWMSETMDLKKEKNFFETRVIEY 214

Query: 344 QQGAELKWD 352
           Q G  L WD
Sbjct: 215 QNGGALTWD 223


>gi|153875510|ref|ZP_02003277.1| ribonucleotide-diphosphate reductase beta subunit [Beggiatoa sp.
           PS]
 gi|152068026|gb|EDN66723.1| ribonucleotide-diphosphate reductase beta subunit [Beggiatoa sp.
           PS]
          Length = 374

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 219/354 (61%), Gaps = 8/354 (2%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           ++ L  I  G KR +  D +++  R  DV Q +P+KY    E++L+A  N W+P E+PM 
Sbjct: 24  SSSLDAISIGTKRPSSSDIKIIGGRGYDVRQPIPVKYTSVRERFLNARKNFWIPNEIPMG 83

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
           +D   W +   LT+ E  + K N+ +  +S++LV +N+  AI +H++  E RQY   Q  
Sbjct: 84  EDKLQWNT-GLLTEAEMWLFKSNISYLTASDNLVPDNLDNAILKHITANEMRQYFRHQIM 142

Query: 123 EEAVHSHTFQYIITSLGLDE---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           EE+ H  ++ +I+ S GLDE   G++FN+Y+EVP++T K NW L +T  + +     GT 
Sbjct: 143 EESNHIESYLFILESFGLDEKGQGQIFNLYQEVPALTEKLNWNLTFTNNVVNSEAPRGTL 202

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +A++  L+DL  +Y+ FE ++F  GF+QI +L R  K+   A+QY YI RDE+LH + G+
Sbjct: 203 EANRALLEDLISYYI-FEYLFFPLGFSQIFALARKGKLRNTAQQYSYIWRDENLHSSNGL 261

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPK-GFVGLNAPSCEQYMQF 298
            +I QI  EN  LW    Q++SR ++ EA  LE  YAH +MP+ G VGL   +  ++  F
Sbjct: 262 WLIKQIIQENHELWDSTMQERSRAIVSEAVKLETDYAHASMPEGGIVGLPVKTYIKFSHF 321

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +A+  C  +G++PLF+  E+P PW+SE  +L  E NFFE RV EYQ G++L WD
Sbjct: 322 VADNICKNLGIKPLFRVREHPMPWISEY-ELNHEVNFFEGRVREYQTGSQLTWD 374


>gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039813|gb|ACT56609.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040683|gb|ACT57479.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 125

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 228 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 287
           MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL
Sbjct: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60

Query: 288 NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA
Sbjct: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120

Query: 348 ELKWD 352
           ELKWD
Sbjct: 121 ELKWD 125


>gi|311696539|gb|ADP99412.1| ribonucleotide-diphosphate reductase beta subunit [marine bacterium
           HP15]
          Length = 352

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 140/336 (41%), Positives = 197/336 (58%), Gaps = 7/336 (2%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VNVDDKR++N  +D+NQL P KY WAWE +++A  NHW P +V M  D+  +  +  LT 
Sbjct: 23  VNVDDKRVINGETDINQLAPFKYPWAWEYFMNANKNHWTPLDVNMAQDVHDYHHR--LTA 80

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+ + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +EEA+H+  +Q+ I 
Sbjct: 81  PEKHVYENVLAYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVYEEAMHTWAYQHCIE 140

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           +L LD+ E++N YR VP+I  K   A +       P      KD  QEF+     F  VF
Sbjct: 141 TLNLDQSEIYNRYRVVPAINGKIQIANRRLDAAMRPDMNLRNKDDLQEFIMSYLFFAAVF 200

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG WFY GF+ I +L R   M G  EQ QYI+RDE++H +FG+ V+NQI +E  ++    
Sbjct: 201 EGTWFYNGFSPIFALQRRGLMRGTGEQLQYILRDEAMHFSFGLKVVNQI-VEEENI---T 256

Query: 257 FQQKS-RTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           F  K+ R M  E+   E AYA   +    +G +A    +  +F+ANRR   +GLE  F  
Sbjct: 257 FDPKAVREMWDESEAAEKAYADYILRDPILGYSAEYHSEQFRFVANRRARTVGLEEPFPG 316

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            +N  PW+ E   L+KEKNFFETRV EYQ GA+L+W
Sbjct: 317 AKNVSPWLDEQATLRKEKNFFETRVIEYQTGAQLEW 352


>gi|94986920|ref|YP_594853.1| ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731169|emb|CAJ54531.1| Ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 333

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 142/337 (42%), Positives = 196/337 (58%), Gaps = 7/337 (2%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN  DKR++N ++D+NQLLP +Y WAW+ +L A  NHW P E+ M  D+  +   + LT 
Sbjct: 3   VNASDKRIVNGKTDINQLLPFRYPWAWDFFLKANQNHWTPLEISMSQDV--YDYNHTLTT 60

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER +    L +  +S+ L   NI LA+   ++ PE + Y  RQ +EEA+H+ T+Q+ I 
Sbjct: 61  NERHVFDNVLAYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEEALHTWTYQHCIE 120

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           SLGL++ E++N YR VP I  K   + +  + +         KD   EF+     F  +F
Sbjct: 121 SLGLEQSEIYNRYRVVPEIYGKILLSNKRLEQVLRSDINLSDKDNLHEFIMSYIFFAAIF 180

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ-IKIENPHLWTK 255
           EG WFY GF+ I SL R   M G AEQ+QYI+RDE LH  FGI VI   I+ EN  L   
Sbjct: 181 EGCWFYNGFSPIFSLQRRGLMKGTAEQFQYILRDEVLHCTFGITVIKGLIEEENITLDPT 240

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +Q    +  E    EIAYA+  + +  +G NA       +FIANRR  Q+G++  F  
Sbjct: 241 AVRQ----LWDEVEAAEIAYANYILHEPIIGYNADLHIGQFRFIANRRSRQLGMKEPFPG 296

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +N  PW+ E  +L+KEKNFFETRVTEYQ G  LKWD
Sbjct: 297 AKNVLPWLDEQSNLRKEKNFFETRVTEYQTGGGLKWD 333


>gi|149375674|ref|ZP_01893443.1| Ribonucleotide reductase, beta subunit [Marinobacter algicola
           DG893]
 gi|149360076|gb|EDM48531.1| Ribonucleotide reductase, beta subunit [Marinobacter algicola
           DG893]
          Length = 352

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 199/350 (56%), Gaps = 8/350 (2%)

Query: 4   NTGLSPI-QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           NT   P    G   VNVDDKR++N  +D+NQL P KY WAWE +++A  NHW P +V M 
Sbjct: 9   NTQTRPAAHEGPAPVNVDDKRVINGETDINQLAPFKYPWAWEYFMNANKNHWTPLDVNMA 68

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+  +  +  L+  E+ + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +
Sbjct: 69  QDVHDYHHR--LSAPEKHVYENVLAYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVY 126

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEA+H+  +Q+ I +L LD+ E++N YR VP+I  K   A +              KD  
Sbjct: 127 EEAMHTWAYQHCIETLNLDQSEIYNRYRVVPAINGKIQMANRRLDAAMRSDMNLRDKDDL 186

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           QEF+     F  VFEG WFY GF+ I +L R   M G  EQ QYI+RDE++H +FG+ V+
Sbjct: 187 QEFIMSYLFFAAVFEGAWFYNGFSPIFALQRRGLMRGTGEQLQYILRDEAMHFSFGLKVV 246

Query: 243 NQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           NQI + EN  L  K      R M  E+   E AYA+  +    +G +A    +  +F+AN
Sbjct: 247 NQILEEENITLDPKAV----RDMWDESEAAETAYANYILRDPILGYSAQYHSEQFRFVAN 302

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           RR   +GLE  F   +N  PW+ E   L+KEKNFFETRV EYQ GA+L+W
Sbjct: 303 RRARTVGLEEPFPGAKNVSPWLDEQATLRKEKNFFETRVIEYQTGAQLEW 352


>gi|120556760|ref|YP_961111.1| ribonucleoside-diphosphate reductase [Marinobacter aquaeolei VT8]
 gi|120326609|gb|ABM20924.1| Ribonucleoside-diphosphate reductase [Marinobacter aquaeolei VT8]
          Length = 352

 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 193/340 (56%), Gaps = 5/340 (1%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
            G   VNVDDKR++N  +D+NQL P KY WAWE +++A  NHW P +V M  D+  +  +
Sbjct: 18  GGPAPVNVDDKRVINGETDINQLAPFKYPWAWEYFMNANKNHWTPLDVNMAQDVHDYHHR 77

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
             LT  E+ + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +EEA+H+ T+
Sbjct: 78  --LTPAEKHVYENVLAYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVYEEALHTWTY 135

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           Q+ I +L LD+ E++N YR VP I  K   A +               D  Q+F+     
Sbjct: 136 QHCIETLNLDQSEIYNRYRVVPEINGKIQLANRRLDAAMRSDMNLRNPDELQDFVMSYLF 195

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  VFEG WFY GF+ I +L R   M G  EQ QYI+RDE++H +FG+ V+NQI  E   
Sbjct: 196 FAAVFEGCWFYNGFSPIFALQRRGLMRGTGEQLQYILRDEAMHFSFGLKVVNQILEEEKI 255

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
                  +  R M  E+   E+AYA+  +    +G +A    +  +F+ANRR   +GLE 
Sbjct: 256 TLDP---KAVREMWDESEAAEMAYANYVLRDPILGYSAEYHSEQFRFVANRRARTVGLEE 312

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            F   +N  PW+ E   L+KEKNFFETRV EYQ GA+L+W
Sbjct: 313 PFPGAKNVSPWLDEQATLRKEKNFFETRVIEYQTGAQLEW 352


>gi|90023100|ref|YP_528927.1| amino acid adenylation [Saccharophagus degradans 2-40]
 gi|89952700|gb|ABD82715.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 368

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 198/348 (56%), Gaps = 6/348 (1%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            G +     +  V   DKR++N  +D+NQL P KY WAW+ +++A  NHW P ++ M  D
Sbjct: 27  AGQAATPNAQAPVCASDKRVINGHTDINQLAPFKYPWAWDFFINANKNHWTPLDINMSQD 86

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +  +  K+ LT+ ER M +  L +  +S+ L   NI LA+   ++ PE + Y  RQ +EE
Sbjct: 87  V--YDYKHNLTEAERHMYENVLSYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEE 144

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+ T+Q+ I +LGLD+GE++N YR VP I AK   A +  +++          D    
Sbjct: 145 ALHTWTYQHCIETLGLDQGEIYNRYRVVPEINAKIQMANRRLESILRSDIDLTDPDQLNN 204

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F+     F  VFEG WFY GF+ I +L R   M G AEQ QYIMRDE++H  FGI  ++Q
Sbjct: 205 FILAYIFFAAVFEGCWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDETMHCAFGIQTVSQ 264

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           I IEN    T       +TM  EA   E  YA   + +  +G +A    +  +FIANRR 
Sbjct: 265 IIIEN---CTNIDVDAIKTMWEEADEAEANYARYILREPILGYSANDHIEQFRFIANRRA 321

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GLE  F   +   PW+ E  +++KEKNFFETRV EYQ G  L+WD
Sbjct: 322 RQLGLEEPFPQAKCALPWLDEQANIRKEKNFFETRVIEYQAGG-LEWD 368


>gi|126664354|ref|ZP_01735338.1| Ribonucleotide reductase, beta subunit [Marinobacter sp. ELB17]
 gi|126630680|gb|EBA01294.1| Ribonucleotide reductase, beta subunit [Marinobacter sp. ELB17]
          Length = 352

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 202/352 (57%), Gaps = 14/352 (3%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A N+ ++P       VNVDDKR++N  +DVNQL P KY WAWE +++A  NHW P +V 
Sbjct: 14  IALNSSVAP-------VNVDDKRVINGNTDVNQLAPFKYPWAWEYFMNANKNHWTPLDVN 66

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+  +  +  L   E+ + +  L +  +S+ L   NI LA+   ++ PE + Y  RQ
Sbjct: 67  MSQDVHDYHHR--LNPAEKHVFENVLAYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQ 124

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
            +EEAVH+ T+Q+ I +L LD+GE++N YR VP I  K   A +              KD
Sbjct: 125 VYEEAVHTWTYQHCIETLNLDQGEIYNRYRVVPQINGKIQMANRRLNAAMRSDINLRNKD 184

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
             QEF+     F  VFEG WFY GF+ I +L R   M G  EQ+QYI+RDE++H +FG+ 
Sbjct: 185 DLQEFIMSYLFFAAVFEGCWFYNGFSPIFALQRRGLMRGTGEQFQYILRDEAMHFSFGLK 244

Query: 241 VINQIKIENPHLWTKEFQQKS-RTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           V+NQI +E  ++    F  K+ R M  E+   E  YA+  +    +G +A    +  +F+
Sbjct: 245 VVNQI-LEEENI---SFDPKAVRDMWDESEAAESDYANYILRDPILGYSAEYHIEQFRFV 300

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           ANRR   + L   F   +N  PW+ E   ++KEKNFFETRV EYQ GA+L+W
Sbjct: 301 ANRRARTVNLPEPFPGAKNVSPWLEEQATMRKEKNFFETRVIEYQTGAQLEW 352


>gi|254492407|ref|ZP_05105579.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxidans DMS010]
 gi|224462299|gb|EEF78576.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxydans DMS010]
          Length = 383

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 143/360 (39%), Positives = 199/360 (55%), Gaps = 15/360 (4%)

Query: 2   ANNTGLSPIQA--------GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNH 53
           AN+   +P +A          K +N DDKR++N  +D+NQL P KY WAW  +L+A  NH
Sbjct: 30  ANDLSEAPARAEVTEMPLNNAKAINADDKRVINGEADINQLAPFKYPWAWNYFLNANKNH 89

Query: 54  WMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPEC 113
           W P ++ M  D+  ++ K  LT +ER + +  L +  +S+ L   NI LA+   ++ PE 
Sbjct: 90  WTPLDINMAQDVHDYRHK--LTLEERHVYENVLSYLTTSDILAMRNIGLAVMEKMTAPEL 147

Query: 114 RQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPS 173
           + Y  RQ +EEA+H+ T+Q+ I ++GLD+ E++N YR VP I  K   A     T+    
Sbjct: 148 QIYQARQVYEEALHTWTYQHCIETIGLDQSEIYNRYRVVPEIHQKIKLANDRLDTVMRSD 207

Query: 174 FTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESL 233
                +D  + F+     F  +FEG WFY GF+ I +L R   M G AEQ QYIMRDE +
Sbjct: 208 IDLRDRDELENFVMSYAFFAGIFEGSWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDEVM 267

Query: 234 HLNFGIDVINQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSC 292
           H +FGI V  QI K EN  L  K+ QQ    M  EA   E  YA   +    +G +    
Sbjct: 268 HASFGIRVCKQIMKEENITLDPKKVQQ----MFEEADAAEETYAGYILRDPILGYSKEVH 323

Query: 293 EQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               ++ ANRR  Q+G E  F   E   PW+ E  +++KEKNFFET+VTEYQ G  LKWD
Sbjct: 324 HGQFRYTANRRAKQLGFEEPFPGAEATLPWLDEQANMRKEKNFFETKVTEYQTGGGLKWD 383


>gi|83649535|ref|YP_437970.1| ribonucleotide reductase subunit beta [Hahella chejuensis KCTC
           2396]
 gi|83637578|gb|ABC33545.1| Ribonucleotide reductase, beta subunit [Hahella chejuensis KCTC
           2396]
          Length = 405

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 137/336 (40%), Positives = 191/336 (56%), Gaps = 7/336 (2%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN DDKR++N  +D+NQL P KY WAWE +L+A  NHW P ++ M  D+  +  K  LT 
Sbjct: 76  VNPDDKRVVNGMTDINQLAPFKYPWAWEFFLNANKNHWTPLDINMSQDVYDYHHK--LTL 133

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E+ + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +EE++H+ T+Q+ I 
Sbjct: 134 EEKHVYENVLAYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVYEESLHTWTYQHCIE 193

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           ++GLD+ E++N YR  P+I  K     +    L  P      +D  + F+     F  +F
Sbjct: 194 TIGLDQSEIYNRYRVTPAIYRKIKMGNERISALLRPDINLRNRDDLETFVMAYIFFAGIF 253

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ-IKIENPHLWTK 255
           EG WFY GF+ I +L R   M G  EQ QYIMRDE +H  FGI V+ Q IK E   L  K
Sbjct: 254 EGCWFYNGFSPIFALQRRGLMKGTGEQLQYIMRDEVMHCAFGIRVVKQIIKEEGVTLDPK 313

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
                 +T+  EA   E  YAH  + +  +G  A    +  +FIANRR  Q+ L+  F  
Sbjct: 314 AI----KTLWEEAEAAETGYAHFLLKEPILGYTAEDHIEQFRFIANRRAKQLKLDEPFPG 369

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             N  PW+ E   ++KEKNFFETRVTEYQ GA L+W
Sbjct: 370 AGNALPWLDEQASMRKEKNFFETRVTEYQTGASLQW 405


>gi|254449372|ref|ZP_05062814.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
 gi|198261018|gb|EDY85321.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
          Length = 404

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 193/347 (55%), Gaps = 5/347 (1%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           T  + +  G   V  +DK+++N  +D+NQL P KY WAWE +L+A  NHW P ++ M  D
Sbjct: 63  TNAAQMSGGVNPVKAEDKKVVNGMADINQLAPFKYPWAWEYFLNANKNHWTPLDINMAQD 122

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +  +  K  LT +ER +    L +  +S+ +   NI LA+   +S PE + Y  RQ +EE
Sbjct: 123 VHDFHHK--LTLEERHVYTNVLSYLTTSDIMAMRNIGLAVMEKMSAPELQIYQARQVYEE 180

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           ++H+ T+Q+ I +LGLD+GE++N YR VP I AK   A +   ++  P      +D    
Sbjct: 181 SLHTWTYQHCIETLGLDQGEVYNRYRVVPEINAKIQIANRRLNSVMRPDIDLNDRDELHN 240

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           FL     F  +FEG WFY GF+ I +L R   M G AEQ QYIMRDE +H +FG+ V  Q
Sbjct: 241 FLMSYIFFAGIFEGCWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDEVMHASFGLRVARQ 300

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           I  E      +   +  R M  E    E  YA   +    +G +A       +FIANRR 
Sbjct: 301 IMREEN---IQPDPKAMREMWDECEAAEEGYARYLLRDPILGYSAEDHVNQFRFIANRRA 357

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           +++ LE  F   EN  PW+ E  +++KEKNFFETRVTEYQ G  L W
Sbjct: 358 NKLSLEEPFPGAENALPWLDEQANMRKEKNFFETRVTEYQVGGGLTW 404


>gi|260220050|emb|CBA27200.1| Ribonucleoside-diphosphate reductase subunit alpha [Curvibacter
            putative symbiont of Hydra magnipapillata]
          Length = 1306

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/181 (61%), Positives = 140/181 (77%)

Query: 172  PSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDE 231
            P+F TGT ++DQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDE
Sbjct: 1126 PNFHTGTSESDQVLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDE 1185

Query: 232  SLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPS 291
            S+H NFGID+INQ+K+ENPHLWT EF+ + + +  +A  LE  YA +TMP+G +G+NA  
Sbjct: 1186 SMHCNFGIDLINQLKLENPHLWTPEFKAEIKALFEKAVELEYRYAEDTMPRGVLGMNASM 1245

Query: 292  CEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             + Y+++IANRR  QIGLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W
Sbjct: 1246 FKGYLRYIANRRATQIGLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSW 1305

Query: 352  D 352
            D
Sbjct: 1306 D 1306


>gi|294055010|ref|YP_003548668.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614343|gb|ADE54498.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 360

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 196/316 (62%), Gaps = 2/316 (0%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           +LPLKY WA++ Y +  NNHW P ++PMQ D+ LW+S + L+D ER +IK  +G+F+++E
Sbjct: 39  ILPLKYQWAYDLYKTMKNNHWEPEDIPMQKDVELWRSAD-LSDAERWIIKMAIGYFSAAE 97

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            +V +NI       ++ PE +  L R A EE +H+ +  Y+I+SLG++  E   M+ ++ 
Sbjct: 98  GIVGDNIQHVTRELVTAPELKLLLGRHAHEENIHADSLVYMISSLGINPHECEAMFEDID 157

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +I  K  + +  ++ L      T T D  Q F +++F+F    EG  FY  F  +LSL R
Sbjct: 158 TIERKTAFVVNNSRGLRRDMDLTTTADK-QAFTKNMFLFGQCMEGTQFYGLFGMVLSLYR 216

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            NK  GI + ++Y +RDES H+    ++I  +  EN  +WT EF+++ R ++ EA  LE 
Sbjct: 217 QNKFPGIGQMFRYTLRDESNHIEVFRNLIMDLIEENEDVWTPEFREELRDLMREAVTLEK 276

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            +  + +P   VGL+A    QY+ +IA+RR   +GL PL    +NPFPW++E++D+KKE+
Sbjct: 277 DFIRDCLPVNSVGLSADEFCQYIDYIADRRLEGVGLAPLSPGVDNPFPWLAEMMDIKKEQ 336

Query: 334 NFFETRVTEYQQGAEL 349
           NFFE RVTEYQ+ + L
Sbjct: 337 NFFEGRVTEYQKASAL 352


>gi|238023979|ref|YP_002908211.1| Ribonucleotide reductase subunit beta [Burkholderia glumae BGR1]
 gi|237878644|gb|ACR30976.1| Ribonucleotide reductase, beta subunit [Burkholderia glumae BGR1]
          Length = 337

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 139/338 (41%), Positives = 193/338 (57%), Gaps = 7/338 (2%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   V+DKR++N   D+NQL P +Y WAWE +LSA  NHW P E+ M DD+  +  +  L
Sbjct: 5   KPARVEDKRVVNGAGDINQLAPFRYAWAWECFLSANKNHWTPLEISMSDDVHDFHHR--L 62

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           +  E+ + +  L +  +S+ L   NI LA+   ++ PE + Y  RQ +EEA+H+ T+Q+ 
Sbjct: 63  SPAEKHVFENVLAYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEEALHTWTYQHC 122

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           I SLGLD+ E++N YR VP I AK   + +    +  P      +D   EF      F  
Sbjct: 123 IESLGLDQQEIYNRYRVVPQIHAKIALSNRRLNRMLEPGLDLHDRDTLHEFALAYLFFAA 182

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           VFEG WFY GF+ + +L R   M   A+Q+QYIMRDE LH  FGI VI Q+ +E  HL  
Sbjct: 183 VFEGTWFYNGFSPVFALQRRGLMKATAQQFQYIMRDEVLHCGFGIRVIRQL-LEEEHL-- 239

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAP-SCEQYMQFIANRRCHQIGLEPLF 313
           +      + +  EA   E AYA   +    +G +A   CEQ+ +FIANRR  Q+ +   F
Sbjct: 240 RLDPHAVQQIWEEAEAAERAYAQYILRDPILGYSAELHCEQF-RFIANRRATQLSMPAPF 298

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
               N  PW+ E  +L+KEKNFFETRVT+YQ G  L W
Sbjct: 299 PGATNALPWLDEQANLRKEKNFFETRVTDYQSGGALDW 336


>gi|254442775|ref|ZP_05056251.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
 gi|198257083|gb|EDY81391.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
          Length = 361

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 196/330 (59%), Gaps = 2/330 (0%)

Query: 22  KRMLNARSDVN-QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           K+++N R  +   LLPLKY WA+E Y +   NHW P ++ M  D+  WK    +++ ER 
Sbjct: 26  KKIINGRETMTFNLLPLKYNWAYEIYKTMKANHWEPEDIGMNKDIEQWKDTEQVSEIERW 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I   +G+F+++E +V +NI+  I   ++ PE +  L R A EE VH+ +  Y+I+SLG+
Sbjct: 86  IIMMGIGYFSAAEGIVGDNILHVIRELVTAPELKLVLGRHAHEENVHADSLLYMISSLGI 145

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +  E   M+ ++P+I  K  +  + +  L +    T T++  Q+F +++F+F    EG  
Sbjct: 146 NPHECEAMFEDIPTIVKKNEFVTRQSHALRNDVDLTITENK-QKFAKNVFLFGQCMEGTQ 204

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY  F  ILSL R NK  GI E ++Y +RDES H+    ++   +  ENP +WT EF+ +
Sbjct: 205 FYGMFGMILSLYRQNKFRGIGEMFRYTLRDESNHIELLRNLFMDLIEENPDVWTPEFKAE 264

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R  + EA  LE  +  + +P   +GL      QY+ +IA+RR    GL+PL     NP 
Sbjct: 265 LRDAMSEAIALEKEFIADCLPVDSIGLRKEDFVQYIDYIADRRLEGCGLDPLTPGVTNPL 324

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PW++E++D+KKE+NFFE RVTEYQ+ + L+
Sbjct: 325 PWLAEMMDIKKEQNFFEGRVTEYQKASSLE 354


>gi|284043177|ref|YP_003393517.1| ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
 gi|283947398|gb|ADB50142.1| Ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
          Length = 364

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 197/335 (58%), Gaps = 16/335 (4%)

Query: 23  RMLNARSDVN-QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           R++  R  +   LLPL+YGWA+E Y +   NHW P +V M  D+  W+ +  L++ +R +
Sbjct: 30  RVVGGRETMTFNLLPLRYGWAYELYRTMKANHWEPEDVQMAKDIEQWRDERALSEIDRWI 89

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           ++  +G+F+++E +V +NI+  +   ++  E +  L R A EE +H+ +  Y+I+SLG+D
Sbjct: 90  VRMAIGYFSAAEGIVGDNILHVVRELMTASELKLVLGRHAHEENIHADSLLYMISSLGID 149

Query: 142 EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE-------FLQDLFVFYV 194
             E   M+ ++P+I AK  +    +Q L         +D D +         +++F+F  
Sbjct: 150 PHECEAMFDDIPTIRAKNAFVTSASQALR--------RDLDMQDPRSVALLAKNIFLFGQ 201

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG  FY  F  +LSL R  K+ GI   ++Y +RDES H+     ++ ++  ENP +WT
Sbjct: 202 CMEGTQFYGLFGMVLSLYRQGKLPGIGTMFRYTLRDESNHIELFRRLLRELVAENPEIWT 261

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + R ++ EA  LE  +  + +P   VGLNA    QY+ +IA+RR   +GLEPL  
Sbjct: 262 AEFRDELRELMREAVALEQRFIDDCLPVEGVGLNADEFAQYIDYIADRRLEGVGLEPLKP 321

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             ENP PW++E++D++KE+NFFE RVTEYQ+ + L
Sbjct: 322 GVENPLPWLAELMDVRKEQNFFEGRVTEYQKASAL 356


>gi|225164890|ref|ZP_03727109.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
 gi|224800504|gb|EEG18881.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
          Length = 362

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 118/330 (35%), Positives = 194/330 (58%), Gaps = 3/330 (0%)

Query: 22  KRMLNARSDVN-QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KR++N R  +   LLPLKY WA++ Y +   NHW P ++PM  D+  W+    +TD ER 
Sbjct: 26  KRVINGRETMTFNLLPLKYQWAYDLYRTMKANHWEPEDIPMGKDIEQWRDPRAVTDQERW 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I+  +G+F+++E +V +NI       ++ PE +  L R A EE +H+ +  Y+I+SLG+
Sbjct: 86  IIRMGIGYFSAAEGIVGDNIQHVTRELVTAPELKLVLGRHAHEENIHADSLLYMISSLGI 145

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +  E   M+ ++P+I  K  + ++ ++ L      T  ++  Q   +++F+F    EG  
Sbjct: 146 NPHECEAMFEDIPTIVRKNEFVVKNSRQLRRDLDLTQPENK-QLLARNMFLFGQCMEGTQ 204

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY  F  ILSL R NK  GI + ++Y +RDES H+    +++  +  ENP +WT  F+++
Sbjct: 205 FYGLFGMILSLYRQNKFPGIGQMFRYTLRDESNHIEVFRNLLMDLVEENPEIWTPGFKEE 264

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY-TENP 319
            R  + EA  LE  +  + +P   VGL       Y+ +IA+RR   +GL P+     +NP
Sbjct: 265 LRETMREAVTLEKEFIRDCLPVNAVGLAVDEFLTYIDYIADRRLEGVGLAPISATPIKNP 324

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            PW++E++D+KKE+NFFE RVTEYQ+ + L
Sbjct: 325 LPWLAEMMDIKKEQNFFEGRVTEYQKASSL 354


>gi|317122809|ref|YP_004102812.1| ribonucleoside-diphosphate reductase [Thermaerobacter marianensis
           DSM 12885]
 gi|315592789|gb|ADU52085.1| Ribonucleoside-diphosphate reductase [Thermaerobacter marianensis
           DSM 12885]
          Length = 336

 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 189/317 (59%), Gaps = 6/317 (1%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           QL PL+Y WA+        N W P E+P+ DD+  W+ +  LTDDER  ++  LGFF   
Sbjct: 22  QLFPLRYPWAYAHAQQGKRNTWFPEEIPLADDVRDWELR--LTDDERRAVELLLGFFNPM 79

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           ESLV +N+V++IY  L+ PE R YL RQ +EEA H+  F+Y++ +L +D   +F  +R+V
Sbjct: 80  ESLVTHNLVMSIYPLLTPPEVRLYLARQIWEEANHTMAFEYVLKTLPVDRERVFAAHRDV 139

Query: 153 PSITAKANWALQYT-QTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           P+I AK  +  + T Q L  P  +T   +  Q FL++L  +Y+V EG++FY GF    + 
Sbjct: 140 PAIRAKEAFQQELTRQLLVRPDVST--LEGRQAFLRNLIGYYIVLEGVFFYGGFLFAYTF 197

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            R N + G+A    ++++DESLHL+FGI +I  +  E+P L T EF ++ + ++  A  L
Sbjct: 198 RRRNLLKGLATLVDWVLKDESLHLSFGIHLITTLLEEHPELMTPEFAREVKGLILRAVEL 257

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  Y    +P+  +G++A     Y++++ +RR  ++GL P F  T NP  WM+  +D+ +
Sbjct: 258 ERDYNRALLPRPILGVSADYLNAYIEYVTDRRLDELGLGPHFG-TPNPAQWMATEVDVPE 316

Query: 332 EKNFFETRVTEYQQGAE 348
             NFFE R   Y+  A+
Sbjct: 317 IVNFFEARNIHYEVAAD 333


>gi|313903043|ref|ZP_07836438.1| Ribonucleoside-diphosphate reductase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313466767|gb|EFR62286.1| Ribonucleoside-diphosphate reductase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 336

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 187/317 (58%), Gaps = 6/317 (1%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           QL PL+Y WA+        N W P E+P+ DD+  W+ +  LTDDER  ++  LGFF   
Sbjct: 22  QLFPLRYPWAYAHAQQGKRNTWFPEEIPLADDVRDWELR--LTDDERRAVELLLGFFNPM 79

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           ESLV +N+V++IY  L+ PE R YL RQ +EEA H+  F+Y++ +L +D   +F  +R V
Sbjct: 80  ESLVTHNLVMSIYPLLTPPEIRLYLARQIWEEANHTMAFEYVLKTLPVDRERVFAAHRNV 139

Query: 153 PSITAKANWALQYT-QTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           P+I AK  +  + T Q L  P  +T   +  Q FL++L  +Y+V EG++FY GF    + 
Sbjct: 140 PAIRAKEAFQQELTRQLLVRPDVST--LEGRQAFLRNLIGYYIVLEGVFFYGGFLFAYTF 197

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            R N + G+A    ++++DESLHL+FGI +I  +  E+P L T  F ++ + ++  A  L
Sbjct: 198 RRRNLLKGLATLVDWVLKDESLHLSFGIHLITALLEEHPELMTPAFAREVKGLILRAVEL 257

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  Y    +P+  +G++A     Y++++ +RR  ++GL P F  T NP  WM+  +D+ +
Sbjct: 258 ERDYNRALLPRPILGVSADYLNAYVEYVTDRRLDELGLGPHFG-TPNPAKWMATEVDVPE 316

Query: 332 EKNFFETRVTEYQQGAE 348
             NFFE R   Y+  A+
Sbjct: 317 IVNFFEARNIHYEVAAD 333


>gi|171913278|ref|ZP_02928748.1| ribonucleotide-diphosphate reductase subunit beta [Verrucomicrobium
           spinosum DSM 4136]
          Length = 361

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 188/329 (57%), Gaps = 2/329 (0%)

Query: 22  KRMLNARSDVN-QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KR++N R  +   LLPLKY WA++ Y     NHW P ++ MQ D+  W+S + + + ER 
Sbjct: 26  KRVINGRQTMTFNLLPLKYQWAYDLYRVMKANHWEPEDIQMQKDVEQWRSVDQVAEVERW 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I   +G+F+++E +V +NI   +   ++ PE +  L R A EE +H+ +  Y+I+SLG+
Sbjct: 86  IIMMGIGYFSAAEGIVGDNIQHVVRELVTAPELKLVLGRHAHEENIHADSLLYMISSLGI 145

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +  E   M+ ++P+I  K  +  + +  L      T  ++  +   +++FVF    EG  
Sbjct: 146 NPHECEAMFEDIPTIVKKNAFVTRSSNALRRDLDLTQIENK-RLLAKNIFVFGQCMEGTQ 204

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY  F  ILSL R  K  GI   ++Y +RDES H+    ++   +  ENP +WT EF+++
Sbjct: 205 FYGLFGMILSLYRQGKFPGIGTMFRYTLRDESNHIKVFRNLFMDLIDENPEIWTPEFREE 264

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  LE  +  + +P   VGL A   E Y+ FIA+RR   +GL  L     NP 
Sbjct: 265 LVELMKEAVALEKEFIRDCLPVAAVGLTAGEFELYIDFIADRRLASVGLPALTPGIVNPL 324

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PW++E+ D++KE+NFFE  VT+YQ+ + L
Sbjct: 325 PWLAEMQDIRKEQNFFEGTVTDYQKASSL 353


>gi|88856487|ref|ZP_01131145.1| ribonucleotide-diphosphate reductase beta subunit [marine
           actinobacterium PHSC20C1]
 gi|88814354|gb|EAR24218.1| ribonucleotide-diphosphate reductase beta subunit [marine
           actinobacterium PHSC20C1]
          Length = 332

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 184/314 (58%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY WA + Y  A  N W P E+ + +D+A +K    +TD+ER  +   + +F  +E
Sbjct: 14  LKPIKYQWAMDLYDQAVANTWFPNEIQLGEDIADFKK---MTDEERHAVTFLMSYFNPNE 70

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y ++S  EC  YL +Q +EEA H  +F+Y++ +  +D    +N + ++P
Sbjct: 71  LLVNKALAFGVYPYVSAAECSLYLAKQMWEEANHCMSFEYVLETFPIDREAAYNSHIDIP 130

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + L+Y + ++  +    T +  Q+F+++L  + VV EG+WFY+GF   LS  +
Sbjct: 131 SMARKEEFELKYIRRMTEQTLDINTIEGKQDFIRNLVAYNVVLEGIWFYSGFMVALSFRQ 190

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FGI++I  +  ENP + T+EF  + R M+ +A  +E 
Sbjct: 191 RNLLRNFGSLMDWVVRDESLHLKFGINLILTVLEENPEIQTEEFADEIRQMILDAVEMEE 250

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           AY H+ +P G +GLNA    QY++++A+RR  ++G EP +K T NP  WM+   D  +  
Sbjct: 251 AYNHDLLPGGILGLNANYINQYVKYLADRRLEELGFEPHYKVT-NPAKWMATANDTLELV 309

Query: 334 NFFETRVTEYQQGA 347
           NFFE+  T Y+  A
Sbjct: 310 NFFESTNTSYEANA 323


>gi|221633388|ref|YP_002522613.1| ribonucleotide-diphosphate reductase subunit beta [Thermomicrobium
           roseum DSM 5159]
 gi|221156578|gb|ACM05705.1| ribonucleoside-diphosphate reductase, beta subunit [Thermomicrobium
           roseum DSM 5159]
          Length = 328

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 187/315 (59%), Gaps = 6/315 (1%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           +L PL + WA+     A +N W P EVP+ DD+  W  +  L+D+ER  ++  LGFF   
Sbjct: 15  ELFPLSHPWAYAHVQQAKHNTWFPEEVPLHDDVRDWHER--LSDEERRAVEMFLGFFNPM 72

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           ESLV  N++L++YR ++ PE R YL RQA+EEA H   F+Y+I +L LD   +F ++ E 
Sbjct: 73  ESLVTTNLLLSLYRAVTAPEARLYLARQAWEEANHVMAFEYVIKTLPLDRERVFGLHVEH 132

Query: 153 PSITAKANWALQYT-QTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           P++ AK  +  Q   Q L +P     + +  Q  +++L  ++V+ EG++FY+GFA  L+ 
Sbjct: 133 PAVAAKELFQRQLAEQWLVTPD--VESVEGLQRLVRNLVGYFVILEGIFFYSGFALALAF 190

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            + N + G+     ++++DESLHL+FGI +I  I  E+P + +  F ++ R ++  A  L
Sbjct: 191 RQRNLLRGLCTIVDWVLKDESLHLSFGIHLITTILEEHPEIMSAAFGRQLRELILRAVEL 250

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E AY    +P+  +GL+A    +Y+++IA+RR  ++GL P+     NP  WM   +D+ +
Sbjct: 251 EEAYNRAVLPEPLIGLDADVLNRYVRYIADRRLEELGL-PIAFGEPNPLRWMVAQVDMPE 309

Query: 332 EKNFFETRVTEYQQG 346
             NFFE R   Y+ G
Sbjct: 310 IVNFFEARNIHYEVG 324


>gi|328950373|ref|YP_004367708.1| Ribonucleoside-diphosphate reductase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450697|gb|AEB11598.1| Ribonucleoside-diphosphate reductase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 332

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 184/328 (56%), Gaps = 5/328 (1%)

Query: 21  DKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           D R+    S +  +L PL + WA+       +N W P EVP+ +D+  W  K  LT++ER
Sbjct: 4   DHRLFGPPSLEAIELFPLAHPWAYAHVQQGKHNTWFPEEVPLGEDVRDWHEK--LTEEER 61

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
                 LGFF   ESLV  N+VLAI+ ++  PE R YL RQ +EEA H+  F+Y++ +L 
Sbjct: 62  HAASLLLGFFNPMESLVTQNLVLAIFPYVRAPEARLYLARQIWEEANHTMAFEYVLKTLP 121

Query: 140 LDEGELFNMYREVPSITAKANWALQYTQTL-SSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           +D  ++F  +REVP++ AK  +    TQ L         T+   +  L++L  ++VV EG
Sbjct: 122 VDREKVFAAHREVPAVRAKEAFQTALTQALLQQHPLDLETRSGQEALLKNLVGYFVVLEG 181

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++FY GF   LS  R N + G+     + ++DESLHL+FG+ +I     E   + T    
Sbjct: 182 IFFYAGFLLALSWRRRNLLKGLGAIIDWTLKDESLHLSFGLHLITGFLEEYSEVMTPRLA 241

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ R ++ EA  LE AY    +P+  +GL+A +   Y++++A+RR  ++GLE  F  T N
Sbjct: 242 REVRGLILEAVQLERAYNQALLPRPILGLSAETLNAYVEYVADRRLEELGLEAAFG-TPN 300

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQG 346
           P  WM+  +D+ +  NFFE   T Y+ G
Sbjct: 301 PAKWMATEVDVPEIVNFFEAVNTSYEVG 328


>gi|196233679|ref|ZP_03132520.1| Ribonucleoside-diphosphate reductase [Chthoniobacter flavus
           Ellin428]
 gi|196222349|gb|EDY16878.1| Ribonucleoside-diphosphate reductase [Chthoniobacter flavus
           Ellin428]
          Length = 390

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/342 (35%), Positives = 185/342 (54%), Gaps = 3/342 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   + R  +  KR++N  RS    +LPLKY  A+  Y     NHW P  + M  D   W
Sbjct: 43  LDKAKARARLAGKRVINGLRSAELNVLPLKYHEAYRIYKQMKANHWEPDVIDMTRDSQQW 102

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
            +   L+  ER +I+  +G+F+++E +V ++++  I  +L+  E +   LR   EE++H 
Sbjct: 103 NT-GALSPKERWIIEMGVGYFSAAEGIVGDSVLHVIEDNLTAAELKHASLRHIAEESIHM 161

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
            +  +II SL +D  E+   + ++PS+  K  +  ++   L      T T +  Q+F + 
Sbjct: 162 DSLLHIIGSLNIDLDEVTAKFSDIPSVQRKNAFITRHMPELKMGIDLTQTANK-QKFAKA 220

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           +F    V EG  FY  FA ILSL R NKM GI + +QY +RDES H+  G  ++ Q+  E
Sbjct: 221 IFGITQVMEGTQFYALFAMILSLHRQNKMTGIGQMFQYTLRDESNHIELGRYILTQLIAE 280

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT EF+ +    + E   LE  +  + +P+  VG+       Y+++ A+RR   + 
Sbjct: 281 NPDIWTPEFRAELVEFMREGVELEKEFVRDCLPEDGVGMTQADFLTYVEYNADRRLAGLD 340

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           L  L     NPF W+ EVI L+KEKNFFETRVTEYQ    LK
Sbjct: 341 LPALSGVKTNPFAWLDEVIFLRKEKNFFETRVTEYQTSGSLK 382


>gi|148273612|ref|YP_001223173.1| ribonucleotide-diphosphate reductase subunit beta [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|170782700|ref|YP_001711034.1| ribonucleotide-diphosphate reductase subunit beta [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|147831542|emb|CAN02508.1| putative ribonucleoside-diphosphate reductase beta subunit
           [Clavibacter michiganensis subsp. michiganensis NCPPB
           382]
 gi|169157270|emb|CAQ02455.1| ribonucleoside-diphosphate reductase beta subunit [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 331

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 181/314 (57%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA + Y  A  N W P E+ + +D+A +K    +TD+ER  I   + +F  +E
Sbjct: 15  LKPVNYQWAMDLYDQAVANTWFPNEIQLGEDIADFKK---MTDEERHAITFLMSYFNPNE 71

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++ PEC  YL +Q +EEA H  +F+Y++ +  +D    +N + ++P
Sbjct: 72  LLVNKALAFGVYPYINAPECHLYLAKQMWEEANHCMSFEYVLETFPIDREAAYNSHVDIP 131

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + +++ + ++  +    T +  ++F+++L  + V+ EG+WFY+GF   LS  +
Sbjct: 132 SMARKEEFEVKFIKRMTEQTLDITTTEGKKDFVRNLVAYNVILEGIWFYSGFMVSLSFRQ 191

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +I+RDESLHL FGI++I  +  ENP L T+EF  + + M+ +A  +E 
Sbjct: 192 RNLLRNFGSLMDWIVRDESLHLKFGINLILTVLEENPDLQTEEFAAEIKQMILDAVEMEE 251

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P G +GLNA    QY++++A+RR  ++G E  +K + NP  WM+   D  +  
Sbjct: 252 QYNRDLLPNGILGLNANYINQYVKYLADRRLEELGFEAEYKVS-NPAKWMATANDTLQLV 310

Query: 334 NFFETRVTEYQQGA 347
           NFFE+  T Y+  A
Sbjct: 311 NFFESTNTSYESNA 324


>gi|28493649|ref|NP_787810.1| ribonucleotide-diphosphate reductase subunit beta [Tropheryma
           whipplei str. Twist]
 gi|28572842|ref|NP_789622.1| ribonucleotide-diphosphate reductase subunit beta [Tropheryma
           whipplei TW08/27]
 gi|28410975|emb|CAD67360.1| ribonucleotide-diphosphate reductase small chain [Tropheryma
           whipplei TW08/27]
 gi|28476691|gb|AAO44779.1| ribonucleotide reductase beta chain [Tropheryma whipplei str.
           Twist]
          Length = 327

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 178/314 (56%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y WA + Y  A  N W P E+ + +D+A +K    +T +E+  +   + +F  +E
Sbjct: 14  LKPVRYQWAMDLYEQAVANTWFPNEIQLGEDIADFKK---MTHEEKHAVTFLMSYFNPNE 70

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++ PEC  YL +Q +EEA H  +F+Y++ +  +D  E ++ + EVP
Sbjct: 71  LLVNKALAFGVYPYINAPECHLYLAKQMWEEANHCMSFEYVLETFPIDREEAYSSHIEVP 130

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + ++Y + ++  +    T +  ++F+++L  + VV EG+WFY+GF   L   +
Sbjct: 131 SMARKEEFEVEYIRRMTEETLDITTTEGKRDFIRNLVAYNVVLEGIWFYSGFMAALYFRQ 190

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +I+RDESLHL FGI++I  +  ENP L T +F  + R M+     +E 
Sbjct: 191 RNLLRNFGSLIDWIVRDESLHLKFGINLILTVLEENPDLQTSDFADEIRGMIIAGVEMEE 250

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y H+ +P G +GLN+    QY++++A+RR  ++G +P +  T NP  WM+   D  +  
Sbjct: 251 EYNHDLLPNGILGLNSGYINQYVKYLADRRLEELGFDPEYNVT-NPAKWMATANDTFELV 309

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 310 NFFEAINTSYESNA 323


>gi|50955339|ref|YP_062627.1| ribonucleotide-diphosphate reductase subunit beta [Leifsonia xyli
           subsp. xyli str. CTCB07]
 gi|50951821|gb|AAT89522.1| ribonucleoside-diphosphate reductase, beta chain [Leifsonia xyli
           subsp. xyli str. CTCB07]
          Length = 329

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 182/315 (57%), Gaps = 4/315 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY WA + Y  A  N W P E+ + +D+A +K    +TD+ER  +   + +F  +E
Sbjct: 14  LKPVKYQWAMDLYDQAVANTWFPNEIQIGEDIADFKK---MTDEERHAVTFLMSYFNPNE 70

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  E   YL +Q +EEA H  +F+Y++ +  +D  + +N + +VP
Sbjct: 71  LLVNKALAFGVYPYINAAEAHLYLAKQMWEEANHCMSFEYVLETFPIDREQAYNSHVDVP 130

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+ +K  + +++ + ++  +    T +  Q+F+++L  + V+ EG+WFY+GF   LS  +
Sbjct: 131 SMASKEEFEVRFIKRMTEQALDITTTEGKQDFIRNLIAYNVILEGIWFYSGFMVALSFRQ 190

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FGI++I  +  ENP L T EF  + + M+ +A  +E 
Sbjct: 191 RNLLRNFGSLIDWVVRDESLHLKFGINLILTVLEENPDLQTPEFAAEIKQMILDAVEMEE 250

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P G +GLNA    QY++++A+RR  ++G E  +K + NP  WM+   D  +  
Sbjct: 251 QYNRDLLPGGILGLNANYINQYVKYLADRRLEELGFEAEYKVS-NPAKWMATANDTLELV 309

Query: 334 NFFETRVTEYQQGAE 348
           NFFE+  T Y+  A+
Sbjct: 310 NFFESTNTSYESNAK 324


>gi|311743885|ref|ZP_07717691.1| ribonucleotide-diphosphate reductase beta subunit [Aeromicrobium
           marinum DSM 15272]
 gi|311313015|gb|EFQ82926.1| ribonucleotide-diphosphate reductase beta subunit [Aeromicrobium
           marinum DSM 15272]
          Length = 357

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 179/316 (56%), Gaps = 4/316 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA E Y  A  N W P E+ + +DLA ++    ++D+ER  +   + +F  +E
Sbjct: 45  LKPVTYPWAMELYDQAVANTWFPNEIQLGEDLADFER---MSDEERHALTFLMSYFNPNE 101

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H  +F+Y++ +  +D    +  +  VP
Sbjct: 102 LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMSFEYVLETFPIDREAAYGSHVTVP 161

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+ AK  + +++ + ++  +    T +  Q+F+++L  + V+ EG+WFY+GF   LS  +
Sbjct: 162 SMAAKEEFEIRFIRRMTEQTLDITTTEGKQDFVRNLVAYNVILEGIWFYSGFMVALSFRQ 221

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +I+RDESLHL FGI++I  +  ENP + T EF  + + M+ +A  +E 
Sbjct: 222 RNLLRNFGSLIDWIVRDESLHLKFGINLILTVLEENPEVATAEFAAEIQQMVLDAVEMEE 281

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           AY  + +P G +GLNA    QY++++A+RR  ++G  P +  T NP  WM+   D  +  
Sbjct: 282 AYNRDLLPGGILGLNADYINQYVRYLADRRLEELGFGPHYGAT-NPAKWMATANDTLQLV 340

Query: 334 NFFETRVTEYQQGAEL 349
           NFFE   T Y+  A+L
Sbjct: 341 NFFEATNTSYEVNAKL 356


>gi|117928932|ref|YP_873483.1| ribonucleoside-diphosphate reductase [Acidothermus cellulolyticus
           11B]
 gi|117649395|gb|ABK53497.1| Ribonucleoside-diphosphate reductase [Acidothermus cellulolyticus
           11B]
          Length = 348

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/324 (34%), Positives = 184/324 (56%), Gaps = 11/324 (3%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E++ +A  N W   EV +  DLA  +    L+  E  ++KR + FFA+ +
Sbjct: 28  LRPMRYPHFFERFKAAIRNTWTVEEVDLHSDLADLRK---LSPAEHHLVKRLVAFFATGD 84

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELFNMYR 150
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   DE    E F    
Sbjct: 85  TIVANNLVLNLYQHINSPEARLYLSRQLFEEAVHVQFYLALLDTYITDERERAEAFAAIE 144

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA++  ++  ++          D  + FL +L  F    EG++FY  FA +  
Sbjct: 145 NIPSIKRKADFCFRWIDSIFDLRELRTAADR-RSFLLNLICFAACIEGLFFYGAFAYVYF 203

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DVI+ ++ E P L+  E  +++R ML EA  
Sbjct: 204 LRSRGLLNGLASGTNWVFRDESMHMAFAFDVIDTVRREEPELFDDELARQAREMLAEAVD 263

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + + +G  G++      Y++ +A+RRC Q+GLEP++  + NPF +M E+ D++
Sbjct: 264 CETQFAEDLLGQGVPGMSLADMRSYLEHVADRRCVQLGLEPIYG-SPNPFTFM-ELQDVQ 321

Query: 331 KEKNFFETRVTEYQQG--AELKWD 352
           +  NFFE RV  YQ G   E+ +D
Sbjct: 322 ELSNFFERRVAAYQIGVSGEVAFD 345


>gi|238061574|ref|ZP_04606283.1| ribonucleoside-diphosphate reductase [Micromonospora sp. ATCC
           39149]
 gi|237883385|gb|EEP72213.1| ribonucleoside-diphosphate reductase [Micromonospora sp. ATCC
           39149]
          Length = 344

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 179/317 (56%), Gaps = 9/317 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++++  A  N W   EV +  DLA       L+  ER ++ R + FFA+ +
Sbjct: 24  LRPMRYPHFFDRFKDAIKNTWTVEEVDLHSDLA---DLARLSPAERHLVSRLVAFFATGD 80

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMY---R 150
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   DE E F  +    
Sbjct: 81  TIVANNLVLNLYQHVNSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPDERERFAAFAAIE 140

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA +  ++  ++        T++  + FL +L  F    EG++FY  FA +  
Sbjct: 141 NIPSIRRKAEFCFRWIDSIFELR-ELKTREDRRAFLLNLICFAACIEGLFFYGAFAYVYF 199

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DV++ ++ E P L+  E  ++ R ML EA  
Sbjct: 200 LRSRGLLNGLASGTNWVFRDESMHMAFAFDVVDTVRHEEPDLFDDELARQVREMLAEAVE 259

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + + +G  GL+     QY+Q +A+RR  Q+G+ PL+  + NPF +M E+ D++
Sbjct: 260 CEAQFAEDLLEQGVSGLSLDDMRQYLQHVADRRLAQLGIAPLYG-SANPFAFM-ELQDVQ 317

Query: 331 KEKNFFETRVTEYQQGA 347
           +  NFFE RV+ YQ G 
Sbjct: 318 ELSNFFERRVSAYQVGV 334


>gi|312962626|ref|ZP_07777115.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
 gi|311283001|gb|EFQ61593.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
          Length = 136

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 217 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 276
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 1   MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 60

Query: 277 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 336
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 61  RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 120

Query: 337 ETRVTEYQQGAELKWD 352
           ETRV EYQ G  L WD
Sbjct: 121 ETRVIEYQTGGALSWD 136


>gi|50843560|ref|YP_056787.1| ribonucleotide-diphosphate reductase subunit beta
           [Propionibacterium acnes KPA171202]
 gi|282854887|ref|ZP_06264221.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J139]
 gi|289427904|ref|ZP_06429608.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J165]
 gi|295131638|ref|YP_003582301.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK137]
 gi|50841162|gb|AAT83829.1| ribonucleoside-diphosphate reductase beta chain [Propionibacterium
           acnes KPA171202]
 gi|282582033|gb|EFB87416.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J139]
 gi|289158787|gb|EFD06987.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J165]
 gi|291376691|gb|ADE00546.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK137]
 gi|313771782|gb|EFS37748.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL074PA1]
 gi|313808408|gb|EFS46875.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA2]
 gi|313810605|gb|EFS48319.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL083PA1]
 gi|313813765|gb|EFS51479.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL025PA1]
 gi|313818171|gb|EFS55885.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL046PA2]
 gi|313821029|gb|EFS58743.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA1]
 gi|313823899|gb|EFS61613.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA2]
 gi|313827161|gb|EFS64875.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL063PA1]
 gi|313831646|gb|EFS69360.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL007PA1]
 gi|313834800|gb|EFS72514.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL056PA1]
 gi|314924366|gb|EFS88197.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL001PA1]
 gi|314927054|gb|EFS90885.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA3]
 gi|314961874|gb|EFT05975.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA2]
 gi|314965892|gb|EFT09991.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL082PA2]
 gi|314974996|gb|EFT19091.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL053PA1]
 gi|314977908|gb|EFT22002.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL045PA1]
 gi|314979603|gb|EFT23697.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL072PA2]
 gi|314981613|gb|EFT25706.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA3]
 gi|314984684|gb|EFT28776.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA1]
 gi|314988338|gb|EFT32429.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA2]
 gi|314990428|gb|EFT34519.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA3]
 gi|315082361|gb|EFT54337.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL078PA1]
 gi|315083809|gb|EFT55785.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL027PA2]
 gi|315087306|gb|EFT59282.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA3]
 gi|315089724|gb|EFT61700.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL072PA1]
 gi|315092253|gb|EFT64229.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA4]
 gi|315094826|gb|EFT66802.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL060PA1]
 gi|315095599|gb|EFT67575.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL038PA1]
 gi|315104692|gb|EFT76668.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA2]
 gi|315107754|gb|EFT79730.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL030PA1]
 gi|327326613|gb|EGE68401.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL096PA3]
 gi|327332877|gb|EGE74609.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL096PA2]
 gi|327335278|gb|EGE76988.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL097PA1]
 gi|327447704|gb|EGE94358.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL043PA2]
 gi|327448579|gb|EGE95233.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL043PA1]
 gi|327449568|gb|EGE96222.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL013PA2]
 gi|328757395|gb|EGF71011.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL020PA1]
 gi|328762002|gb|EGF75508.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL099PA1]
 gi|332676502|gb|AEE73318.1| ribonucleoside-diphosphate reductase subunit beta
           [Propionibacterium acnes 266]
          Length = 328

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 171/314 (54%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P E+ + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYSWAYDLYNQAVANTWFPNEIQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + + + + ++  +    T +  Q+F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVAFIKRMTEQTLDITTVEGKQDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEE 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGILGMNADYVNDYVKYLADRRLEELGFEPEYRVV-NPAKWMATANDTLQVV 308

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 309 NFFEATNTSYEVNA 322


>gi|327328671|gb|EGE70431.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL103PA1]
          Length = 328

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 171/314 (54%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P E+ + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYSWAYDLYNQAVANTWFPNEIQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + + + + ++  +    T +  Q+F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVAFIKRMTEQTLDITTVEGKQDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEE 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGILGMNADYVNDYVKYLADRRLEELGFEPEYRIV-NPAKWMATANDTLQVV 308

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 309 NFFEATNTSYEVNA 322


>gi|289425969|ref|ZP_06427716.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK187]
 gi|289153512|gb|EFD02226.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK187]
 gi|313763766|gb|EFS35130.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL013PA1]
 gi|313802998|gb|EFS44206.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA2]
 gi|313816916|gb|EFS54630.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL059PA1]
 gi|313829718|gb|EFS67432.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL063PA2]
 gi|313839374|gb|EFS77088.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL086PA1]
 gi|314916474|gb|EFS80305.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA4]
 gi|314932316|gb|EFS96147.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL067PA1]
 gi|314956590|gb|EFT00842.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL027PA1]
 gi|314959472|gb|EFT03574.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA1]
 gi|314964864|gb|EFT08964.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL082PA1]
 gi|314968630|gb|EFT12728.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA1]
 gi|315079174|gb|EFT51177.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL053PA2]
 gi|315100241|gb|EFT72217.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL059PA2]
 gi|315102565|gb|EFT74541.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL046PA1]
 gi|315109517|gb|EFT81493.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL030PA2]
 gi|327455890|gb|EGF02545.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA3]
 gi|327458042|gb|EGF04697.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL083PA2]
 gi|328757204|gb|EGF70820.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA1]
 gi|328757585|gb|EGF71201.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL025PA2]
          Length = 328

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 171/314 (54%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P E+ + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYSWAYDLYNQAVANTWFPNEIQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + + + + ++  +    T +  Q+F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVAFIKRMTEQTLDITTVEGTQDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEE 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGILGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVV 308

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 309 NFFEATNTSYEVNA 322


>gi|313793687|gb|EFS41718.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA1]
 gi|327456018|gb|EGF02673.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL092PA1]
          Length = 328

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 170/314 (54%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P E+ + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYSWAYDLYNQAVANTWFPNEIQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + + + + ++  +    T +  Q+F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVAFIKRMTEQTLDITTVEGTQDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEE 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G  G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGIRGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVV 308

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 309 NFFEATNTSYEVNA 322


>gi|314918862|gb|EFS82693.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA1]
 gi|314921071|gb|EFS84902.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA3]
          Length = 328

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 171/314 (54%), Gaps = 4/314 (1%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P E+ + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYSWAYDLYNQAVANTWFPNEIQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + + + + ++  +    T +  ++F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVAFIKRMTEQTLDITTVEGTRDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEE 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGILGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVV 308

Query: 334 NFFETRVTEYQQGA 347
           NFFE   T Y+  A
Sbjct: 309 NFFEATNTSYEVNA 322


>gi|256391238|ref|YP_003112802.1| ribonucleoside-diphosphate reductase [Catenulispora acidiphila DSM
           44928]
 gi|256357464|gb|ACU70961.1| Ribonucleoside-diphosphate reductase [Catenulispora acidiphila DSM
           44928]
          Length = 331

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/324 (33%), Positives = 179/324 (55%), Gaps = 11/324 (3%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +++Y  A  N W   EV +  DL      + L+  ER ++ R + FFA+ +
Sbjct: 11  LRPMRYPHFFDRYRDAIKNTWTVEEVDLHSDLT---DLDRLSAAERHLVSRLVAFFATGD 67

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   DE E    F    
Sbjct: 68  TIVANNLVLNLYQHVNSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPDEDERTEAFAAVE 127

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA +  ++  +L +       +D  + FL +L  F    EG++FY  FA +  
Sbjct: 128 NIPSIRRKAEFCFRWIDSLGNLQRLESREDR-RAFLLNLICFAACIEGLFFYGAFAYVYF 186

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DV++ ++ E P L+ ++  Q+ R ML EA  
Sbjct: 187 LRSRGLLHGLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDEKMAQQVREMLAEAVE 246

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + +  G  GL       Y++ +A+RR  Q+GLEP++  T NP  +M E+ D++
Sbjct: 247 CETQFAGDLLGGGVSGLPVADMRAYLEHVADRRLEQLGLEPMYG-TANPLGFM-ELQDVQ 304

Query: 331 KEKNFFETRVTEYQ--QGAELKWD 352
           +  NFFE RV+ YQ   G  + +D
Sbjct: 305 ELSNFFERRVSAYQVAVGGSVSFD 328


>gi|330467634|ref|YP_004405377.1| ribonucleoside-diphosphate reductase [Verrucosispora maris
           AB-18-032]
 gi|328810605|gb|AEB44777.1| Ribonucleoside-diphosphate reductase [Verrucosispora maris
           AB-18-032]
          Length = 342

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/316 (33%), Positives = 177/316 (56%), Gaps = 9/316 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++++  A  N W   EV +  DLA       L+  E+ ++ R + FFA+ +
Sbjct: 22  LRPMRYPQFFDRFKDAIRNTWTVEEVDLHADLA---DLAKLSPAEQHLVSRLVAFFATGD 78

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG---ELFNMYR 150
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   DE    E F    
Sbjct: 79  TIVANNLVLNLYQHINSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPDEKQRYEAFAAVE 138

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA +  
Sbjct: 139 NIPSIARKAEFCFKWIDSIFELR-ELKTRADRRAFLLNLICFAACIEGLFFYGAFAYVYF 197

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DV++ ++ E P L+  E +Q+ R ML EA  
Sbjct: 198 LRSRGVLHGLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDAEMEQQVRDMLAEAVD 257

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +A + + +G  G+      QY+Q +A+RR   +G+ P++  T NPF +M E+ D++
Sbjct: 258 CEVQFAADLLEQGVSGMPLADMRQYLQHVADRRLAMLGIAPMYGST-NPFAFM-ELQDVQ 315

Query: 331 KEKNFFETRVTEYQQG 346
           +  NFFE RV+ YQ G
Sbjct: 316 ELSNFFERRVSAYQVG 331


>gi|256825983|ref|YP_003149943.1| ribonucleotide reductase subunit beta [Kytococcus sedentarius DSM
           20547]
 gi|256689376|gb|ACV07178.1| ribonucleotide reductase, beta subunit [Kytococcus sedentarius DSM
           20547]
          Length = 365

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 175/318 (55%), Gaps = 8/318 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E +  A  N W   E+ +  DLA     N L+  ER ++ R + FFA+ +
Sbjct: 44  LRPMRYPQFYEMFRDAIKNTWTVEEIDLHSDLA--DLHNKLSPAERHLVSRLVAFFATGD 101

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV- 152
           ++VANN+VL +Y H+++PE R YL RQ FEEAVH   +  ++ +   DE E F  +  V 
Sbjct: 102 TIVANNLVLNLYEHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYVPDEAERFEAFAAVE 161

Query: 153 --PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             PSI  KA +   +  ++ +      TK+  ++FL +L  F    EG++FY  FA +  
Sbjct: 162 NIPSIRTKAEFCFTWIDSIENLG-QLETKEQRRQFLLNLICFGTCIEGLFFYGAFAYVYF 220

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  +V+  ++ E P L+  E   + R ML EA  
Sbjct: 221 LRSRGLLNGLASGTNWVFRDESMHMAFAFEVVETVRSEEPDLFDAEMAGQVRQMLMEAVD 280

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + +  G  GL+      Y++ +A+RR  Q+G+  ++  T+NP  +M E+ D++
Sbjct: 281 AEAQFAEDLLGMGVAGLSVADMRAYLENVADRRAVQLGMPEIYG-TKNPLAFM-ELQDVQ 338

Query: 331 KEKNFFETRVTEYQQGAE 348
           +  NFFE RV+ YQ G E
Sbjct: 339 ELSNFFERRVSAYQVGVE 356


>gi|313836278|gb|EFS73992.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA2]
 gi|314928743|gb|EFS92574.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL044PA1]
 gi|314971220|gb|EFT15318.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA3]
 gi|328906508|gb|EGG26283.1| ribonucleotide-diphosphate reductase subunit beta
           [Propionibacterium sp. P08]
          Length = 324

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 173/314 (55%), Gaps = 8/314 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y WA++ Y  A  N W P EV + +DLA +     +T DE   +   + +F  +E
Sbjct: 13  LKPVTYPWAYDLYNQAVANTWFPNEVQLDEDLADFAR---MTPDEHHALTHLMSYFNPNE 69

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
            LV   +   +Y +++  EC  YL +Q +EEA H   F+Y++ +  +D  E +  +  VP
Sbjct: 70  LLVNKALAFGVYPYVNAAECHLYLAKQMWEEANHCMAFEYVLETFPIDRDEAYRSHIHVP 129

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           S+  K  + +++ + ++  +    T +  Q+F+++L  + ++ EG+WFY+GF   LS  +
Sbjct: 130 SMARKEAFEVEFIKRVTEQTLDITTVEGKQDFVRNLIAYNIILEGIWFYSGFMVALSFRQ 189

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            N +        +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E 
Sbjct: 190 RNLLRNFGSLIDWVVRDESLHLKFGMNLILTVLEENPDIATDEFAVEIHDMILKGVEMEA 249

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
            Y  + +P+G  G+NA     Y++++A+RR  ++GLEP + +  NP  WM+   D  +  
Sbjct: 250 QYNRDMLPRGIPGMNA----DYVKYLADRRLEELGLEPEY-HVANPAKWMATANDTLQLV 304

Query: 334 NFFETRVTEYQQGA 347
           NFFET  T Y+  A
Sbjct: 305 NFFETTNTSYEVNA 318


>gi|302867100|ref|YP_003835737.1| ribonucleotide reductase [Micromonospora aurantiaca ATCC 27029]
 gi|315506490|ref|YP_004085377.1| ribonucleotide reductase [Micromonospora sp. L5]
 gi|302569959|gb|ADL46161.1| ribonucleotide reductase [Micromonospora aurantiaca ATCC 27029]
 gi|315413109|gb|ADU11226.1| ribonucleotide reductase [Micromonospora sp. L5]
          Length = 342

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 179/316 (56%), Gaps = 9/316 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++++  A  N W   EV +  DLA       L+  ER ++ R + FFA+ +
Sbjct: 22  LRPMRYPRFFDRFKDAIKNTWTVEEVDLHSDLA---DLAKLSPAERHLVSRLVAFFATGD 78

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV- 152
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   DE E F  +  V 
Sbjct: 79  TIVANNLVLNLYQHVNSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPDEKERFAAFDAVE 138

Query: 153 --PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA +  
Sbjct: 139 NIPSIARKAEFCFRWIDSIFELR-ELRTRADRRAFLLNLICFAACIEGLFFYGAFAYVYF 197

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DV+  ++ E P L+  E +++ + ML EA  
Sbjct: 198 LRSRGLLNGLASGTNWVFRDESMHMAFAFDVVETVRAEEPDLFDDEMERQVKEMLAEAVE 257

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+++A + + +G  G++     +Y+Q +A+RR   +G+ P++  + NPF +M E+ D++
Sbjct: 258 CEVSFAEDLLGQGVPGMSLADMREYLQHVADRRLAVLGIAPMYG-SGNPFAFM-ELQDVQ 315

Query: 331 KEKNFFETRVTEYQQG 346
           +  NFFE RV+ YQ G
Sbjct: 316 ELSNFFERRVSAYQVG 331


>gi|297157411|gb|ADI07123.1| ribonucleoside-diphosphate reductase [Streptomyces bingchenggensis
           BCW-1]
          Length = 340

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 176/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +++Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 20  LRPMRYPDFYDRYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHLIGRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 77  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 133

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++        TKD  + FL +L  F    EG++FY  FA 
Sbjct: 134 AVENIPSIREKAEFCFRWIDSVDKID-RLETKDERRRFLLNLICFAACIEGLFFYGAFAY 192

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF   V++ ++ E P L+  E QQ+   ML E
Sbjct: 193 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFQVVDTVREEEPELFDDELQQQVTDMLRE 252

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +   +G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 253 AVEAELQFARDLCGEGLPGMNTESMRQYLECVADQRLARLGFAPVYG-SENPFSFM-ELQ 310

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
           ++++  NFFE R + YQ   E
Sbjct: 311 NVQELTNFFERRASAYQVAVE 331


>gi|269302771|gb|ACZ32871.1| ribonucleoside-diphosphate reductase beta subunit, truncated
           [Chlamydophila pneumoniae LPCoLN]
          Length = 159

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 114/142 (80%), Gaps = 2/142 (1%)

Query: 15  KRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV V  K ++N  + DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LWKS + 
Sbjct: 11  KRVEVSKKGLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKS-DE 69

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+HTF Y
Sbjct: 70  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTHTFLY 129

Query: 134 IITSLGLDEGELFNMYREVPSI 155
           I  SLGLDEGE+FN Y E  SI
Sbjct: 130 ICESLGLDEGEVFNAYNERASI 151


>gi|159040364|ref|YP_001539617.1| ribonucleoside-diphosphate reductase [Salinispora arenicola
           CNS-205]
 gi|157919199|gb|ABW00627.1| Ribonucleoside-diphosphate reductase [Salinispora arenicola
           CNS-205]
          Length = 350

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 189/348 (54%), Gaps = 16/348 (4%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    ++    GE+ + +D    L  R       P++Y   ++++  A  N W   EV +
Sbjct: 5   AETRTVTAATTGERHMLLDPGMDLTLR-------PMRYPHFFDRFKEAIKNTWTVEEVDL 57

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DLA       L+  ER ++ R + FFA+ +++VANN+VL +Y+H+++PE R YL RQ 
Sbjct: 58  HSDLA---DLAKLSPAERHLVSRLVAFFATGDTIVANNLVLNLYQHVNSPEGRLYLSRQL 114

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREV---PSITAKANWALQYTQTLSSPSFTTGT 178
           FEEAVH   +  ++ +   DE E F  +  V   PSI  KA +  ++  ++        T
Sbjct: 115 FEEAVHVQFYLNLLDTYVPDEKERFAAFAAVENIPSIARKAEFCFRWIDSIFELR-ELRT 173

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
           +   + FL +L  F    EG++FY  FA +  L     + G+A    ++ RDES+H+ F 
Sbjct: 174 RADRRAFLLNLICFAACIEGLFFYGAFAYVYFLRSRGLLNGLASGTNWVFRDESMHMAFA 233

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
            DV++ I+ E P L+  + +++ + M+ EA   E  +A + + +G  GL+     +Y+Q 
Sbjct: 234 FDVVDTIRAEEPDLFDADLERQIKDMVTEAVDCEAQFAEDLLEQGVSGLSLADMREYLQH 293

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQG 346
           +A+RR   +G+ P++  ++NPF +M E+ D+++  NFFE RV+ YQ G
Sbjct: 294 VADRRLVTLGIAPIYG-SQNPFAFM-ELQDVQELSNFFERRVSAYQVG 339


>gi|222834323|gb|EEE72800.1| predicted protein [Populus trichocarpa]
          Length = 146

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 99/118 (83%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 26  KRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMNRDIALWKDPNGL 85

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           T+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +Q
Sbjct: 86  TEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQ 143


>gi|42523460|ref|NP_968840.1| ribonucleotide-diphosphate reductase small chain [Bdellovibrio
           bacteriovorus HD100]
 gi|39575666|emb|CAE79833.1| ribonucleotide-diphosphate reductase small chain [Bdellovibrio
           bacteriovorus HD100]
          Length = 336

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 104/317 (32%), Positives = 177/317 (55%), Gaps = 8/317 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   +E Y +   N W   EV    DL    SK  +T+ E+ +I+R + FFA+ +
Sbjct: 15  LRPMKYPIFYEMYKNGIKNTWTVDEVDFSTDLVDLHSK--MTESEKHLIRRLVAFFATGD 72

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL--GLDE-GELFNMYR 150
           S+V NN+VL +Y+H+++PE R YL RQ +EEA+H   +  ++ +     DE  E F    
Sbjct: 73  SIVGNNLVLNLYKHVNSPEGRMYLSRQLYEEALHVQFYLTLLDNYIPNPDERAEAFAAVE 132

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA++  ++  +++  +     +D  + FL +L  F    EG++FY  FA +  
Sbjct: 133 NIPSIKKKADFCYKWIDSINELTELNTIEDR-RRFLMNLICFATCVEGLFFYAAFAYVYF 191

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F I+V+   + E P L+ ++ +     ML +A  
Sbjct: 192 LRSKGLLAGLASGTNWVFRDESMHMAFAIEVVKTARKEEPELFNQQMEDMVVQMLEDAIE 251

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +AH+ +  G  GL+A    QY+++ A++R   + + P +   +NPF +M E+ D++
Sbjct: 252 CEMEFAHDVLNLGVAGLSAKDMRQYLEYCADQRLESLNIAPRYN-VKNPFIFM-ELQDMQ 309

Query: 331 KEKNFFETRVTEYQQGA 347
           +  NFFE RV+ YQ G 
Sbjct: 310 ELANFFERRVSAYQTGV 326


>gi|145596896|ref|YP_001161193.1| ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440]
 gi|145306233|gb|ABP56815.1| Ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440]
          Length = 350

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 178/316 (56%), Gaps = 9/316 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++++  A  N W   EV +  DL        L+  ER ++ R + FFA+ +
Sbjct: 30  LRPMRYPHFFDRFKEAIKNTWTVEEVDLHSDLG---DLAKLSSAERHLVSRLVAFFATGD 86

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV- 152
           ++VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   +E E F  +  V 
Sbjct: 87  TIVANNLVLNLYQHVNSPEGRLYLSRQLFEEAVHVQFYLNLLDTYVPEEKERFAAFAAVE 146

Query: 153 --PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA +  
Sbjct: 147 NIPSIARKAEFCFRWIDSIFELR-ELRTQADRRAFLLNLICFAACIEGLFFYGAFAYVYF 205

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES+H+ F  DV++ ++ E P L+  + +++ + M+ EA  
Sbjct: 206 LRSRGLLNGLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDADLERQVKEMVAEAVD 265

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +A + + +G  GL+     +Y+Q +A+RR   +G+ P++  + NPF +M E+ D++
Sbjct: 266 CEVQFAEDLLEQGVSGLSLADMREYLQHVADRRLVTLGIAPMYG-SANPFAFM-ELQDVQ 323

Query: 331 KEKNFFETRVTEYQQG 346
           +  NFFE RV+ YQ G
Sbjct: 324 ELSNFFERRVSAYQMG 339


>gi|239944172|ref|ZP_04696109.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces roseosporus NRRL 15998]
 gi|239990628|ref|ZP_04711292.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces roseosporus NRRL 11379]
 gi|291447643|ref|ZP_06587033.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           roseosporus NRRL 15998]
 gi|291350590|gb|EFE77494.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           roseosporus NRRL 15998]
          Length = 338

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 111/337 (32%), Positives = 182/337 (54%), Gaps = 16/337 (4%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
             +DK +L+   ++  L P++Y   +E+Y  A  N W   EV +  D+A       L+  
Sbjct: 3   TTEDKNLLDPGFELT-LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPG 58

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+ MI R + FFA+ +S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T 
Sbjct: 59  EQHMIGRLVAFFATGDSIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTL 115

Query: 138 LGL------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           L        D    F+   E+PSI  KA +  ++  ++        TK   + FL +L  
Sbjct: 116 LDTYLPDPDDRAAAFDAVEEIPSIREKAQFCFKWMDSVEKIE-RLETKADRRRFLLNLIC 174

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F    EG++FY  FA +        + G+A    ++ RDE++H+NF  +V++ ++ E P 
Sbjct: 175 FAACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPD 234

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           L+  E QQ+   ML EA   E+ +  +   +G  G+N  S  QY++ +A++R  ++G  P
Sbjct: 235 LFDDELQQQVTDMLKEAVEAELQFGRDLCGEGLPGMNTESMRQYLECVADQRLARLGF-P 293

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
               +ENPF +M E+  +++  NFFE R + YQ   E
Sbjct: 294 TVYGSENPFSFM-ELQGVQELTNFFERRPSAYQVAVE 329


>gi|329939692|ref|ZP_08288993.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           griseoaurantiacus M045]
 gi|329301262|gb|EGG45157.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           griseoaurantiacus M045]
          Length = 347

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 174/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       LT  ER +I R + FFA+ +
Sbjct: 27  LRPMRYPDFYERYRDAIKNTWHVEEVDLHSDVA---DLAKLTPAERHLIGRLVAFFATGD 83

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 84  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 140

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA 
Sbjct: 141 AVENIPSIREKAEFCFRWMDSVERLD-RLETRSDRRRFLLNLICFAACIEGLFFYGAFAY 199

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+ +E  ++   ML E
Sbjct: 200 VYWFRGRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPGLFDEELGRQVTDMLRE 259

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY+Q +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 260 AVEAELQFARDLCGDGLPGMNTESMRQYLQCVADQRLVRLGFAPVYG-SENPFSFM-ELQ 317

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 318 GVQELTNFFERRASAYQVAVE 338


>gi|311898297|dbj|BAJ30705.1| putative ribonucleoside-diphosphate reductase subunit beta
           [Kitasatospora setae KM-6054]
          Length = 339

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/335 (32%), Positives = 182/335 (54%), Gaps = 15/335 (4%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           D K+ML        L P++Y   +++Y  A  N W   EV +  D+A       L++ ER
Sbjct: 5   DRKKMLLDPGFELTLRPMRYPSFYDRYRDAIKNTWTVEEVDLHSDVA---DLAKLSEGER 61

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
            MI R + FFA+ +S+V+NN+VL++Y+H+++PE R YL RQ FEEAVH    Q+ +T L 
Sbjct: 62  HMIGRLVAFFATGDSIVSNNVVLSLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLD 118

Query: 140 L------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
                  D    F     +PSI  KA +  +Y   +     +  +K+  + FL +L  F 
Sbjct: 119 TYLPDPEDRNAAFAAVENIPSIAQKAQFCFKYMNAVDHID-SLRSKEDRRAFLLNLICFA 177

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++FY  FA +        + G+A    ++ RDES+H++F   V++ ++ E P L+
Sbjct: 178 ACVEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDESMHMDFAFSVVDTVREEEPDLF 237

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
             +  ++   ML EA   E+ +A +   +G  G+N  S  +Y+Q +A++R  ++GL P+ 
Sbjct: 238 DDKMARQVTEMLEEAVEAELQFARDLCGEGLPGMNTESMREYLQAVADQRLARLGL-PIR 296

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
             + NPF +M E+ ++++  NFFE RV+ YQ   E
Sbjct: 297 YGSTNPFGFM-ELQNVQELTNFFERRVSAYQIAVE 330


>gi|328884923|emb|CCA58162.1| Ribonucleotide reductase of class Ia (aerobic),beta subunit
           [Streptomyces venezuelae ATCC 10712]
          Length = 338

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/339 (32%), Positives = 180/339 (53%), Gaps = 16/339 (4%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           D+K +L+   ++  L P++Y   +E+Y  A  N W   EV +  D+A       LT  E+
Sbjct: 5   DEKNLLDPGFELT-LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLTPGEQ 60

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
            MI R + FFA+ +S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L 
Sbjct: 61  HMIGRLVAFFATGDSIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLD 117

Query: 140 L------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
                  D    F     +PSI  KA +  ++  ++          D  + FL +L  F 
Sbjct: 118 TYLPDPEDRAAAFAAVENIPSIREKAQFCFRWMDSVEKIDRLETQADR-RRFLLNLICFA 176

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++FY  FA +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+
Sbjct: 177 ACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELF 236

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               +Q+   ML EA   E+ +  +    G  G+N  S  +Y+Q +A++R  ++G  P++
Sbjct: 237 DDALRQQVTDMLKEAVEAELQFGRDLCGDGLPGMNTESMREYLQCVADQRLQRLGFAPVY 296

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +ENPF +M E+  +++  NFFE R + YQ   E   D
Sbjct: 297 G-SENPFSFM-ELQGVQELTNFFERRPSAYQVAVEGSVD 333


>gi|29829569|ref|NP_824203.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           avermitilis MA-4680]
 gi|29606677|dbj|BAC70738.1| putative ribonucleoside-diphosphate reductase beta chain
           [Streptomyces avermitilis MA-4680]
          Length = 338

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 172/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       LT  E+ +I R + FFA+ +
Sbjct: 18  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLTPAEQHLIGRLVAFFATGD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 75  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRTAAFA 131

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++   +        TK   + FL +L  F    EG++FY  FA 
Sbjct: 132 AVENIPSIREKAEFCFKWINEVEKLD-RLETKADRRRFLLNLICFAACIEGLFFYGAFAY 190

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  +V++ ++ E P L+  E QQ+   ML E
Sbjct: 191 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFEVVDTVRKEEPELFDDELQQQVTDMLRE 250

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 251 AVEAELQFGRDLCGDGLPGMNTESMRQYLECVADQRLQRLGFAPVYG-SENPFSFM-ELQ 308

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 309 GVQELTNFFERRASAYQVAVE 329


>gi|320008647|gb|ADW03497.1| Ribonucleoside-diphosphate reductase [Streptomyces flavogriseus
           ATCC 33331]
          Length = 338

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 174/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 18  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMIGRLVAFFATGD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F+
Sbjct: 75  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRAAAFD 131

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
              E+PSI  KA +  ++  ++        TK   + FL +L  F    EG++FY  FA 
Sbjct: 132 AVEEIPSIREKAQFCFRWMDSVEKIE-RLETKADRRRFLLNLICFAACIEGLFFYGAFAY 190

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+  E +Q+   ML E
Sbjct: 191 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPDLFDDELRQQVTDMLKE 250

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +    G  G+N  S  QY++ +A++R  ++G   L+  +ENPF +M E+ 
Sbjct: 251 AVEAELQFGRDLCGDGLPGMNTESMRQYLECVADQRLTRLGFPALYG-SENPFSFM-ELQ 308

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 309 GVQELTNFFERRPSAYQVAVE 329


>gi|297192180|ref|ZP_06909578.1| ribonucleoside-diphosphate reductase subunit beta protein
           [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720175|gb|EDY64083.1| ribonucleoside-diphosphate reductase subunit beta protein
           [Streptomyces pristinaespiralis ATCC 25486]
          Length = 340

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 176/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 20  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMIGRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 77  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRTAAFA 133

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA++  ++  ++ S      T+   + FL +L  F    EG++FY  FA 
Sbjct: 134 AVENIPSIREKASFCFKWMDSVESID-RLETQADRRRFLLNLICFAACIEGLFFYGAFAY 192

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+  E +Q+   ML E
Sbjct: 193 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDELRQQVTDMLKE 252

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +   +G  G+N  S  +Y+Q +A++R  ++G  P++  ++NPF +M E+ 
Sbjct: 253 AVEAELQFGRDLCGEGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SQNPFSFM-ELQ 310

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 311 GVQELTNFFERRPSAYQVAVE 331


>gi|239982206|ref|ZP_04704730.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           albus J1074]
 gi|291454052|ref|ZP_06593442.1| ribonucleotide-diphosphate reductase subunit small [Streptomyces
           albus J1074]
 gi|291357001|gb|EFE83903.1| ribonucleotide-diphosphate reductase subunit small [Streptomyces
           albus J1074]
          Length = 350

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 176/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 30  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHLIGRLVAFFATGD 86

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D  + F 
Sbjct: 87  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPADRADAFA 143

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++          D  ++FL +L  F    EG++FY  FA 
Sbjct: 144 AVENIPSIREKAEFCFRWMDSVDKLDQLESQADR-RKFLLNLICFAACIEGLFFYGAFAY 202

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + Q++   ML E
Sbjct: 203 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLQEQVVAMLKE 262

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  +Y++ +A++R  ++G  P++  ++NPF +M E+ 
Sbjct: 263 AVEAELQFARDLCGDGLPGMNTESMREYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQ 320

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE RV+ YQ   E
Sbjct: 321 GVQELTNFFERRVSAYQVAVE 341


>gi|282861024|ref|ZP_06270089.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. ACTE]
 gi|282563682|gb|EFB69219.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. ACTE]
          Length = 340

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 173/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 20  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMIGRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F+
Sbjct: 77  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRAAAFD 133

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
              E+PSI  KA +  ++  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 134 AVEEIPSIREKAQFCFKWMDSVEEIDRLETQADR-RRFLLNLICFAACIEGLFFYGAFAY 192

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML E
Sbjct: 193 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLRE 252

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +   +G  G+N  S  QY++ +A++R  ++G   L+  +ENPF +M E+ 
Sbjct: 253 AVEAELQFGRDLCGEGLPGMNTESMRQYLECVADQRLTRLGFPALYG-SENPFSFM-ELQ 310

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 311 GVQELTNFFERRPSAYQVAVE 331


>gi|182436093|ref|YP_001823812.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326776718|ref|ZP_08235983.1| Ribonucleoside-diphosphate reductase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464609|dbj|BAG19129.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326657051|gb|EGE41897.1| Ribonucleoside-diphosphate reductase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 338

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 173/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 18  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMIGRLVAFFATGD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F+
Sbjct: 75  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFD 131

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
              E+PSI  KA +  ++  ++        TK   + FL +L  F    EG++FY  FA 
Sbjct: 132 AVEEIPSIREKAQFCFRWMDSVEKID-RLETKADRRRFLLNLICFAACIEGLFFYGAFAY 190

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML E
Sbjct: 191 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPDLFDDALQQQVTDMLKE 250

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +   +G  G+N  S  QY++ +A++R  ++G  P    +ENPF +M E+ 
Sbjct: 251 AVEAELQFGRDLCGEGLPGMNTESMRQYLECVADQRLARLGF-PTVYGSENPFSFM-ELQ 308

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 309 GVQELTNFFERRPSAYQVAVE 329


>gi|294631326|ref|ZP_06709886.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. e14]
 gi|292834659|gb|EFF93008.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. e14]
          Length = 339

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 173/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       LT  E+ +I R + FFA+ +
Sbjct: 19  LRPMRYPDFYERYRDAIKNTWHVEEVDLHSDVA---DLAKLTPGEQHLIGRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 76  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +   +  ++        T+   + FL +L  F    EG++FY  FA 
Sbjct: 133 AVENIPSIREKAEFCFTWMDSVEKLD-RLETRADRRRFLLNLICFAACIEGLFFYGAFAY 191

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + +Q+   ML E
Sbjct: 192 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPDLFDDQLEQQVTDMLRE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 252 AVEAELQFARDLCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQ 309

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 310 GVQELTNFFERRPSAYQVAVE 330


>gi|310823070|ref|YP_003955428.1| ribonucleoside-diphosphate reductase subunit beta [Stigmatella
           aurantiaca DW4/3-1]
 gi|309396142|gb|ADO73601.1| Ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
          Length = 336

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 176/327 (53%), Gaps = 15/327 (4%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LNA  ++  L P+ Y   +E Y +A  N W   EV    DL   +SK  +TD ER +I 
Sbjct: 2   LLNAGMNLT-LRPMAYPVFFEMYRNAIKNTWTVEEVDFSTDLVDLRSK--MTDAERHLIH 58

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL--- 140
           R + FFA+ +S+V NN+VL +Y+HL+ PE R YL RQ +EEA+H    Q+ +T L     
Sbjct: 59  RLVAFFATGDSIVGNNLVLNLYKHLNAPEARMYLSRQLYEEALH---VQFYLTLLDTYVP 115

Query: 141 ---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
              D  + F     +PSI  KA + L++  ++   +    T++  + FL +L  F    E
Sbjct: 116 DPADRAKAFAAIDNIPSIQRKARFCLKWMDSIHDLA-QLKTREDRRRFLLNLICFAGCIE 174

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F+  FA +  L     + G+A    ++ RDES H+ F  + I   + E P L+    
Sbjct: 175 GLFFFAAFAYVYFLRSKGLLHGLAAGTNWVFRDESTHMAFAFEAIRVARQEEPDLFDARM 234

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           Q     M+ EA   E  +A + +  G  GL+     QY++++A++R   +GL P+F+  +
Sbjct: 235 QADVVAMMREAVECETLFAQDLLSGGVAGLSVQEMRQYLEYVADQRLTMLGLAPVFR-VK 293

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQ 344
           N  P+M ++ D+++  NFFE RV+ YQ
Sbjct: 294 NSLPFM-DLQDVQELTNFFERRVSAYQ 319


>gi|302536805|ref|ZP_07289147.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
 gi|302445700|gb|EFL17516.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
          Length = 356

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 173/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       LT  E+ MI R + FFA+ +
Sbjct: 36  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLTPAEQHMIGRLVAFFATGD 92

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F+
Sbjct: 93  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFD 149

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
              E+PSI  KA +  ++  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 150 AVEEIPSIREKAQFCFKWMDSVEKIERLETAADR-RRFLLNLICFAACIEGLFFYGAFAY 208

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML E
Sbjct: 209 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKE 268

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +    G  G+N  S  +Y++ +A++R  ++G  P++  ++NPF +M E+ 
Sbjct: 269 AVEAELQFGRDLCGDGLPGMNTDSMREYLECVADQRLVRLGFPPVYG-SQNPFSFM-ELQ 326

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 327 GVQELTNFFERRPSAYQVAVE 347


>gi|295836584|ref|ZP_06823517.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB74]
 gi|197697282|gb|EDY44215.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB74]
          Length = 345

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 173/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y +A  N W   EV +  D+A       LT  E+ +I R + FFA+ +
Sbjct: 25  LRPMRYPDFYERYRNAIKNTWTVEEVDLHSDVA---DLAKLTPGEQHLIGRLVAFFATGD 81

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D  + F 
Sbjct: 82  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRADAFA 138

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++   +          D  + FL +L  F    EG++FY  FA 
Sbjct: 139 AVENIPSIREKAEFCFKWIDEVEKIDRLESKADR-RRFLLNLICFAACIEGLFFYGAFAY 197

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  E +Q+ + ML  
Sbjct: 198 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDAELEQEVKDMLDG 257

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+ 
Sbjct: 258 AVNAELQFARDLCGDGLPGMNTESMREYLQCVADQRLQRLGFAPVYG-SSNPFSFM-ELQ 315

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 316 GVQELTNFFERRPSAYQVAVE 336


>gi|256785295|ref|ZP_05523726.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           lividans TK24]
 gi|289769189|ref|ZP_06528567.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           lividans TK24]
 gi|289699388|gb|EFD66817.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           lividans TK24]
          Length = 343

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 175/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 23  LRPMRYPDFYERYRDAIKNTWHVEEVDLHSDVA---DLAKLSPMEQHLIGRLVAFFATGD 79

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 80  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRAAAFA 136

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++ S      TK   + FL +L  F    EG++FY  FA 
Sbjct: 137 AVENIPSIREKAEFCFRWMDSVESID-RLETKADRRRFLLNLICFAACIEGLFFYGAFAY 195

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + +++   ML E
Sbjct: 196 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLREQVTDMLRE 255

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 256 AVEAELQFARDLCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQ 313

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 314 GVQELTNFFERRPSAYQVAVE 334


>gi|254384639|ref|ZP_04999978.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces sp.
           Mg1]
 gi|194343523|gb|EDX24489.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces sp.
           Mg1]
          Length = 338

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 180/337 (53%), Gaps = 16/337 (4%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           + D K +L+   ++  L P++Y   +E+Y  A  N W   EV +  D+A       LT  
Sbjct: 3   STDQKNLLDPGFELT-LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLTPA 58

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+ MI R + FFA+ +S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T 
Sbjct: 59  EQHMIGRLVAFFATGDSIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTL 115

Query: 138 LGL------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           L        D    F+   E+PSI  KA +  ++   +          D  + FL +L  
Sbjct: 116 LDTYLPDPDDRAAAFDAVEEIPSIREKAQFCFKWINEVEKLDRLETQADR-RRFLLNLIC 174

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F    EG++FY  FA +        + G+A    ++ RDE++H+NF  +V++ ++ E P 
Sbjct: 175 FAACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPE 234

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           L+    QQ+   ML EA   E+ +  +    G  G+N  S  +Y++ +A++R  ++G  P
Sbjct: 235 LFDDALQQQVTDMLKEAVDAELQFGRDLCGDGLPGMNTESMREYLECVADQRLVRLGFAP 294

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           ++  ++NPF +M E+  +++  NFFE R + YQ   E
Sbjct: 295 VYG-SQNPFSFM-ELQGVQELTNFFERRPSAYQVAVE 329


>gi|21223593|ref|NP_629372.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           coelicolor A3(2)]
 gi|7328345|emb|CAB82486.1| class I ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces coelicolor A3(2)]
 gi|8546891|emb|CAB94610.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           coelicolor A3(2)]
          Length = 343

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 175/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 23  LRPMRYPDFYERYRDAIKNTWHVEEVDLHSDVA---DLAKLSPMEQHLIGRLVAFFATGD 79

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 80  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRAAAFA 136

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++ S      TK   + FL +L  F    EG++FY  FA 
Sbjct: 137 AVENIPSIREKAEFCFRWMDSVESID-RLETKADRRRFLLNLICFAACIEGLFFYGAFAY 195

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + +++   ML E
Sbjct: 196 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLREQVTDMLRE 255

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 256 AVEAELQFARDLCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQ 313

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 314 GVQELTNFFERRPSAYQVAVE 334


>gi|302542646|ref|ZP_07294988.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302460264|gb|EFL23357.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           himastatinicus ATCC 53653]
          Length = 343

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +++Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 23  LRPMRYPQFYDRYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMISRLVAFFATGD 79

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 80  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAASFA 136

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 137 AVENIPSIREKAEFCFRWMDSVEKIDRLESKADR-RRFLLNLICFAACIEGLFFYGAFAY 195

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDES+H+ F   V++ ++ E P L+  + +++   ML E
Sbjct: 196 VYWFRSRGLLHGLATGTNWVFRDESMHMEFAFSVVDTVREEEPDLFDDDLERQVTDMLKE 255

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +AH+    G  G+N  S   Y++ +A++R  ++G   +F  +ENPF +M E+ 
Sbjct: 256 AVEAELQFAHDLCGDGLPGMNTESMRAYLECVADQRLARLGFPAVFG-SENPFSFM-ELQ 313

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
           D+++  NFFE R + YQ   E
Sbjct: 314 DVQELTNFFERRASAYQVAVE 334


>gi|302554045|ref|ZP_07306387.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           viridochromogenes DSM 40736]
 gi|302471663|gb|EFL34756.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           viridochromogenes DSM 40736]
          Length = 341

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 174/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 21  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPAEQHLIGRLVAFFATGD 77

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 78  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRTAAFA 134

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA++  ++  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 135 AVENIPSIREKASFCFKWMDSVEKLDRLETQADR-RRFLLNLICFAACIEGLFFYGAFAY 193

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + +Q+   ML E
Sbjct: 194 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLRQEVTDMLRE 253

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 254 AVEAELQFARDLCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQ 311

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 312 GVQELTNFFERRPSAYQVAVE 332


>gi|225873704|ref|YP_002755163.1| ribonucleoside-diphosphate reductase, beta subunit [Acidobacterium
           capsulatum ATCC 51196]
 gi|225791613|gb|ACO31703.1| ribonucleoside-diphosphate reductase, beta subunit [Acidobacterium
           capsulatum ATCC 51196]
          Length = 340

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 173/317 (54%), Gaps = 8/317 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++ +     N W   EV  Q DL   K +  L+  E  +I+R + FFA+ +
Sbjct: 19  LRPMRYPVFYDMFRDGIKNTWTVEEVDFQTDLVDLKQR--LSPAEVHLIQRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD---EGELFNMYR 150
           S+V+NN+VL +Y+H+++PE R YL RQ +EEAVH   +  ++ +   D       F    
Sbjct: 77  SIVSNNLVLNLYKHINSPEARLYLSRQLYEEAVHVQFYLTLLDNYVPDPEARAAAFAAVE 136

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI+ KA++ +++  ++        T++  ++FL +L  F    EG++F+  FA +  
Sbjct: 137 NIPSISKKADFCMKWMDSIQQLD-ELKTREHRRQFLLNLICFAACIEGLFFFAAFAYVYF 195

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES HL F  +V+N ++ + P LW  + +     MLHEA  
Sbjct: 196 LRSKGLLHGLASGTNWVFRDESCHLEFAFEVVNVVRSQEPDLWDAQLEADIVEMLHEAVD 255

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + +  G  GL+     QY+ ++A+ R  ++G+ P F   +NPF +M E+ D++
Sbjct: 256 AETQFAEDLLSGGVAGLSVRDMRQYLGYVADSRLQRLGIAPAFG-VKNPFSFM-ELQDVQ 313

Query: 331 KEKNFFETRVTEYQQGA 347
           +  NFFE RV+ YQ   
Sbjct: 314 ELTNFFERRVSAYQTAV 330


>gi|271967540|ref|YP_003341736.1| ribonucleoside-diphosphate reductase [Streptosporangium roseum DSM
           43021]
 gi|270510715|gb|ACZ88993.1| Ribonucleoside-diphosphate reductase [Streptosporangium roseum DSM
           43021]
          Length = 331

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 171/318 (53%), Gaps = 9/318 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y +A  N W   EV +  DLA       +T +ER +I R + FFA+ +
Sbjct: 11  LRPMRYPEFYERYRAAIRNTWTVEEVDLNSDLA---DLARMTPEERHLINRLVAFFATGD 67

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+VANN+VL +Y+H++ PE R YL RQ FEEAVH   +  ++ +   D  E    F    
Sbjct: 68  SIVANNLVLNLYQHVNAPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDHDERVKAFAAVE 127

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA +  ++  +L         +D  + FL +L  F    EG++FY  FA +  
Sbjct: 128 HIPSIRNKAEFCFRWIDSLGGLDRLESREDR-RAFLLNLICFAACIEGLFFYGAFAYVYW 186

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDES+H+ F   V++ ++ E P L+  +   +   M+ EA  
Sbjct: 187 FRSRGLLSGLATGTNWVFRDESMHMEFAFSVVDTVRAEEPDLFDDKLGAQVTQMIEEAVE 246

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+A+A +    G  G+N     QY++++A++R  ++   P+   T NPF +M E+ D++
Sbjct: 247 AELAFAADLCGDGMSGMNVEQMRQYLEYVADQRLVRLRF-PVRYGTANPFAFM-ELQDVQ 304

Query: 331 KEKNFFETRVTEYQQGAE 348
           +  NFFE RV+ YQ   E
Sbjct: 305 ELANFFERRVSAYQVAVE 322


>gi|297202281|ref|ZP_06919678.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sviceus ATCC 29083]
 gi|197710199|gb|EDY54233.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sviceus ATCC 29083]
          Length = 340

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+        L+  E+ +I R + FFA+ +
Sbjct: 20  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVT---DLAKLSPAEQHLIGRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F+
Sbjct: 77  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPQDRAAAFD 133

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++   +          D  + FL +L  F    EG++FY  FA 
Sbjct: 134 AVENIPSIREKAEFCFRWINEVEKLDRLESQADR-RRFLLNLICFAACIEGLFFYGAFAY 192

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+    QQ+   ML E
Sbjct: 193 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDRLQQQVTDMLAE 252

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 253 AVEAELQFARDLCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQ 310

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 311 GVQELTNFFERRPSAYQVAVE 331


>gi|307328555|ref|ZP_07607729.1| Ribonucleoside-diphosphate reductase [Streptomyces violaceusniger
           Tu 4113]
 gi|306885823|gb|EFN16835.1| Ribonucleoside-diphosphate reductase [Streptomyces violaceusniger
           Tu 4113]
          Length = 340

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 180/335 (53%), Gaps = 16/335 (4%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           D K +L+   ++  L P++Y   +++Y  A  N W   EV +  D+        L+  E+
Sbjct: 7   DTKNLLDPGFELT-LRPMRYPEFYDRYRDAIKNTWTVEEVDLHSDVT---DLAKLSPGEQ 62

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
            +I R + FFA+ +S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L 
Sbjct: 63  HLIGRLVAFFATGDSIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLD 119

Query: 140 L------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
                  D    F     +PSI  KA +  ++  ++        TK   + FL +L  F 
Sbjct: 120 TYLPDPDDRAAAFAAVENIPSIREKAEFCFRWMDSVEKID-RLETKQDRRRFLLNLICFA 178

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++FY  FA +  L     + G+A    ++ RDES+H+ F   V++ ++ E P L+
Sbjct: 179 ACIEGLFFYGAFAYVYWLRSRGLLHGLATGTNWVFRDESMHMEFAFSVVDTVREEEPDLF 238

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
             E +Q+   ML EA   E+ +A +    G  G+N  S ++Y+Q +A++R  ++G   +F
Sbjct: 239 DDELRQQVTDMLKEAVEAELQFARDLCGDGLPGMNTASMQEYLQCVADQRLMRLGFPAVF 298

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
             +ENPF +M E+ ++++  NFFE R + YQ   E
Sbjct: 299 G-SENPFSFM-ELQNVQELTNFFERRASAYQVAVE 331


>gi|302558498|ref|ZP_07310840.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           griseoflavus Tu4000]
 gi|302476116|gb|EFL39209.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           griseoflavus Tu4000]
          Length = 341

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 174/321 (54%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+ +E+ +I R + FFA+ +
Sbjct: 21  LRPMRYPDFYERYRDAIKNTWHVEEVDLHSDVA---DLAKLSPEEQHLIGRLVAFFATGD 77

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 78  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 134

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 135 AVENIPSIREKAEFCFRWMDSVEKLDRLETQADR-RRFLLNLICFAACIEGLFFYGAFAY 193

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+ ++  Q+   ML E
Sbjct: 194 VYWFRGRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDEQLGQQVTAMLRE 253

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 254 AVEAELQFARDLCGDGLPGMNTESMRQYLECVADQRLVRLGFAPVYG-SENPFSFM-ELQ 311

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 312 GVQELTNFFERRPSAYQVAVE 332


>gi|108763495|ref|YP_633213.1| ribonucleoside-diphosphate reductase subunit beta [Myxococcus
           xanthus DK 1622]
 gi|108467375|gb|ABF92560.1| ribonucleoside-diphosphate reductase, beta subunit [Myxococcus
           xanthus DK 1622]
          Length = 349

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 171/314 (54%), Gaps = 8/314 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y   +E Y +A  N W   EV    DL   +SK  +TD ER +I R + FFA+ +
Sbjct: 24  LRPMAYPQFFEMYRNAIKNTWTVEEVDFSTDLVDLRSK--MTDAERHLIHRLVAFFATGD 81

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+V NN+VL +Y+HL+ PE R YL RQ +EEA+H   +  ++ +   D  E    F    
Sbjct: 82  SIVGNNLVLNLYKHLNAPEARMYLSRQLYEEALHVQFYLTLLDTYVPDPAERAMAFAAVD 141

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA + +++  ++     T  TK   ++FL +L  F    EG++F+  FA +  
Sbjct: 142 NIPSIQRKAQFCMKWMDSIQGLD-TLQTKAHRRQFLLNLICFAGCIEGLFFFAAFAYVYF 200

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES H+ F  + I   + E P L+  + ++    ML EA  
Sbjct: 201 LRSKGLLNGLAAGTNWVFRDESAHMAFAFESIQVARKEEPDLFDAQMERDVVAMLREAVE 260

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E  +A + +  G +GL+      Y++++A++R   +G+ P+F  T+NP  +M ++ D++
Sbjct: 261 CETQFAQDLLSGGVMGLSVQDMRGYLEYVADQRLQMLGMTPVFG-TKNPLHFM-DLQDVQ 318

Query: 331 KEKNFFETRVTEYQ 344
           +  NFFE RV+ YQ
Sbjct: 319 ELTNFFERRVSSYQ 332


>gi|168702494|ref|ZP_02734771.1| ribonucleoside-diphosphate reductase, beta subunit [Gemmata
           obscuriglobus UQM 2246]
          Length = 332

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 171/316 (54%), Gaps = 8/316 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E Y  A  N W   EV    DLA  + +  +T  ER +I R + FFA+ +
Sbjct: 11  LRPMRYPPFFEMYKDAIKNTWTVDEVDFSTDLADLRGR--VTPAERHLIHRLVAFFATGD 68

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV- 152
           S+V NN+VL +Y+H++ PE R YL RQ +EEA+H   +  ++ +   D       +  V 
Sbjct: 69  SIVGNNLVLNLYKHVNAPEARMYLSRQLYEEALHVQFYLTLLDNYLPDMAAREAAFAAVD 128

Query: 153 --PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             PSI  KA++  ++  ++        T+   + FL +L  F    EG++F+  FA +  
Sbjct: 129 NIPSIKLKADFCFKWIDSIEGLD-RLETRAHRRAFLLNLVCFAACIEGLFFFAAFAYVYF 187

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES H+ F   VI+ ++ E P L+  E + +   ML EA  
Sbjct: 188 LRSKGLLHGLATGTNWVFRDESAHMAFAFRVIDTVRREEPDLFDAELEAQIVAMLREAVE 247

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E A+A + + +G  GL+      Y++++A+RR   +G+ P+F   +NPF +M ++ D++
Sbjct: 248 CETAFARDVLGQGVAGLSLADLRSYLEYVADRRLESLGIAPVFG-AKNPFGFM-DLQDVQ 305

Query: 331 KEKNFFETRVTEYQQG 346
           +  NFFE RV+ YQ G
Sbjct: 306 ELTNFFERRVSAYQLG 321


>gi|239929012|ref|ZP_04685965.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           ghanaensis ATCC 14672]
          Length = 339

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 19  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPAEQHLIGRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 76  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +   +  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 133 AVENIPSIREKAEFCFTWMDSVEKLDRLQTQADR-RRFLLNLICFAACIEGLFFYGAFAY 191

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+ +   Q+   ML E
Sbjct: 192 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDERLGQQVTDMLRE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+ 
Sbjct: 252 AVEAELQFARDLCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQ 309

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 310 GVQELTNFFERRPSAYQVAVE 330


>gi|254388985|ref|ZP_05004216.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           clavuligerus ATCC 27064]
 gi|294814921|ref|ZP_06773564.1| Ribonucleoside-diphosphate reductase beta chain protein
           [Streptomyces clavuligerus ATCC 27064]
 gi|326443293|ref|ZP_08218027.1| Ribonucleoside-diphosphate reductase [Streptomyces clavuligerus
           ATCC 27064]
 gi|197702703|gb|EDY48515.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           clavuligerus ATCC 27064]
 gi|218078699|emb|CAB90708.3| class Ia ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces clavuligerus ATCC 27064]
 gi|294327520|gb|EFG09163.1| Ribonucleoside-diphosphate reductase beta chain protein
           [Streptomyces clavuligerus ATCC 27064]
          Length = 339

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 173/325 (53%), Gaps = 15/325 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+        L+  E+ +I R + FFA+ +
Sbjct: 19  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDV---PDLAKLSPGEQHLIGRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 76  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRNAAFA 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA 
Sbjct: 133 AVENIPSIREKAQFCFRWMDSVEKLD-QLETQADRRRFLLNLICFAACIEGLFFYGAFAY 191

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML E
Sbjct: 192 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ ++ +    G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 252 AVEAELQFSRDLCGDGLPGMNTESMREYLQCVADQRLARLGFAPVYG-SENPFSFM-ELQ 309

Query: 328 DLKKEKNFFETRVTEYQQGAELKWD 352
            +++  NFFE R + YQ   E   D
Sbjct: 310 GVQELTNFFERRPSAYQVAVEGSVD 334


>gi|291437353|ref|ZP_06576743.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           ghanaensis ATCC 14672]
 gi|291340248|gb|EFE67204.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           ghanaensis ATCC 14672]
          Length = 340

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ +I R + FFA+ +
Sbjct: 20  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPAEQHLIGRLVAFFATGD 76

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 77  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 133

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +   +  ++          D  + FL +L  F    EG++FY  FA 
Sbjct: 134 AVENIPSIREKAEFCFTWMDSVEKLDRLQTQADR-RRFLLNLICFAACIEGLFFYGAFAY 192

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+ +   Q+   ML E
Sbjct: 193 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDERLGQQVTDMLRE 252

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+ 
Sbjct: 253 AVEAELQFARDLCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQ 310

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 311 GVQELTNFFERRPSAYQVAVE 331


>gi|290957506|ref|YP_003488688.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           scabiei 87.22]
 gi|260647032|emb|CBG70131.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           scabiei 87.22]
          Length = 355

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 174/322 (54%), Gaps = 9/322 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L++ E+ MI R + FFA+ +
Sbjct: 35  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSEGEQHMIGRLVAFFATGD 91

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   D  +    F    
Sbjct: 92  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDPADRVAAFAAVE 151

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA +  ++  ++          D  + FL +L  F    EG++FY  FA +  
Sbjct: 152 NIPSIREKAEFCFKWMDSVEKLDRLESQADR-RRFLLNLICFAACIEGLFFYGAFAYVYW 210

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDE++H++F  +V++ ++ E P L+ +  +Q+   ML EA  
Sbjct: 211 FRSRGLLHGLATGTNWVFRDETMHMSFAFEVVDTVRKEEPELFDELLRQQVTDMLKEAVE 270

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +  +    G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+  ++
Sbjct: 271 AELQFGRDLCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQ 328

Query: 331 KEKNFFETRVTEYQQGAELKWD 352
           +  NFFE R + YQ   E   D
Sbjct: 329 ELTNFFERRPSAYQVAVEGTVD 350


>gi|318060206|ref|ZP_07978929.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. SA3_actG]
 gi|318077113|ref|ZP_07984445.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. SA3_actF]
 gi|333024515|ref|ZP_08452579.1| putative ribonucleoside-diphosphate reductase beta chain
           [Streptomyces sp. Tu6071]
 gi|332744367|gb|EGJ74808.1| putative ribonucleoside-diphosphate reductase beta chain
           [Streptomyces sp. Tu6071]
          Length = 345

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D++       LT  E+ +I R + FFA+ +
Sbjct: 25  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVS---DLAKLTPGEQHLIGRLVAFFATGD 81

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 82  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 138

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI AKA +  ++   +          D  + FL +L  F    EG++FY  FA 
Sbjct: 139 AVENIPSIRAKAEFCFKWIDEVEKIDRLESRSDR-RRFLLNLICFAACIEGLFFYGAFAY 197

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + + + + ML  
Sbjct: 198 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLEAEVKEMLAG 257

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+ 
Sbjct: 258 AVDAELQFARDLCGDGLPGMNTESMREYLQCVADQRLVRLGFSPVYG-SSNPFSFM-ELQ 315

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 316 GVQELTNFFERRPSAYQVAVE 336


>gi|302521843|ref|ZP_07274185.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB78]
 gi|302430738|gb|EFL02554.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB78]
          Length = 345

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 171/321 (53%), Gaps = 15/321 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D++       LT  E+ +I R + FFA+ +
Sbjct: 25  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVS---DLAKLTPGEQHLIGRLVAFFATGD 81

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 82  SIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPDDRAAAFA 138

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI AKA +  ++   +          D  + FL +L  F    EG++FY  FA 
Sbjct: 139 AVENIPSIRAKAEFCFKWIDEVEKIDRLESQSDR-RRFLLNLICFAACIEGLFFYGAFAY 197

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H++F  DV++ ++ E P L+  + + + + ML  
Sbjct: 198 VYWFRSRGLLHGLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLEAEVKEMLAG 257

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +A +    G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+ 
Sbjct: 258 AVDAELQFARDLCGDGLPGMNTESMREYLQCVADQRLVRLGFSPVYG-SSNPFSFM-ELQ 315

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            +++  NFFE R + YQ   E
Sbjct: 316 GVQELTNFFERRPSAYQVAVE 336


>gi|320107274|ref|YP_004182864.1| Ribonucleoside-diphosphate reductase [Terriglobus saanensis SP1PR4]
 gi|319925795|gb|ADV82870.1| Ribonucleoside-diphosphate reductase [Terriglobus saanensis SP1PR4]
          Length = 346

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/320 (32%), Positives = 173/320 (54%), Gaps = 14/320 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++ +     N W   EV  Q DL   K +  LT  E   I+R + FFA+ +
Sbjct: 25  LRPMRYPQFYDMFRDGIKNTWTVEEVDFQTDLVDLKQR--LTPAEIHTIQRLVAFFATGD 82

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGE----LFN 147
           S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L   + E E     F 
Sbjct: 83  SIVSNNLVLNLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDNYIPEPEERNAAFA 139

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI+ KA++ +++  ++        TK+  ++FL +L  F    EG++F+  FA 
Sbjct: 140 AVENIPSISKKADFCMKWMDSIQQLD-QLETKEHRRQFLLNLICFAACIEGLFFFAAFAY 198

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDES HL F  +V+  ++ + P LW  E +++   M+ E
Sbjct: 199 VYFFRSKGLLHGLASGTNWVFRDESAHLEFAFEVVQVVRAQEPDLWDTELERQVVVMMEE 258

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E  +A + +  G  GL+     QY+ ++A+ R  ++G+   F   +NPF +M E+ 
Sbjct: 259 AIDAEAQFAEDLLSGGVAGLSVRDMRQYLGYVADSRLERLGIGAHFN-AKNPFSFM-ELQ 316

Query: 328 DLKKEKNFFETRVTEYQQGA 347
           D+++  NFFE RV+ YQ   
Sbjct: 317 DVQELTNFFERRVSAYQTAV 336


>gi|149916691|ref|ZP_01905193.1| putative ribonucleoside-diphosphate reductase beta chain
           [Plesiocystis pacifica SIR-1]
 gi|149822408|gb|EDM81797.1| putative ribonucleoside-diphosphate reductase beta chain
           [Plesiocystis pacifica SIR-1]
          Length = 356

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 105/322 (32%), Positives = 167/322 (51%), Gaps = 8/322 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y   + +Y  A  N W   EV    DL     + G    ER +I+R + FFA+ +
Sbjct: 35  LRPMAYPDFYAQYRQAIRNTWTVEEVDFSTDLRDLAERMGPA--ERHLIQRLVAFFATGD 92

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+VANN+VL++YRHL+ PE R YL RQ +EEA+H   +  ++ +   D  +    F    
Sbjct: 93  SIVANNLVLSLYRHLNAPEARMYLSRQLYEEALHVQFYLTLLDTYVPDPDQRHAAFAAVE 152

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +PSI  KA + L++  T+++     G     Q FL +L  F    EG++FY  FA +  
Sbjct: 153 TIPSIRRKAEFCLRWQDTVAAIPRLDGPAHRRQ-FLLNLICFAACTEGLFFYGAFAYVYF 211

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L     + G+A    ++ RDES H+ F   VI+ ++ + P L+  E +     M+ EA  
Sbjct: 212 LRSRGLLHGLAAGTNWVFRDESAHMAFAFSVIDVVRDQEPELFDAELEAAVVEMIEEAVA 271

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+A+A + +  G  GL       Y+++ A++R  ++G+   +  T NP  +M E+ D+ 
Sbjct: 272 CEVAFAEDLLGLGVAGLTVADLRAYLEYCADQRLQRLGMATRYGST-NPLSFM-ELQDIP 329

Query: 331 KEKNFFETRVTEYQQGAELKWD 352
           +  NFFE RV+ YQ G     D
Sbjct: 330 ELANFFERRVSAYQHGVSGTID 351


>gi|291303011|ref|YP_003514289.1| Ribonucleoside-diphosphate reductase [Stackebrandtia nassauensis
           DSM 44728]
 gi|290572231|gb|ADD45196.1| Ribonucleoside-diphosphate reductase [Stackebrandtia nassauensis
           DSM 44728]
          Length = 338

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 105/328 (32%), Positives = 178/328 (54%), Gaps = 16/328 (4%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
           R+L+   D+  L P++Y   +E++ +A  N W   EV +  DL    +    TD ER +I
Sbjct: 8   RLLDPGMDLT-LRPMRYPDFYEQFRAAIRNTWTVEEVDLASDLPDLAT---FTDSERHLI 63

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL-- 140
            R + FFA+ +++VANN+VL +Y+H++ PE R YL RQ +EEAVH    Q+ +T L    
Sbjct: 64  NRLVAFFATGDTIVANNLVLNLYKHVNAPEARLYLSRQLYEEAVH---VQFYLTLLDTYL 120

Query: 141 ----DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
               D  + F     +PSI  KA +  ++  T+        T +  + FL +L  F    
Sbjct: 121 PDPEDRVKAFAAVEHIPSIKEKAEFCFKWIDTIDQLD-ELRTPEDRRAFLLNLICFAACI 179

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY  FA +  L     + G+A    ++ RDES H+NF   V++ ++ E P L+  E
Sbjct: 180 EGLFFYGAFAYVYWLRSRGLLDGLATGTNWVFRDESCHMNFAFSVVDVVRNEEPELFDDE 239

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    M+ EA   E+ +A +   +G  G+     + Y++++A++R  ++G+ P+   +
Sbjct: 240 LTEAVTRMIEEAVAAELQFARDLCGEGMPGMTVNDMKSYLEYVADQRLTRLGM-PVRYGS 298

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQ 344
           +NPF +M+ + D+++  NFFE R T YQ
Sbjct: 299 KNPFGFMA-LQDVQELTNFFERRPTAYQ 325


>gi|162452149|ref|YP_001614516.1| ribonucleotide-diphosphate reductase [Sorangium cellulosum 'So ce
           56']
 gi|161162731|emb|CAN94036.1| Ribonucleotide-diphosphate reductase [Sorangium cellulosum 'So ce
           56']
          Length = 339

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/319 (32%), Positives = 170/319 (53%), Gaps = 15/319 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ Y   +E Y SA  N W   EV    D+   +    +TD ER +++R + FFA+ +
Sbjct: 19  LRPMAYPAFFEMYRSAIKNTWTVEEVDFSTDVGDLRK---MTDAERHLVQRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +YRH++ PE R YL RQ +EEA+H    Q+ +T L        D    F 
Sbjct: 76  SIVANNLVLNLYRHINAPEARMYLSRQLYEEALH---VQFYLTLLDTYIPDPEDRHRAFA 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA++ +++  ++ S      T+   + FL +L  F    EG++F+  FA 
Sbjct: 133 AVENIPSIRQKADFCMRWLDSVESLG-RLDTRAERRRFLLNLICFAACVEGLFFFGAFAY 191

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +  L     + G+A    ++ RDES H+ F  +V++  + E P L+     +    M+ E
Sbjct: 192 VYFLRSRGLLHGLAAGTSWVFRDESAHMRFAFEVVSTARREEPELFDAGLARSILDMMDE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E  +A + +  G  G++A    +Y++F A++R   +G+ P     +NPF +M ++ 
Sbjct: 252 AIACEARFAEDLLGAGVAGMSARDVRRYLEFCADQRLATLGM-PKRYGAKNPFSFM-DLQ 309

Query: 328 DLKKEKNFFETRVTEYQQG 346
           D+++  NFFE RV+ YQ G
Sbjct: 310 DVQEVTNFFERRVSAYQVG 328


>gi|11544904|emb|CAC17630.1| class I ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces jumonjinensis]
          Length = 322

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 167/312 (53%), Gaps = 15/312 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+        LT  E+ +I R + FFA+ +
Sbjct: 19  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVT---DLAKLTPGEQHLIGRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL------DEGELFN 147
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH    Q+ +T L        D    F 
Sbjct: 76  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVH---VQFYLTLLDTYLPDPEDRTAAFA 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA 
Sbjct: 133 AVENIPSIREKAQFCFKWMDSVEKID-QLETQADRRRFLLNLICFAACIEGLFFYGAFAY 191

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +        + G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML E
Sbjct: 192 VYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLQE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A   E+ +  +    G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+ 
Sbjct: 252 AVEAELQFGSDLCGDGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SENPFSFM-ELQ 309

Query: 328 DLKKEKNFFETR 339
            +++  NFFE R
Sbjct: 310 GVQELTNFFERR 321


>gi|190572323|ref|YP_001970168.1| putative ribonucleotide diphosphate reductase, small chain
           [Stenotrophomonas maltophilia K279a]
 gi|190010245|emb|CAQ43853.1| putative ribonucleotide diphosphate reductase, small chain
           [Stenotrophomonas maltophilia K279a]
          Length = 339

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 98/318 (30%), Positives = 174/318 (54%), Gaps = 8/318 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++ Y +A  N W   E+  Q D+    SK  ++  ER +I R + FFA+ +
Sbjct: 18  LRPMRYPQFYDMYRNAIKNTWTVEEINFQIDITDLHSK--MSPGERHLIHRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+V+NN+VL +Y+HL+ PE R YL RQ +EEA+H   +  ++ +   D  E    F+   
Sbjct: 76  SIVSNNLVLNLYQHLNAPEARMYLSRQLYEEALHVQFYLTLLDNYLPDPEERAKAFSAVE 135

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            + SI  KA++  ++  ++ S +    T++  ++FL +   F    EG++F+  FA +  
Sbjct: 136 NIDSIKKKADFCFKWIDSIQSLT-RIETREQRRQFLLNQICFAACIEGLFFFAAFAYVYY 194

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDES H+ F  + +  ++ E P L+ +E +Q+   ML EA  
Sbjct: 195 FRSRGLLPGLASGTNWVFRDESAHMEFAFESVRVVREEEPDLFDEEMKQQVYDMLAEAIE 254

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +A + +  G  G++     QY+Q  A++   ++G+E  +    NP P+M E+ D++
Sbjct: 255 CEVQFAEDVLSGGVAGISTRDMRQYLQHCADQHFAKLGMEKKYN-VRNPLPFM-ELQDVQ 312

Query: 331 KEKNFFETRVTEYQQGAE 348
           +  NFFE RV+ YQ G +
Sbjct: 313 ELTNFFERRVSAYQVGVQ 330


>gi|11544907|emb|CAC17632.1| class I ribonucleotide-diphosphate reductase small chain
           [Streptomyces microflavus]
          Length = 321

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 169/309 (54%), Gaps = 9/309 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   +E+Y  A  N W   EV +  D+A       L+  E+ MI R + FFA+ +
Sbjct: 18  LRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVA---DLAKLSPGEQHMIGRLVAFFATGD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV- 152
           S+VANN+VL +Y+H+++PE R YL RQ FEEAVH   +  ++ +   D  E    +  V 
Sbjct: 75  SIVANNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDPAERAAAFAAVE 134

Query: 153 --PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             PSI  KA +  ++  ++        T+   + FL +L  F    EG++FY  FA +  
Sbjct: 135 NIPSIRDKAQFCFKWMDSVEKID-QLETRADRRRFLLNLICFAACIEGLFFYGAFAYVYW 193

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDE++H+NF  +V++ ++ E P L+    Q++   ML EA  
Sbjct: 194 FRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQEQVTAMLKEAVE 253

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +  +   +G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+  ++
Sbjct: 254 AELQFGRDLCGEGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SENPFAFM-ELQGVQ 311

Query: 331 KEKNFFETR 339
           +  NFFE R
Sbjct: 312 ELTNFFERR 320


>gi|194363985|ref|YP_002026595.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia
           R551-3]
 gi|194346789|gb|ACF49912.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia
           R551-3]
          Length = 339

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 171/318 (53%), Gaps = 8/318 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++ Y +A  N W   E+  Q D++   SK  ++  ER +I R + FFA+ +
Sbjct: 18  LRPMRYPQFYDMYRNAIKNTWTVEEINFQIDISDLHSK--MSPGERHLIHRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+V+NN+VL +Y+HL+ PE R YL RQ +EEA+H   +  ++ +   D  E    F    
Sbjct: 76  SIVSNNLVLNLYQHLNAPEARMYLSRQLYEEALHVQFYLTLLDNYLPDPDERVKAFAAVE 135

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            + SI  KA++  ++  ++ +      T++  ++FL +   F    EG++F+  FA +  
Sbjct: 136 NIDSIKKKADFCFKWIDSIQNLK-RIETREERRQFLLNQICFAACIEGLFFFAAFAYVYY 194

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDES H++F  + ++ I+ E P L+  + +Q    ML EA  
Sbjct: 195 FRSRGLLNGLASGTNWVFRDESAHMDFAFECVDVIREEEPDLFDDKMKQDVYDMLAEAIE 254

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +A + +  G  G++     QY+Q  A+   H++G+E  +    NP  +M E+ D++
Sbjct: 255 CEVQFAEDVLSGGVAGISTRDMRQYLQHCADNHFHRLGMERKYN-VRNPLSFM-ELQDVQ 312

Query: 331 KEKNFFETRVTEYQQGAE 348
           +  NFFE R + YQ G +
Sbjct: 313 ELTNFFERRASAYQVGVQ 330


>gi|254521240|ref|ZP_05133295.1| ribonucleoside-diphosphate reductase, beta subunit
           [Stenotrophomonas sp. SKA14]
 gi|219718831|gb|EED37356.1| ribonucleoside-diphosphate reductase, beta subunit
           [Stenotrophomonas sp. SKA14]
          Length = 339

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/318 (30%), Positives = 169/318 (53%), Gaps = 8/318 (2%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   ++ Y +A  N W   E+  Q D+    SK  ++  ER +I R + FFA+ +
Sbjct: 18  LRPMRYPQFYDMYRNAIKNTWTVEEINFQIDITDLHSK--MSPGERHLIHRLVAFFATGD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
           S+V+NN+VL +Y+HL+ PE R YL RQ +EEA+H   +  ++ +   D  E    F    
Sbjct: 76  SIVSNNLVLNLYQHLNAPEARMYLSRQLYEEALHVQFYLTLLDNYLPDPEERVKAFAAVE 135

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            + SI  KA++  ++  ++        T+   ++FL +   F    EG++F+  FA +  
Sbjct: 136 NIDSIKKKADFCFKWIDSIQDLK-RIETRAERRQFLLNQICFAACIEGLFFFAAFAYVYY 194

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
                 + G+A    ++ RDES H+ F  + +  ++ E P L+  E +Q+   ML EA  
Sbjct: 195 FRSRGLLPGLASGTNWVFRDESAHMEFAFESVRVVREEEPDLFDDEMKQQVYDMLAEAIE 254

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
            E+ +A + +  G  G++     QY+Q  A++   ++G+E  +    NP P+M E+ D++
Sbjct: 255 CEVQFAEDVLSGGVAGISTRDMRQYLQHCADQHFAKLGMEKKYN-VRNPLPFM-ELQDVQ 312

Query: 331 KEKNFFETRVTEYQQGAE 348
           +  NFFE RV+ YQ G +
Sbjct: 313 ELTNFFERRVSAYQVGVQ 330


>gi|253827828|ref|ZP_04870713.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           canadensis MIT 98-5491]
 gi|313142391|ref|ZP_07804584.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
 gi|253511234|gb|EES89893.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           canadensis MIT 98-5491]
 gi|313131422|gb|EFR49039.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
          Length = 341

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 184/332 (55%), Gaps = 13/332 (3%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+++R+     + + +L  +KY WA+  +     N W P EV M  D   +   +GLT 
Sbjct: 15  SVNERRIFGGNPTSIFELNKIKYQWAYNLWKVMLANSWFPEEVNMTQDKRDYA--DGLTP 72

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E++   R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++  ++ 
Sbjct: 73  EEKIGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYAVMVE 132

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           S+  +  E+++M+R    + AK ++  +  + L+       T   ++  ++ +F   ++ 
Sbjct: 133 SISANTDEIYDMWRSDMQLKAKNDYIAEVYEQLA-------TNPIERNIIKAMFANQIL- 184

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY+GFA   +L R+ KM+G A+  ++I RDE  HL    ++IN +K E+P L+TK+
Sbjct: 185 EGIYFYSGFAFFYTLARSGKMLGSAQMIRFIQRDEVTHLILFQNMINSVKKESPELFTKD 244

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            +++   M  EA  +E A+         +GL +   ++Y++++A+ R  +IGL  L+   
Sbjct: 245 LEEEVIEMFREAVKVETAWGEYITQGQILGLTSEIIQEYIKYLADERLRRIGLPTLYN-A 303

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           ++P  W+       ++K NFFE  VT Y +G+
Sbjct: 304 KHPIKWVDSFSSFNEQKTNFFEGNVTNYAKGS 335


>gi|224418874|ref|ZP_03656880.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
          Length = 340

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 184/332 (55%), Gaps = 13/332 (3%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+++R+     + + +L  +KY WA+  +     N W P EV M  D   +   +GLT 
Sbjct: 14  SVNERRIFGGNPTSIFELNKIKYQWAYNLWKVMLANSWFPEEVNMTQDKRDYA--DGLTP 71

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E++   R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++  ++ 
Sbjct: 72  EEKIGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYAVMVE 131

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           S+  +  E+++M+R    + AK ++  +  + L+       T   ++  ++ +F   ++ 
Sbjct: 132 SISANTDEIYDMWRSDMQLKAKNDYIAEVYEQLA-------TNPIERNIIKAMFANQIL- 183

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY+GFA   +L R+ KM+G A+  ++I RDE  HL    ++IN +K E+P L+TK+
Sbjct: 184 EGIYFYSGFAFFYTLARSGKMLGSAQMIRFIQRDEVTHLILFQNMINSVKKESPELFTKD 243

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            +++   M  EA  +E A+         +GL +   ++Y++++A+ R  +IGL  L+   
Sbjct: 244 LEEEVIEMFREAVKVETAWGEYITQGQILGLTSEIIQEYIKYLADERLRRIGLPTLYN-A 302

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           ++P  W+       ++K NFFE  VT Y +G+
Sbjct: 303 KHPIKWVDSFSSFNEQKTNFFEGNVTNYAKGS 334


>gi|254456975|ref|ZP_05070403.1| ribonucleoside-diphosphate reductase, beta subunit
           [Campylobacterales bacterium GD 1]
 gi|207085767|gb|EDZ63051.1| ribonucleoside-diphosphate reductase, beta subunit
           [Campylobacterales bacterium GD 1]
          Length = 340

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 98/336 (29%), Positives = 180/336 (53%), Gaps = 14/336 (4%)

Query: 14  EKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           + + NV+D+++     + + +L  +KY WA+  +    NN W P EV M  D+  +K+  
Sbjct: 10  DSKENVNDRKVFGGDPTGIFELNNIKYQWAYNLWEVMLNNTWFPKEVDMTRDVNDYKN-- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT++E+    + L      +SL  NN++  +  ++++PE    L+RQ+FEEA+HS ++ 
Sbjct: 68  -LTENEKTAYDKALSQLIFMDSLQTNNLIDNVNPYVTSPEINLILVRQSFEEALHSQSYA 126

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            ++ S+  +  E+++++R    +  K +   +  Q L++          +  F++  F  
Sbjct: 127 VMVDSISTNSAEIYDLWRRDMMLKGKNDAIARVYQELAANP-------TEHNFVKACFAN 179

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
            ++ EG++FY+GF  I +L R+ KM+G A+  ++I RDE  HL    ++IN ++ E P L
Sbjct: 180 QIL-EGIYFYSGFTYIYTLARSGKMLGSAQMIRFIQRDEVTHLVLFQNLINTLRKERPDL 238

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           +T + +++   M  EA  LE  +         +GL     EQY++F+A+ R   +G E L
Sbjct: 239 FTDKLKEEVIAMFKEAVQLESEWGKYITQGQILGLTNDIVEQYIKFLADERLTAVGFEKL 298

Query: 313 FKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           +  T NP  W+ +      +K NFFE  VT Y +G+
Sbjct: 299 YNVT-NPIKWVDDFAKFNDQKTNFFEGTVTNYSKGS 333


>gi|78776214|ref|YP_392529.1| ribonucleotide-diphosphate reductase subunit beta [Sulfurimonas
           denitrificans DSM 1251]
 gi|78496754|gb|ABB43294.1| Ribonucleoside-diphosphate reductase [Sulfurimonas denitrificans
           DSM 1251]
          Length = 340

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 180/337 (53%), Gaps = 16/337 (4%)

Query: 14  EKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           E   NV+D+R+     + + +L  +KY WA+  +    NN W P EV M  D++ +K   
Sbjct: 10  ESNENVNDRRIFGGNPTGIFELNDIKYQWAYNLWEMMLNNTWFPKEVDMTRDVSDYKQ-- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            +TD E+    + L      +SL  NNI+  I  ++++PE    L+RQA+EEA+HS ++ 
Sbjct: 68  -ITDVEKASYDKALAQLIFMDSLQTNNIMDNINPYVTSPEINLILVRQAYEEALHSQSYA 126

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLS-SPSFTTGTKDADQEFLQDLFV 191
            ++ ++  +  E++ ++R    +  K +   +  + LS +P+        +  F++  F 
Sbjct: 127 VMVDTISTNSKEIYELWRRDMMLKGKNDAIARVYEELSKNPT--------EHNFVKACFA 178

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
             ++ EG++FY+GFA I +L R+ KM+G A+  ++I RDE  HL    ++IN ++ E P 
Sbjct: 179 NQIL-EGIYFYSGFAYIYTLARSGKMLGSAQMIRFIQRDEVTHLVLFQNLINSLRKERPD 237

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           L+ ++ +++   M  EA  LE+A+         +GL     EQY+Q++A+ R   +G   
Sbjct: 238 LFNEKLKEEVIEMFKEAVALEVAWGKYITGGQILGLTDAIIEQYIQYLADDRLTSVGFAK 297

Query: 312 LFKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           L+  T NP  W+ +      +K NFFE  V  Y +G+
Sbjct: 298 LYNVT-NPIKWVDDFSKFNDQKTNFFEGTVANYSKGS 333


>gi|195953600|ref|YP_002121890.1| Ribonucleoside-diphosphate reductase [Hydrogenobaculum sp. Y04AAS1]
 gi|195933212|gb|ACG57912.1| Ribonucleoside-diphosphate reductase [Hydrogenobaculum sp. Y04AAS1]
          Length = 319

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 163/296 (55%), Gaps = 16/296 (5%)

Query: 46  YLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIY 105
           Y  A NN+W+P E  + +D   +  K  L D ER  +   +GFF+S+E  V  NI L I 
Sbjct: 37  YTKAKNNYWIPEEYDLANDKHEFYEK--LNDIERHYMLHTVGFFSSAEGWVGQNI-LEIS 93

Query: 106 RHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQY 165
           + + N E R +L  Q  EE  H  TF+YI+  L L   E++ M+  V  I  KA++ ++ 
Sbjct: 94  KRIRNTETRMFLGYQLMEEMKHIDTFRYIMDGLDLKPHEVYAMHENVKEIKRKADFEVKR 153

Query: 166 TQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQ 225
              L            ++  ++D+FV+Y + EG++F++GF   L+ GR   +  +A   +
Sbjct: 154 AMALCEEP-------TEENLIEDIFVYYAILEGLFFFSGFVTPLAFGRRGVLKNVAALVR 206

Query: 226 YIMRDESLHLNFGIDVINQ-IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 284
           +I++DE+ HL FGI ++N+ +K +N +    +++ K R ++ EA  +E  YA   MP+  
Sbjct: 207 WILKDETRHLAFGIYLLNELLKDKNKN----DYKDKFRVLMEEAVDIETEYARVAMPEKI 262

Query: 285 VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRV 340
           +GL+  +   Y++++A+RR   +G + ++   +NP  W++   DL    NFFE +V
Sbjct: 263 IGLSFETYTSYVKYLADRRMRSLGFDAIYG-QKNPMKWLTTQTDLPDLTNFFEAKV 317


>gi|152989800|ref|YP_001355522.1| ribonucleotide-diphosphate reductase subunit beta [Nitratiruptor
           sp. SB155-2]
 gi|151421661|dbj|BAF69165.1| ribonucleoside-diphosphate reductase, beta subunit [Nitratiruptor
           sp. SB155-2]
          Length = 341

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 170/317 (53%), Gaps = 15/317 (4%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           +L  +KY WA+  +     N W P EV M  D   +K    LTD E+L   + L      
Sbjct: 32  ELNKIKYQWAYNLWEMMLANTWFPKEVDMTQDARDYKL---LTDAEKLAYDKVLAQLIFM 88

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           +SL  NN++  +  +++ PE    L+RQAFEEA+HS ++  ++ S+  +  E++ ++RE 
Sbjct: 89  DSLQTNNLIDNVNPYITAPEINLILVRQAFEEALHSQSYAVMVDSISQNTDEIYELWRED 148

Query: 153 PSITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
             +  K ++ A  Y +  ++PS        D+  ++ +F   ++ EG++FY+GF  + +L
Sbjct: 149 LQLKQKNDYIAHVYEELAANPS--------DENIVKAMFANQIL-EGIYFYSGFTYMYTL 199

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            R+ KM+G A+  ++I RDE  HL    ++IN +K E P L+TKE       M   A  L
Sbjct: 200 ARSGKMLGSAQMIRFIQRDEVTHLLIFQNMINTVKKERPELFTKELIDDVYKMFEGAVDL 259

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E ++         +GL     EQY++++A+ R  ++GLEP++   E+P  W+ +      
Sbjct: 260 ETSWGKYITQGQILGLTDEIIEQYIKYLADDRLKRVGLEPMYN-VEHPIKWVDDFSKFND 318

Query: 332 EK-NFFETRVTEYQQGA 347
           +K NFFE  VT Y +G+
Sbjct: 319 QKTNFFEGNVTNYSKGS 335


>gi|152993970|ref|YP_001359691.1| ribonucleotide-diphosphate reductase subunit beta [Sulfurovum sp.
           NBC37-1]
 gi|151425831|dbj|BAF73334.1| ribonucleoside-diphosphate reductase, beta subunit [Sulfurovum sp.
           NBC37-1]
          Length = 339

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 168/317 (52%), Gaps = 15/317 (4%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           +L  +KY WA+  +    NN W P EV M  D+  +K    LTD E+    + L      
Sbjct: 30  ELNDIKYQWAYNLWEMMLNNTWFPKEVDMTRDVNDYKR---LTDAEKQAYDKVLAQLIFM 86

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           +SL  NNI+  +   ++ PE    L+RQAFEEA+HS ++  ++ S+  +  E++ ++R  
Sbjct: 87  DSLQTNNIIDNLNPFITAPEVNLILVRQAFEEALHSQSYAVMVDSISTNSEEIYELWRRD 146

Query: 153 PSITAKANWALQYTQTLS-SPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
             + +K +   +  + LS +P+        D+  ++ +F   ++ EG++FY+GF  + +L
Sbjct: 147 MKLKSKNDAIAKVYEELSENPT--------DENIVKAMFANQIL-EGIYFYSGFTYLYTL 197

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            R++KM+G A+  ++I RDE  HL    ++IN  K E P L+TKE       M  +A  L
Sbjct: 198 ARSDKMLGTAQMIRFIQRDEVTHLLLFQNMINATKRERPELFTKELIDDVYQMFRDAVKL 257

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +         +GL     EQY+Q++A++R H +GLE ++   E+P  W+        
Sbjct: 258 ECEWGTYITQGQILGLTNEIIEQYIQYLADKRLHAVGLEKIYN-VEHPIKWVDNFSQFND 316

Query: 332 EK-NFFETRVTEYQQGA 347
           +K NFFE  VT Y +G+
Sbjct: 317 QKTNFFEGNVTNYSKGS 333


>gi|115378653|ref|ZP_01465803.1| ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
 gi|115364319|gb|EAU63404.1| ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
          Length = 288

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 152/277 (54%), Gaps = 12/277 (4%)

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           +TD ER +I R + FFA+ +S+V NN+VL +Y+HL+ PE R YL RQ +EEA+H    Q+
Sbjct: 1   MTDAERHLIHRLVAFFATGDSIVGNNLVLNLYKHLNAPEARMYLSRQLYEEALH---VQF 57

Query: 134 IITSLGL------DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
            +T L        D  + F     +PSI  KA + L++  ++   +    T++  + FL 
Sbjct: 58  YLTLLDTYVPDPADRAKAFAAIDNIPSIQRKARFCLKWMDSIHDLA-QLKTREDRRRFLL 116

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +L  F    EG++F+  FA +  L     + G+A    ++ RDES H+ F  + I   + 
Sbjct: 117 NLICFAGCIEGLFFFAAFAYVYFLRSKGLLHGLAAGTNWVFRDESTHMAFAFEAIRVARQ 176

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           E P L+    Q     M+ EA   E  +A + +  G  GL+     QY++++A++R   +
Sbjct: 177 EEPDLFDARMQADVVAMMREAVECETLFAQDLLSGGVAGLSVQEMRQYLEYVADQRLTML 236

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 344
           GL P+F+  +N  P+M ++ D+++  NFFE RV+ YQ
Sbjct: 237 GLAPVFR-VKNSLPFM-DLQDVQELTNFFERRVSAYQ 271


>gi|307719930|ref|YP_003891070.1| Ribonucleoside-diphosphate reductase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978023|gb|ADN08058.1| Ribonucleoside-diphosphate reductase [Sulfurimonas autotrophica DSM
           16294]
          Length = 340

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 175/333 (52%), Gaps = 16/333 (4%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           NV+D+++     + + +L  +KY WA+  +    NN W P EV M  D+  +K    LTD
Sbjct: 14  NVNDRKVFGGNPTGIFELNNIKYQWAYNLWEMMLNNTWFPKEVDMTRDVNDYKQ---LTD 70

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+    + L      +SL  NN++  +  +++ PE    L+RQ+FEEA+HS ++  ++ 
Sbjct: 71  AEKTAYDKALSQLIFMDSLQTNNLIDNVNPYVTAPEINLILVRQSFEEALHSQSYAVMVD 130

Query: 137 SLGLDEGELFNMYREVPSITAKAN-WALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
           S+  +  E+++++R    +  K +  A  Y +   +P+        D  F++  F   ++
Sbjct: 131 SISTNSEEIYDLWRRDMMLKHKNDTIAAVYQELAKNPT--------DSNFVKACFANQIL 182

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY+GF  I +L R+ KM+G A+  ++I RDE  HL    ++IN ++ E P L+T 
Sbjct: 183 -EGIYFYSGFTYIYTLARSGKMLGSAQMIRFIQRDEVTHLVLFQNLINTLRKERPDLFTD 241

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           E +     M  EA  LE  +         +GL     EQY+Q++A+ R + +G + L+  
Sbjct: 242 ELRADVIEMFKEAVKLETEWGKYITQGQILGLTDEIVEQYIQYLADDRLNSVGFDKLYNV 301

Query: 316 TENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           + NP  W+ +      +K NFFE  VT Y +G+
Sbjct: 302 S-NPIKWVDDFAKFNDQKTNFFEGTVTNYSKGS 333


>gi|242309209|ref|ZP_04808364.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pullorum MIT 98-5489]
 gi|239524250|gb|EEQ64116.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pullorum MIT 98-5489]
          Length = 341

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/333 (28%), Positives = 183/333 (54%), Gaps = 15/333 (4%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+++++     + + +L  +KY WA+  +     N W P EV M  D   +   +GLT 
Sbjct: 15  SVNERKIFGGNPTSIFELNKIKYQWAYNLWKVMLANSWFPEEVNMTQDKRDYA--DGLTP 72

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E++   R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++  ++ 
Sbjct: 73  EEKIGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYAVMVE 132

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
           S+  +  E++ M+R    + +K ++  + Y Q  ++P+        ++  ++ +F   ++
Sbjct: 133 SISANTDEIYEMWRTDMQLRSKNDYIAEVYEQLATNPT--------ERNIIKAMFANQIL 184

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY+GF    +L R+ KM+G A+  ++I RDE  HL    ++IN  K E+P  +TK
Sbjct: 185 -EGIYFYSGFTFFYTLARSGKMLGSAQMIRFIQRDEVTHLLLFQNMINSTKKESPEFFTK 243

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           + +++   M  EA  +EIA+         +GL A   ++Y++++A+ R  ++GL P+   
Sbjct: 244 DLEEEVLEMFREAVKVEIAWGEYITQGQILGLTAEIIQEYIKYLADDRLRRVGL-PVLYN 302

Query: 316 TENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
            ++P  W+       ++K NFFE  VT Y +G+
Sbjct: 303 AKHPIKWVDSFSSFNEQKTNFFEGNVTNYAKGS 335


>gi|224438210|ref|ZP_03659145.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
 gi|313144656|ref|ZP_07806849.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
 gi|313129687|gb|EFR47304.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
          Length = 348

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/336 (28%), Positives = 178/336 (52%), Gaps = 13/336 (3%)

Query: 14  EKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           E + +V D+++     + +  L  +KY WA+  + +   N W P EV +  D   +   +
Sbjct: 18  ESKESVKDRKIFGGNPTSMFDLNKIKYQWAYNLWKTMLANTWFPEEVNLNGDKRDYA--D 75

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLT  E+    R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++ 
Sbjct: 76  GLTAQEKAGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYA 135

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            ++ S+  +  E++ M+R    + +K +        +++     G +  +Q  L+ LF  
Sbjct: 136 VMVESISANTDEIYEMWRVDMQLRSKND-------HIANVYIELGKQPTEQNLLKALFAN 188

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
            ++ EG++FY+GF+   +L R+ KM+G A+  ++I RDE  HL     +IN ++ E PHL
Sbjct: 189 QIL-EGIYFYSGFSYFYTLARSGKMLGSAQMIRFIQRDEVTHLLVFQQMINALRKEQPHL 247

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           +T   +++   M  +A  +E  +         +GL A    +Y+Q++A+ R   +GL  +
Sbjct: 248 FTPSLEEEVIAMFQKAVEIESVWGEYITQGQILGLTAEIIREYIQYLADMRLRAVGLREI 307

Query: 313 FKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           + +++NP  W+ +      +K NFFE +VT Y +G+
Sbjct: 308 Y-HSKNPIKWVEQFASFNDQKTNFFEAKVTNYSKGS 342


>gi|167957419|ref|ZP_02544493.1| ribonucleotide-diphosphate reductase subunit beta [candidate
           division TM7 single-cell isolate TM7c]
          Length = 277

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 141/262 (53%), Gaps = 3/262 (1%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
           QL P++Y WA+  Y  A  N W P EV +  DLA +K    LT+DE+  +K  + +   +
Sbjct: 19  QLKPVRYEWAYRLYNQAVANTWFPNEVQLVQDLADFKK---LTEDEKNALKTVISYLNPN 75

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREV 152
           E L+  ++   IY  ++  EC  YL +Q +EEA H  TF+YII +   +  E++      
Sbjct: 76  ELLINKSLAFGIYPCVNAAECHLYLSKQMWEEANHFMTFEYIIETFPFNREEIYAAGWGK 135

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            S+  KA +  +Y   +        T +  ++F+++L  + +V EG+WFY+GF   +S  
Sbjct: 136 KSLADKAAFQTKYVTRMMEERPDVTTTEGKKDFVRNLVAYNIVLEGIWFYSGFMVGMSFR 195

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R N +  +     ++ RDE+LHL FGI+++  I  ENP L   EF  + R ++ +A  LE
Sbjct: 196 RRNLLRNVGTLLDWVTRDENLHLEFGINLLLTILHENPDLQDPEFADEIRNLILQAVELE 255

Query: 273 IAYAHETMPKGFVGLNAPSCEQ 294
            AY  + +P G +GLNA    Q
Sbjct: 256 EAYNRDMLPNGILGLNADYVNQ 277


>gi|237752265|ref|ZP_04582745.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376507|gb|EEO26598.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 343

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 176/332 (53%), Gaps = 13/332 (3%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+++R+     + + +L  +KY WA+  +     N W P EV M  D   +   +GLT 
Sbjct: 17  SVNERRIFGGNPTSIFELNKIKYQWAYNLWKVMLANSWFPEEVNMTQDKRDYS--DGLTP 74

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E++   R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++  ++ 
Sbjct: 75  EEKIGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYAVMVE 134

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           S+  +  E++ M+R    + +K ++     + LS           +   L+ +F   ++ 
Sbjct: 135 SISANTDEIYEMWRTDIQLKSKNDYIANVYEELS-------VNPTESILLKAMFANQIL- 186

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY+GFA   +L R+ KM+G A+  ++I RDE  HL    ++IN ++ E PHL+TK+
Sbjct: 187 EGIYFYSGFAFFYTLARSGKMLGSAQMIRFIQRDEVTHLLLFQNMINSLRKEMPHLFTKD 246

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             ++   M  EA  +E  +         +GL +    +Y++++A+ R  ++GL  L+   
Sbjct: 247 LIEEVLEMFREAVRVESTWGEYITQGQILGLTSEIIHEYIRYLADNRLTRVGLPALYN-A 305

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
            +P  W+       ++K NFFE  VT Y +G+
Sbjct: 306 RHPIKWVDSFSSFNEQKTNFFEGNVTNYAKGS 337


>gi|313683656|ref|YP_004061394.1| ribonucleotide reductase [Sulfuricurvum kujiense DSM 16994]
 gi|313156516|gb|ADR35194.1| ribonucleotide reductase [Sulfuricurvum kujiense DSM 16994]
          Length = 339

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 180/333 (54%), Gaps = 16/333 (4%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+D+++     + + +L  +KY WA+  +    NN W P EV M  D   +K    LT+
Sbjct: 14  HVNDRQIFGGNPTGIFELNNIKYQWAYNLWEMMLNNTWFPKEVDMTRDAVDYKY---LTE 70

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+    + L      +SL  NN++  +  +++ PE    L+RQ+FEEA+HS ++  ++ 
Sbjct: 71  MEKTAYDKALSQLIFMDSLQTNNLMDNVNPYVTAPEINLILVRQSFEEALHSQSYAVMVD 130

Query: 137 SLGLDEGELFNMYREVPSITAKAN-WALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
           S+  +  E+++++R+   +  K +  A +Y +  + PS        +  F++  F   ++
Sbjct: 131 SISQNSEEIYDLWRKDMMLKTKNDSIAARYDELANDPS--------ESAFVKACFANQIL 182

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY+GF  I +L R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T+
Sbjct: 183 -EGIYFYSGFTYIYTLARSGKMLGSAQMIRFIQRDEVTHLVLFQNIINTLRRERSDLFTE 241

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           E  ++   M  +A  LE A+         +GL     EQY+Q++A++R   +GL+PL+  
Sbjct: 242 ELIEEVYDMFRKAVELETAWGKYITQGQILGLTNEIVEQYIQYLADQRLTAVGLKPLYNV 301

Query: 316 TENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           + +P  W+ +      +K NFFE  VT Y +G+
Sbjct: 302 S-HPIKWVDDFSKFNDQKTNFFEGTVTNYSKGS 333


>gi|110802082|ref|YP_699620.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens SM101]
 gi|110682583|gb|ABG85953.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens SM101]
          Length = 344

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 105/339 (30%), Positives = 175/339 (51%), Gaps = 19/339 (5%)

Query: 17  VNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +  + K+M+N  + ++N    +KY W  E Y  A NN W+P E+ +  DL  +K    LT
Sbjct: 15  IETNKKKMINGNTTNLNDFNNMKYTWVSEWYRQAMNNFWIPEEINLAQDLKDYKK---LT 71

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +E+    + L F    +S+   N+   I  +++  E    L  QAF+EAVHS ++ Y++
Sbjct: 72  KEEKAAYDKILSFLIFLDSIQTANLG-NINSYITASEVNLCLTIQAFQEAVHSQSYSYML 130

Query: 136 TSLGLDE--GELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            S+   E   E+   +++   +  +  +    Y   L   S         + F++ +   
Sbjct: 131 DSICSPEERNEILFQWKDDAILLQRNKFIGDLYNNFLEDSSI--------ENFIKSVMAN 182

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           Y++ EG++FY+GF    +L R  KM G A++ +YI RDE+ HL     +I ++K E P +
Sbjct: 183 YIL-EGVYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRSIIKELKEEIPEV 241

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           +TKE +++ R M+      EIA+ H  +     G+N    E+Y+++I N R   IGLEPL
Sbjct: 242 FTKELKEELREMMRTGVEHEIAWGHYVIGDNVTGINKNLIERYIKYIGNLRAKAIGLEPL 301

Query: 313 FK-YTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
           F+ Y ENP PW+    D  + K +FFE + T Y +   L
Sbjct: 302 FEGYNENPAPWVDYYADANQVKTDFFEAKSTAYAKAGAL 340


>gi|18311342|ref|NP_563276.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens str. 13]
 gi|110801267|ref|YP_697050.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens ATCC 13124]
 gi|168205189|ref|ZP_02631194.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens E str. JGS1987]
 gi|168210336|ref|ZP_02635961.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens B str. ATCC 3626]
 gi|168213271|ref|ZP_02638896.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens CPE str. F4969]
 gi|168216675|ref|ZP_02642300.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens NCTC 8239]
 gi|169347055|ref|ZP_02865997.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens C str. JGS1495]
 gi|182625797|ref|ZP_02953564.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens D str. JGS1721]
 gi|18146026|dbj|BAB82066.1| ribonucleoside-diphosphate reductase beta subunit [Clostridium
           perfringens str. 13]
 gi|110675914|gb|ABG84901.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens ATCC 13124]
 gi|169296738|gb|EDS78867.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens C str. JGS1495]
 gi|170663363|gb|EDT16046.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens E str. JGS1987]
 gi|170711548|gb|EDT23730.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens B str. ATCC 3626]
 gi|170715235|gb|EDT27417.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens CPE str. F4969]
 gi|177908953|gb|EDT71440.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens D str. JGS1721]
 gi|182381151|gb|EDT78630.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens NCTC 8239]
          Length = 344

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/337 (31%), Positives = 172/337 (51%), Gaps = 15/337 (4%)

Query: 17  VNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +  + K+M+N  + ++N    +KY W  E Y  A NN W+P E+ +  DL  +K    LT
Sbjct: 15  IETNKKKMINGNTTNLNDFNNMKYTWVSEWYRQAMNNFWIPEEINLAQDLKDYKK---LT 71

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +E+    + L F    +S+   N+   I  +++  E    L  QAF+EAVHS ++ Y++
Sbjct: 72  KEEKTAYDKILSFLIFLDSIQTANLG-NINSYITASEVNLCLTIQAFQEAVHSQSYSYML 130

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE-FLQDLFVFYV 194
            S+   E       R       K +  L          +    +D+  E F++ +   Y+
Sbjct: 131 DSICSPEE------RNEILFQWKDDAILLQRNKFIGDLYNNFLEDSSMENFIKSVMANYI 184

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY+GF    +L R  KM G A++ +YI RDE+ HL     +I ++K E P ++T
Sbjct: 185 L-EGVYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRSIIKELKEEIPEVFT 243

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           KE +++ R M+      EIA+ H  +     G+N    E+Y+++I N R   IGLEPLF+
Sbjct: 244 KELKEELREMVRTGVEHEIAWGHYVIGDNVTGINKNLIERYIKYIGNLRVKAIGLEPLFE 303

Query: 315 -YTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
            Y ENP PW+    D  + K +FFE + T Y +   L
Sbjct: 304 GYNENPAPWVDYYADANQVKTDFFEAKSTAYAKAGAL 340


>gi|163753569|ref|ZP_02160692.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
 gi|161325783|gb|EDP97109.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
          Length = 326

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/329 (31%), Positives = 163/329 (49%), Gaps = 28/329 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P+K+   WE Y  +  + W   E+ +  DL  W +K  L DDER  IK
Sbjct: 8   ILQENKDRFVIFPIKHADIWEWYKKSEASFWTAEEIDLHQDLTDWTTK--LNDDERYFIK 65

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE 
Sbjct: 66  HILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEA 125

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF      P+I  KA+WALQ+   + SPSF            + L  F  V EG++
Sbjct: 126 EKDKLFKAIENFPAIKKKADWALQW---IESPSFA-----------ERLIAFAAV-EGIF 170

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE +H +F       + + N HL  K  +++
Sbjct: 171 FSGAFCSIYWLKKRGIMPGLTFSNELISRDEGVHCDFA------VHLHNNHLVNKVPKER 224

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++G E  +  + NPF
Sbjct: 225 IRAIIVDALNIEREFITESLPVSLIGMNAKLMTQYLEFVTDRLLQELGCEKEYNVS-NPF 283

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +M ++I L+ + NFFE RV+EYQ+   L
Sbjct: 284 DFM-DMISLQGKTNFFEKRVSEYQKAGVL 311


>gi|148259750|ref|YP_001233877.1| ribonucleotide-diphosphate reductase subunit beta [Acidiphilium
           cryptum JF-5]
 gi|146401431|gb|ABQ29958.1| Ribonucleoside-diphosphate reductase [Acidiphilium cryptum JF-5]
          Length = 338

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 163/327 (49%), Gaps = 33/327 (10%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E +L+    HW+P EVP+ DD+  W     LT  ER ++ +   FF  ++  
Sbjct: 31  PFRYPWAYEAWLTQQRVHWLPEEVPLADDVKDWH--RNLTPGERNLLTQIFRFFTQADVE 88

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E   F  Y+E
Sbjct: 89  V-NNCYMKHYSQVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEVEYSAFLKYKE 146

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y Q  S         D+  E  + L  F    EG+  +  FA +L+ 
Sbjct: 147 MKD-------KYDYMQEFSV--------DSKHEIAKTLAAFGAFTEGLQLFASFAILLNF 191

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLH 266
            R NKM G+ +   + +RDESLH N  I +      ENP +WT+E +++     +  + H
Sbjct: 192 PRFNKMKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYLCCATIVDH 251

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+    +     GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW+ E+
Sbjct: 252 EDAFIDLAFEFGAVE----GLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPWLDEM 307

Query: 327 IDLKKEKNFFETRVTEYQQGAEL-KWD 352
           ++  +  NFFE R TEY + +    WD
Sbjct: 308 LNAVEHTNFFENRATEYSKASTAGSWD 334


>gi|326403282|ref|YP_004283363.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
 gi|325050143|dbj|BAJ80481.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
          Length = 338

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 163/327 (49%), Gaps = 33/327 (10%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E +L+    HW+P EVP+ DD+  W     LT  ER ++ +   FF  ++  
Sbjct: 31  PFRYPWAYEAWLTQQRVHWLPEEVPLADDVKDWH--RNLTPGERNLLTQIFRFFTQADVE 88

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E   F  Y+E
Sbjct: 89  V-NNCYMKHYSQVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEVEYSAFLKYKE 146

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y Q  S         D+  E  + L  F    EG+  +  FA +L+ 
Sbjct: 147 MKD-------KYDYMQEFSV--------DSKHEIAKTLAAFGAFTEGLQLFASFAILLNF 191

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLH 266
            R NKM G+ +   + +RDESLH N  I +      ENP +WT+E +++     +  + H
Sbjct: 192 PRFNKMKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYLCCATIVDH 251

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+    +     GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW+ E+
Sbjct: 252 EDAFIDLAFEFGAVE----GLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPWLDEM 307

Query: 327 IDLKKEKNFFETRVTEYQQGAEL-KWD 352
           ++  +  NFFE R TEY + +    WD
Sbjct: 308 LNAVEHTNFFENRATEYSKASTAGSWD 334


>gi|32266105|ref|NP_860137.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           hepaticus ATCC 51449]
 gi|32262154|gb|AAP77203.1| ribonucleoside diphosphate reductase [Helicobacter hepaticus ATCC
           51449]
          Length = 349

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/337 (28%), Positives = 177/337 (52%), Gaps = 15/337 (4%)

Query: 14  EKRVNVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           E   +V D+++     + +  L  +KY WA+  +     N W P EV M  D   +    
Sbjct: 19  ESTESVADRKIFGGNPTSMFDLNKIKYQWAYNLWKVMLANTWFPEEVNMTPDKRDYNG-- 76

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLT  E+L   R L      +SL  NN++  +  ++++PE    L+RQA+EEA+HS ++ 
Sbjct: 77  GLTAQEKLGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAYEEALHSQSYA 136

Query: 133 YIITSLGLDEGELFNMYREVPSITAK-ANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
            ++ S+  +  E++NM+R    + +K  N A  Y +   +P+        +Q  L+ +F 
Sbjct: 137 VMVESISANTDEIYNMWRVDMQLRSKNDNIANVYIELAKNPN--------EQNLLKAMFA 188

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
             ++ EG++FY+GF+   +L R+ KM+G A+  ++I RDE  HL    ++I+ ++ E  H
Sbjct: 189 NQIL-EGIYFYSGFSYFYTLARSGKMLGSAQMIRFIQRDEVTHLLLFQNMISSLRKEQGH 247

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           L+T   +++   M  +A  +E  +         +GL +    +Y+Q++A+ R   +GL  
Sbjct: 248 LFTPSLEEEVVEMFKKAVEIESQWGEYITQGQILGLTSEIIREYIQYLADARLKAVGLPQ 307

Query: 312 LFKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           L+  ++NP  W+ +      +K NFFE +VT Y +G+
Sbjct: 308 LYG-SKNPIKWVDQFASFNDQKTNFFEAKVTNYSKGS 343


>gi|167947199|ref|ZP_02534273.1| Ribonucleotide reductase, beta subunit [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 241

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 116/197 (58%), Gaps = 2/197 (1%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K VN DDKR++N  +DVNQL P KY WAWE +L+A  NHW P ++ M  D+  +  K  L
Sbjct: 46  KPVNPDDKRVVNGLTDVNQLAPFKYPWAWEYFLNANKNHWTPLDINMAQDVHDYHHK--L 103

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T +ER + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +EEA+H+ T+Q+ 
Sbjct: 104 TLEERHIYENVLSYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVYEEALHTWTYQHC 163

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           I ++GLD+ E++N YR VP I  K   A +   ++         +D  + FL     F  
Sbjct: 164 IETIGLDQVEIYNRYRVVPEINGKIQIANRRLHSILRSDVDLSNRDELENFLMAYLFFAG 223

Query: 195 VFEGMWFYTGFAQILSL 211
           +FEG+WFY GF+ I +L
Sbjct: 224 IFEGVWFYNGFSPIFAL 240


>gi|156087150|ref|XP_001610982.1| ribonucleoside-diphosphate reductase small subunit [Babesia bovis
           T2Bo]
 gi|154798235|gb|EDO07414.1| ribonucleoside-diphosphate reductase small subunit, putative
           [Babesia bovis]
          Length = 339

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 98/321 (30%), Positives = 161/321 (50%), Gaps = 29/321 (9%)

Query: 32  NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           N L P+KY   WE Y  A  + W   E+ +  DL  W +   LT+ E   IK  L FFA+
Sbjct: 31  NGLYPIKYPDFWEWYKKAQASFWTSEEIDLSSDLKDWGT---LTEGEHHFIKNVLAFFAA 87

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYRE 151
           S+ +V  N+ L   + +  PE + +   Q   E +HS T+  +I     DE E   ++R 
Sbjct: 88  SDGIVLENLALRFLKDVKLPEAKFFYCFQITVENIHSETYSLLIEQYIRDEAEKDRLFRA 147

Query: 152 VPSITA---KANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQI 208
           + +I A   KA WA ++                D++   +  V Y   EG++F   F  I
Sbjct: 148 IETIDAVRDKAIWAAKWMN--------------DEKSFAERIVAYAAVEGIFFSGSFCAI 193

Query: 209 LSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEA 268
             L +   M G+    + I RDE LH +FG  + +++K + P        +  + ++ EA
Sbjct: 194 FWLKKRGLMPGLTFSNELIARDEGLHADFGCFIYSKLKHKLP-------AECVQQIIKEA 246

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E  +  +++P   +G+N+    QY++F+A+R    +G+ P++K T+NPF WM E+I 
Sbjct: 247 VAVERVFVCDSLPTDLIGMNSMLMAQYIEFVADRLLQALGVPPVYK-TKNPFEWM-ELIS 304

Query: 329 LKKEKNFFETRVTEYQQGAEL 349
           ++ + NFFE RV EYQ+   L
Sbjct: 305 VQGKTNFFEKRVGEYQKSGIL 325


>gi|161760549|ref|NP_906664.2| ribonucleotide-diphosphate reductase subunit beta [Wolinella
           succinogenes DSM 1740]
          Length = 341

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 176/332 (53%), Gaps = 15/332 (4%)

Query: 19  VDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           V+++++     + + +L  +KY WA+  +     N W P EV M  D   +    GLT  
Sbjct: 16  VNERKIFGGNPTSIFELNKIKYQWAYNLWKVMLANSWFPEEVNMTPDKRDYNG--GLTPA 73

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+L   R L      +SL  NN++  +  ++++PE    L+RQAFEEA+HS ++  ++ S
Sbjct: 74  EKLGYDRALSQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAFEEALHSQSYAVMVES 133

Query: 138 LGLDEGELFNMYREVPSITAKAN-WALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           +  +  E++ M+R    + +K +  A  Y +   +P+        D   L+ +F   ++ 
Sbjct: 134 ISANTDEIYEMWRVDMQLKSKNDHIAGVYEELAKNPT--------DSAMLKAMFANQIL- 184

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY GF+   +L R+ KM+G A+  ++I RDE  HL    ++IN +K E P L+TK 
Sbjct: 185 EGIYFYAGFSFFYTLARSGKMLGSAQMIRFIQRDEVTHLLIFQNMINALKKERPDLFTKS 244

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            +++   M  +A  +E A+         +GL +    +Y+Q++A+ R  ++G+ P+    
Sbjct: 245 LEEEVVEMFRKAVAVESAWGDYITQGQILGLTSEIIHEYIQYLADDRLKRVGM-PILYNA 303

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           ++P  W+ +     ++K NFFE  VT Y +G+
Sbjct: 304 KHPIKWVDQFSSFNEQKTNFFEGNVTNYAKGS 335


>gi|291276761|ref|YP_003516533.1| ribonucleoside-diphosphate reductase subunit beta [Helicobacter
           mustelae 12198]
 gi|290963955|emb|CBG39794.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           mustelae 12198]
          Length = 344

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 180/333 (54%), Gaps = 15/333 (4%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+D+++     + +  L  +KY WA++ + +   N W P EV M +D   +   N LT 
Sbjct: 19  SVNDRKIFGGNPTSMFDLNKIKYQWAYDLWKTMLANTWFPEEVSMNEDKRDYN--NLLTA 76

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+L   R L      +SL  NN++  +  ++++PE    L+RQA+EEA+HS ++  ++ 
Sbjct: 77  QEKLGYDRALAQLIFMDSLQTNNLIDNVNPYITSPEINLILVRQAYEEALHSQSYAVMVE 136

Query: 137 SLGLDEGELFNMYREVPSITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
           S+  +  E+++M+R    + +K ++ A  Y +   +P+        ++  ++ +F   ++
Sbjct: 137 SISANTDEIYDMWRVDMQLKSKNDYIANVYMKLAQNPT--------ERNIVKAMFANQIL 188

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY+GFA   +L    KM+G ++  ++I RDE  HL    ++I  +K E P L+ K
Sbjct: 189 -EGIYFYSGFAFFYALASTGKMLGSSQMIRFIQRDEVTHLILFQNMIRTLKKERPDLFDK 247

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           + +++   M   A  +E A+         +GL      QY+Q++A++R  ++G+  L+  
Sbjct: 248 DLEEEIVEMFRRAVEIEAAWGEYITQGQILGLTGEVIHQYIQYLADQRLSKVGMPKLYN- 306

Query: 316 TENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
            E+P  W+ +     +++ NFFE +VT Y +G+
Sbjct: 307 VEHPIKWVEQYASFNEQRTNFFEAKVTNYAKGS 339


>gi|296421312|ref|XP_002840209.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636423|emb|CAZ84400.1| unnamed protein product [Tuber melanosporum]
          Length = 397

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 155/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W+  E+ +  D+  W  +  L DDER  I   L FFA+S+
Sbjct: 79  LFPIKYHEIWQMYKKAEASFWVAEEIDLSKDMHDWSDR--LNDDERYFISHVLAFFAASD 136

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E VHS T+  +I +   D  +   LF+   
Sbjct: 137 GIVNENLVQRFSNEVQIPEARCFYGFQIMMENVHSETYSLLIDTYIKDPKQRTYLFDAID 196

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ +            D +  F Q L  F  V EG++F   FA I  
Sbjct: 197 TIPCIKKKADWAIRWIE------------DRNSTFAQRLVAFAAV-EGIFFSGSFASIFW 243

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G++   + I RDE LH +F   + N       HL  +  QQ  + ++ EA  
Sbjct: 244 LKKRGLMPGLSFSNELISRDEGLHTDFACLLFN-------HLNNRPSQQAVQDIIVEAVG 296

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G  P F    NPF +M E I L 
Sbjct: 297 IEQEFLTEALPCALLGMNSKLMKQYIEFVADRLLLSLG-NPKFYNATNPFDFM-ESISLA 354

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 355 GKTNFFEKRVGDYQKAG 371


>gi|9632043|ref|NP_048832.1| hypothetical protein PBCV1_A476R [Paramecium bursaria Chlorella
           virus 1]
 gi|1620147|gb|AAC96843.1| contains ribonucleotide reductase (RR) signature; similar to
           tobacco RR small subunit, corresponds to Swiss-Prot
           Accession Number P49730 [Paramecium bursaria Chlorella
           virus 1]
          Length = 324

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/319 (30%), Positives = 160/319 (50%), Gaps = 28/319 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P++Y   W+ Y  A    W   EVP+  D+  W+ K  L DDER  IK  LGFFA S+ 
Sbjct: 19  FPIQYPDMWDMYKKAVATFWTTEEVPLNADVVDWREK--LNDDERHFIKHILGFFAGSDG 76

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELFNMYRE 151
           +V  N+       ++ PE RQ+   Q F E++HS  +  +I +L  DE    ELF+    
Sbjct: 77  IVMENLQTNFSVEVTVPEARQFYAYQTFNESIHSEQYALLIDALISDEQERNELFDAIEN 136

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA ++ +   S                +  V +V  EG+ F   F  I  L
Sbjct: 137 IPAVHNKAKWAQKWLEPGKS--------------FAERLVAWVCVEGILFSGSFCAIFWL 182

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG  + ++++ + P        +  + ++ EA   
Sbjct: 183 RNKGVMPGLGLSNEFISRDEGLHQQFGELMYSKLQNKLPF-------ETVKQIITEAVEN 235

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  + +P   +G+NA    QY++F+A+R    +G E ++  ++NPF +M E+I L+ 
Sbjct: 236 EKEFICDAIPCRLIGMNAELMGQYIEFVADRIFVALGYEKVYN-SKNPFAFM-ELISLQG 293

Query: 332 EKNFFETRVTEYQQGAELK 350
           + NFFE RV++YQ+   +K
Sbjct: 294 KTNFFEKRVSDYQRPGVMK 312


>gi|156058956|ref|XP_001595401.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980]
 gi|154701277|gb|EDO01016.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 407

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 167/345 (48%), Gaps = 35/345 (10%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+ P +A E  +  +  R +        L P+KY   W+ Y  A  + W   E+ +  DL
Sbjct: 63  GIKPEEADEPLLQENPNRFV--------LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDL 114

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
             W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E 
Sbjct: 115 HDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMEN 172

Query: 126 VHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           +HS T+  +I +   ++ +   LFN    +P I  KA+WA+++ Q            D +
Sbjct: 173 IHSETYSLLIDTYIKEQAQKTYLFNAIDTIPCIKKKADWAVKWIQ------------DKN 220

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
             F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + 
Sbjct: 221 STFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMAGLTFSNELISRDEGLHTDFACLLF 279

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           +       HL  +  +Q  + ++ EA  +E  +  E +P   +G+N+   +QY++F+A+R
Sbjct: 280 S-------HLKHRPSKQAVQDVITEAVEIEQEFLTEALPCALLGMNSTLMKQYIEFVADR 332

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
               +G + ++K + NPF +M E I L  + NFFE RV +YQ+  
Sbjct: 333 LLVTLGNDKVYK-SANPFDFM-ENISLAGKTNFFEKRVGDYQKAG 375


>gi|171687074|ref|XP_001908478.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943498|emb|CAP69151.1| unnamed protein product [Podospora anserina S mat+]
          Length = 409

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 165/344 (47%), Gaps = 27/344 (7%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +  + A E +  + D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL 
Sbjct: 61  IKTVAAPEPKQELLDEPLLTENPQRFVLFPIKYHEVWQMYKKAEASFWTAEEIDLSKDLH 120

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W +K  L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +
Sbjct: 121 DWSNK--LNDDEKFFISHILAFFAASDGIVNENLVERFSAEVQIPEARCFYGFQIMMENI 178

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   +  +   LFN    +P I  KA+WAL++              D D 
Sbjct: 179 HSETYSLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWIS------------DKDA 226

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 227 SFAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFS 285

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
                  HL  +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F+A+R 
Sbjct: 286 -------HLNNRPSKQLVEDIIRDAVTIEQEFLTEALPCALLGMNSNLMKQYIEFVADRL 338

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +G + +++ T NPF +M E I L  + NFFE RV EYQ+  
Sbjct: 339 LVALGNDKIYRST-NPFDFM-ENISLGGKTNFFEKRVGEYQKAG 380


>gi|315452596|ref|YP_004072866.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter felis
           ATCC 49179]
 gi|315131648|emb|CBY82276.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter felis
           ATCC 49179]
          Length = 347

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 95/319 (29%), Positives = 167/319 (52%), Gaps = 16/319 (5%)

Query: 30  DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFF 89
           D+NQ+   KY WA + + +  +N W P EV M  D   +     L+  E++   R L   
Sbjct: 38  DLNQI---KYQWAHKIWKTMLHNTWFPEEVSMHGDKTHYLK---LSTQEKIGYDRALAQL 91

Query: 90  ASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMY 149
              +SL  NN++  I   +++PE    L+RQA+EEA+HSH++  ++ S+  +  E++ M+
Sbjct: 92  IFMDSLQTNNLIDNINPFITSPEINLCLVRQAYEEALHSHSYAVMVESISANSDEIYEMW 151

Query: 150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQIL 209
           R   ++  K +   Q    L+           ++  L+ L V   + EG++FY+GF+   
Sbjct: 152 RTDEALKNKNDCVAQVYMDLAHTQ-------TERNLLKAL-VANQILEGIYFYSGFSFFY 203

Query: 210 SLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEAT 269
           +L R+ KM+G A+  ++I RDE  HL     +I+ +K E P L++K+  ++   M  EA 
Sbjct: 204 ALARSGKMLGSAQMIRFIQRDEVTHLALFQSMIHTLKKERPDLFSKDLVEEILEMFKEAV 263

Query: 270 LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 329
            LE  +         + LN  +   Y++++A+ R H IGL P   +T++P  W+ +    
Sbjct: 264 DLESTWGRVITQGEILDLNPVTLRAYIEYLADTRLHAIGL-PKIYHTKHPMRWVDQFSSF 322

Query: 330 KKEK-NFFETRVTEYQQGA 347
             ++ NFFE RV+ Y +G+
Sbjct: 323 NSQRSNFFEARVSNYSKGS 341


>gi|258542157|ref|YP_003187590.1| ribonucleotide-diphosphate reductase subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633235|dbj|BAH99210.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636294|dbj|BAI02263.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639347|dbj|BAI05309.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642403|dbj|BAI08358.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645458|dbj|BAI11406.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648511|dbj|BAI14452.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651564|dbj|BAI17498.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654555|dbj|BAI20482.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 339

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/321 (30%), Positives = 162/321 (50%), Gaps = 32/321 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA++ +L+    HW+P EVP+ DD+  W     L + E+ ++ +   FF  S+  
Sbjct: 27  PFRYPWAYDAWLTQQRLHWLPEEVPLADDVKDWH--RVLNEGEQHLVTQIFRFFTQSDVE 84

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + Y++ +LG+ E E   F  Y+E
Sbjct: 85  V-NNCYMKHYSRVFKP-TEVLMMLSAFSNIETIHIAAYSYLLDTLGMPETEYSAFLKYKE 142

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y QT         T D+  E  + L  F    EG+  +  FA +L+ 
Sbjct: 143 MKD-------KYDYMQTF--------TVDSKHEIAKTLAAFGAFTEGLQLFASFAILLNF 187

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTML-H 266
            R NK+ G+ +   + +RDE+LH    I +      ENP LWT++ + +     RT++ H
Sbjct: 188 PRFNKLKGMGQIVSWSVRDETLHCLSIIRLFRVFIQENPELWTEQLRTELTDICRTIVEH 247

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+    +     GLNA   + Y+ FIA+RR  Q+GLEP++  T NP PW+ ++
Sbjct: 248 EEAFIDLAFEMGAVE----GLNAEQVKTYIHFIADRRLTQLGLEPIYNTTTNPLPWLDDM 303

Query: 327 IDLKKEKNFFETRVTEYQQGA 347
           ++  +  NFFE R TEY + +
Sbjct: 304 LNAVEHTNFFENRATEYSRAS 324


>gi|302904131|ref|XP_003049009.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729943|gb|EEU43296.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 389

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 157/319 (49%), Gaps = 27/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N LT DE+  I   L FFA+S+
Sbjct: 69  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLTSDEQFFISHILAFFAASD 126

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 127 GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEPSQRTYLFNAIE 186

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D D  F Q L  F  V EG++F   FA I  
Sbjct: 187 TIPCIRKKADWAIRWIQ------------DKDSSFAQRLVAFAAV-EGIFFSGAFASIFW 233

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F         + + HL  +  +Q  + ++ +A  
Sbjct: 234 LKKRGLMPGLTFSNELISRDEGLHTDFAC-------LLHSHLKGRASKQVIQDIITDAVT 286

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+NA   +QY++F+A+R    +G E ++K + NPF +M E I L 
Sbjct: 287 IEQEFLTEALPCALLGMNADLMKQYIEFVADRLLVALGNEKVYK-SANPFDFM-ENISLG 344

Query: 331 KEKNFFETRVTEYQQGAEL 349
            + NFFE RV +YQ+   L
Sbjct: 345 GKTNFFEKRVGDYQKAGVL 363


>gi|289620013|emb|CBI53457.1| unnamed protein product [Sordaria macrospora]
          Length = 410

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 166/344 (48%), Gaps = 35/344 (10%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           L P +A E  +  + +R +        L P+KY   W+ Y  A  + W   E+ +  DL 
Sbjct: 70  LKPEEAAEPLLTENPQRFV--------LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLH 121

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   N LTDDER  +   L FFA+S+ +V  N+V      +  PE R +   Q   E +
Sbjct: 122 DWN--NRLTDDERFFVSHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENI 179

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   +  +   LFN    +P I  KA+WAL++    SS            
Sbjct: 180 HSETYSLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWITDKSST----------- 228

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 229 -FAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFS 286

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
                  HL  +  +Q  + ++ +A  +E  +  E +P   +G+NA   +QY++F+A+R 
Sbjct: 287 -------HLNNRPSKQLIQDIIVDAVRIEQEFLTEALPCALLGMNADLMKQYIEFVADRL 339

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +G E +++ T NPF +M E I L  + NFFE RV +YQ+  
Sbjct: 340 LVALGNEKVYRST-NPFDFM-ENISLGGKTNFFEKRVADYQKAG 381


>gi|329113329|ref|ZP_08242110.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
 gi|326697154|gb|EGE48814.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
          Length = 339

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/321 (30%), Positives = 162/321 (50%), Gaps = 32/321 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA++ +L+    HW+P EVP+ DD+  W     L + E+ ++ +   FF  S+  
Sbjct: 27  PFRYPWAYDAWLTQQRLHWLPEEVPLADDVKDWH--RVLNEGEQHLVTQIFRFFTQSDVE 84

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + Y++ +LG+ E E   F  Y+E
Sbjct: 85  V-NNCYMKHYSRVFKP-TEVLMMLSAFSNIETIHIAAYSYLLDTLGMPETEYSAFLKYKE 142

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y QT         T D+  E  + L  F    EG+  +  FA +L+ 
Sbjct: 143 MKD-------KYDYMQTF--------TVDSKHEIAKTLAAFGAFTEGLQLFASFAILLNF 187

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTML-H 266
            R NK+ G+ +   + +RDE+LH    I +      ENP LWT++ + +     RT++ H
Sbjct: 188 PRFNKLKGMGQIVSWSVRDETLHCLSIIRLFRVFIQENPELWTEQLRTELTDICRTIVEH 247

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+    +     GLNA   + Y+ FIA+RR  Q+GLEP++  T NP PW+ ++
Sbjct: 248 EEAFIDLAFEMGAVE----GLNAEQVKTYIHFIADRRLTQLGLEPIYNTTTNPLPWLDDM 303

Query: 327 IDLKKEKNFFETRVTEYQQGA 347
           ++  +  NFFE R TEY + +
Sbjct: 304 LNAVEHTNFFENRSTEYSRAS 324


>gi|157953769|ref|YP_001498660.1| hypothetical protein AR158_C579R [Paramecium bursaria Chlorella
           virus AR158]
 gi|156068417|gb|ABU44124.1| hypothetical protein AR158_C579R [Paramecium bursaria Chlorella
           virus AR158]
          Length = 324

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/319 (30%), Positives = 160/319 (50%), Gaps = 28/319 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P++Y   W+ Y  A    W   EVP+  D+  W+ K  L DDER  IK  LGFFA S+ 
Sbjct: 19  FPIQYPDMWDMYKKAVATFWTTEEVPLNADVVDWREK--LNDDERHFIKHILGFFAGSDG 76

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELFNMYRE 151
           +V  N+       ++ PE RQ+   Q F E++HS  +  +I +L  DE    ELF+    
Sbjct: 77  IVMENLQTNFSVEVTVPEARQFYAYQTFNESIHSEQYALLIDALISDEQERNELFDAIEN 136

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA ++ +   S                +  V +V  EG+ F   F  I  L
Sbjct: 137 IPAVHNKAKWAQKWLEPGKS--------------FAERLVAWVCVEGILFSGSFCAIFWL 182

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG  + ++++ + P        +  + ++ EA   
Sbjct: 183 RNKGVMPGLGLSNEFISRDEGLHQQFGELMYSKLQNKLPF-------ETVKQIITEAVEN 235

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  + +P   +G+N+    QY++F+A+R    +G E ++  ++NPF +M E+I L+ 
Sbjct: 236 EKEFICDAIPCRLIGMNSELMGQYIEFVADRIFIALGYEKVYN-SKNPFAFM-ELISLQG 293

Query: 332 EKNFFETRVTEYQQGAELK 350
           + NFFE RV++YQ+   +K
Sbjct: 294 KTNFFEKRVSDYQRPGVMK 312


>gi|46122063|ref|XP_385585.1| hypothetical protein FG05409.1 [Gibberella zeae PH-1]
          Length = 399

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 158/319 (49%), Gaps = 27/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N LT DE+  I   L FFA+S+
Sbjct: 79  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLTSDEQYFISHILAFFAASD 136

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   D  +   LFN   
Sbjct: 137 GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKDPAQRTYLFNAVD 196

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 197 TIPCIRKKADWAIRWIQ------------DKNSTFAQRLVAFAAV-EGIFFSGAFASIFW 243

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G++   + I RDE LH +F         + + HL  +  +Q  + ++ +A  
Sbjct: 244 LKKRGLMPGLSFSNELISRDEGLHTDFAC-------LLHSHLKGRASKQMIQDIITDAVS 296

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L 
Sbjct: 297 IEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYKST-NPFDFM-ENISLG 354

Query: 331 KEKNFFETRVTEYQQGAEL 349
            + NFFE RV +YQ+   L
Sbjct: 355 GKTNFFEKRVADYQKAGVL 373


>gi|328771482|gb|EGF81522.1| hypothetical protein BATDEDRAFT_16297 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 336

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 164/342 (47%), Gaps = 27/342 (7%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P++   +   V ++ +L      + L P+KY   W  Y  A  + W   EV +  D   W
Sbjct: 2   PLELPSESTLVQNEPILTPDPRRSVLFPIKYPAVWRMYKKAEASFWTAEEVDLSKDTLDW 61

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           + +  LTDDER  I R L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS
Sbjct: 62  EER--LTDDERYFISRVLAFFAASDGIVNENLVERFSQDVHIPEARYFYDFQIMIENIHS 119

Query: 129 HTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
             +  +I +   D  E   LF+    VP I  KA+WAL++              D    F
Sbjct: 120 EMYSLLIDTYIKDRKERAFLFDAIDTVPCIRKKADWALRWIS------------DKKSSF 167

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
            + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +
Sbjct: 168 GERLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFTLL 226

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
                    K      + ++HEA  +E  ++ E++P   +G+NA   +QY++F+A+R   
Sbjct: 227 N-------NKPTDSVIQQIIHEAVTIEQEFSTESLPVALIGMNANLMKQYIEFVADRLFI 279

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           ++G+ P      NPF +M ++I L+ + NFFE RV EYQ+  
Sbjct: 280 ELGM-PKKYGVGNPFDFM-DMISLQGKTNFFEKRVGEYQKSG 319


>gi|154296564|ref|XP_001548712.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
 gi|150843273|gb|EDN18466.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
          Length = 407

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 166/345 (48%), Gaps = 35/345 (10%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+ P +A E  +  +  R +        L P+KY   W+ Y  A  + W   E+ +  DL
Sbjct: 63  GIKPEEADEPLLQENPNRFV--------LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDL 114

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
             W  +  L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E 
Sbjct: 115 HDWNER--LNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMEN 172

Query: 126 VHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           +HS T+  +I +   ++ +   LFN    +P I  KA+WA+++ Q            D +
Sbjct: 173 IHSETYSLLIDTYIKEQSQKTYLFNAIDTIPCIKKKADWAVKWIQ------------DKN 220

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
             F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + 
Sbjct: 221 STFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMAGLTFSNELISRDEGLHTDFACLLF 279

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           +       HL  +  +Q  + ++ EA  +E  +  E +P   +G+N+   +QY++F+A+R
Sbjct: 280 S-------HLKHRPSKQAVQDVITEAVEIEQEFLTEALPCALLGMNSNLMKQYIEFVADR 332

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
               +G +  +K + NPF +M E I L  + NFFE RV +YQ+  
Sbjct: 333 LLLSLGNDKYYK-SANPFDFM-ENISLAGKTNFFEKRVGDYQKAG 375


>gi|160881347|ref|YP_001560315.1| ribonucleoside-diphosphate reductase [Clostridium phytofermentans
           ISDg]
 gi|160430013|gb|ABX43576.1| Ribonucleoside-diphosphate reductase [Clostridium phytofermentans
           ISDg]
          Length = 342

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 172/320 (53%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA   Y +  NN W+P E+ +Q+D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWARLIYRTMLNNFWIPEEISLQEDV---KQFPYLTDGERNAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++ PE    L  QAF+E +H+ ++ YI+ ++   +    +++++RE   
Sbjct: 89  SENLP-NISRYITAPEVSSLLNVQAFQEEIHAQSYSYILDTVTNPVTRDRIYDIWREDKY 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S        + +D+ F++ +F  Y++ EG++FY+GF+   +L R 
Sbjct: 148 LLERNKFIANIYQRFSD-------EPSDENFVRVVFANYIL-EGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    +++ ++++E   ++TK  +++ R M+      EIA
Sbjct: 200 GKMTATSTIFKYINRDEITHLVLFQNIMKELRVEQKEMFTKGLEEELREMMRTGVEHEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +G+N    +QY+++++N+R   +GLE L+ + T++P  W+    ++   K
Sbjct: 260 WGQYVTDNQILGINNELIDQYIKYLSNQRLRAVGLEILYPEITKHPMEWIESFSNINSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAVFDFD 339


>gi|58584525|ref|YP_198098.1| ribonucleotide-diphosphate reductase subunit beta [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418841|gb|AAW70856.1| Ribonucleotide reductase, beta subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 331

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 159/314 (50%), Gaps = 15/314 (4%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK K  L + E+ ++ +   FF  ++ +
Sbjct: 12  PFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWKIK--LLNVEKNLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPS 154
             NN  +  Y ++  P E    L   +  E +H   + Y++ ++G+ E E +  + +  +
Sbjct: 69  EVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAAYSYLLDTIGMPESE-YQAFLKYDA 127

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  K  + L++ ++          K   +   + L VF    EG+  +  FA +L+  R 
Sbjct: 128 MRKKYEYMLEFEES---------KKHDKKHVAKTLAVFGAFTEGLQLFASFAILLNFQRF 178

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM G+ +   +  RDE+LH N  I++ N    EN  +W  EF++   +       LE  
Sbjct: 179 GKMKGMGQIIAWSARDETLHTNSIINLFNTFIKENNEIWNDEFKEGLYSACRTIVGLEDE 238

Query: 275 YAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           +       G V GL+A     Y+++IANRR  Q+GL+P++   +NP PW+ E+++  +  
Sbjct: 239 FIKLAFDLGDVEGLSAEEVRNYIRYIANRRLMQLGLKPIYDINDNPLPWLDEILNGVEHT 298

Query: 334 NFFETRVTEYQQGA 347
           NFFE RVTEY + A
Sbjct: 299 NFFENRVTEYSRAA 312


>gi|322693757|gb|EFY85606.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           acridum CQMa 102]
          Length = 411

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 156/319 (48%), Gaps = 27/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDE+  I   L FFA+S+
Sbjct: 90  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDEKYFISHILAFFAASD 147

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 148 GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKENAQRTYLFNAID 207

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 208 TIPCIRKKADWAIRWIQ------------DKESTFAQRLVAFAAV-EGIFFSGAFASIFW 254

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F         + + HL  +  +Q    ++ +A  
Sbjct: 255 LKKRGLMPGLTFSNELISRDEGLHTDFAC-------LLHSHLKNRASKQIIHDIITDAVA 307

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L 
Sbjct: 308 IEKEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYK-TSNPFDFM-ENISLG 365

Query: 331 KEKNFFETRVTEYQQGAEL 349
            + NFFE RV +YQ+   L
Sbjct: 366 GKTNFFEKRVGDYQKAGVL 384


>gi|302409182|ref|XP_003002425.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
 gi|261358458|gb|EEY20886.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
          Length = 414

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 155/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W +K  + DDE+  I   L FFA+S+
Sbjct: 93  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNK--INDDEKYFISHILAFFAASD 150

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 151 GIVNENLVERFSAEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPAQRTYLFNAID 210

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL            T   D    F   L  F VV EG++F   FA I  
Sbjct: 211 TIPCIRKKADWAL------------TWITDKKSTFATRLVAFAVV-EGIFFSGAFASIFW 257

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  
Sbjct: 258 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQTVQDIVTDAVN 310

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P G +G+NA   +QY++F+A+R    +G E ++K T NPF +M E I L 
Sbjct: 311 IEQEFLTEALPCGLLGMNATLMKQYIEFVADRLLVALGNEKVYKAT-NPFDFM-ENISLG 368

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 369 GKTNFFEKRVADYQKAG 385


>gi|322709430|gb|EFZ01006.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 414

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 156/319 (48%), Gaps = 27/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDE+  I   L FFA+S+
Sbjct: 93  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDEKYFISHILAFFAASD 150

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 151 GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKENAQRTYLFNAID 210

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 211 TIPCIRKKADWAIRWIQ------------DKESTFAQRLVAFAAV-EGIFFSGAFASIFW 257

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F         + + HL  +  +Q    ++ +A  
Sbjct: 258 LKKRGLMPGLTFSNELISRDEGLHTDFAC-------LLHSHLKNRASKQVIYDIITDAVA 310

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L 
Sbjct: 311 IEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYK-TSNPFDFM-ENISLG 368

Query: 331 KEKNFFETRVTEYQQGAEL 349
            + NFFE RV +YQ+   L
Sbjct: 369 GKTNFFEKRVGDYQKAGVL 387


>gi|209966751|ref|YP_002299666.1| ribonucleotide-diphosphate reductase subunit beta [Rhodospirillum
           centenum SW]
 gi|209960217|gb|ACJ00854.1| ribonucleoside-diphosphate reductase, beta subunit [Rhodospirillum
           centenum SW]
          Length = 322

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 162/322 (50%), Gaps = 23/322 (7%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E +L+    HW+P EVP+ DD+  W+ K  LT+ ER ++ +   FF  ++  
Sbjct: 14  PFRYPWAYEAWLTQQRIHWLPEEVPLADDVKDWRQK--LTEAERNLLTQIFRFFTQADVE 71

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL--FNMYREV 152
           V NN  +  Y  +  P E    L   +  E VH   + +++ ++G+ E E   F  Y+E+
Sbjct: 72  V-NNCYMRHYSRVFQPTEVCMMLAAFSAMETVHIAAYSHLLDTIGMPEIEYSAFLRYKEM 130

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
                       Y Q  +         D+ ++  + L VF    EG+  +  FA +++  
Sbjct: 131 KD-------KYDYMQGFNV--------DSLEDIAKTLAVFGAFTEGLQLFASFAILMNFP 175

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R NKM G+ +   + +RDE+LH    I +      ENP +WT+ FQ++           E
Sbjct: 176 RFNKMKGMGQIVTWSVRDETLHTLSMIKLFRTFVNENPQVWTEAFQRELTVCCETIVHHE 235

Query: 273 IAYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
            A+       G V G+ A   ++Y+++IA+RR  Q+GLEP+++  +NP PWM  +++  +
Sbjct: 236 DAFIDLAFEMGPVEGMTAEDVKRYIRWIADRRLGQLGLEPVYRIEKNPLPWMDAILNGIE 295

Query: 332 EKNFFETRVTEYQQGAEL-KWD 352
             NFFE R TEY + A    WD
Sbjct: 296 HTNFFENRATEYSKAATRGTWD 317


>gi|317014473|gb|ADU81909.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Gambia94/24]
          Length = 341

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 169/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL ANN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|297831106|ref|XP_002883435.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
 gi|297329275|gb|EFH59694.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
          Length = 341

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 156/327 (47%), Gaps = 29/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L A++    + P++Y   WE Y  A  + W   EV +  D+  W++   LTD E+  I 
Sbjct: 21  LLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEA---LTDSEKHFIS 77

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +   D  
Sbjct: 78  HVLAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFLKDSK 137

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I+ KA W L + Q  S  SF                V +   EG++
Sbjct: 138 EKDRLFNAIETIPCISKKAKWCLDWIQ--SPMSFAVR------------LVAFACVEGIF 183

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++ + P        +K
Sbjct: 184 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLP-------LEK 236

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R    +G E  +K  ENPF
Sbjct: 237 VYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERRYK-AENPF 295

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E I L+ + NFFE RV EYQ+ +
Sbjct: 296 DWM-EFISLQGKTNFFEKRVGEYQKAS 321


>gi|190570498|ref|YP_001974856.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019257|ref|ZP_03335064.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190356770|emb|CAQ54129.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995366|gb|EEB56007.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 329

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 161/314 (51%), Gaps = 15/314 (4%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L++ E+ ++ +   FF  ++ +
Sbjct: 12  PFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWKTK--LSNVEKNLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPS 154
             NN  +  Y ++  P E    L   +  E +H   + Y++ ++G+ E E +  + +  +
Sbjct: 69  EVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAAYSYLLDTIGMPESE-YQAFLKYDA 127

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  K  + L++ ++          K   +   + L VF    EG+  +  FA +L+  R 
Sbjct: 128 MRKKYEYMLEFEES---------KKQDKKHVAKTLAVFGAFTEGLQLFASFAILLNFQRF 178

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM G+ +   +  RDE+LH N  I++ N    EN  +W  EF+++  +       LE  
Sbjct: 179 GKMKGMGQIIAWSARDETLHTNSIINLFNTFIKENNEIWNDEFKEELYSACRTIVELEDE 238

Query: 275 YAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           +       G V GL+A     Y+++IANRR  Q+GL+ ++   +NP PW+ E+++  +  
Sbjct: 239 FISLAFDLGDVEGLSAEEVRNYIRYIANRRLTQLGLKSIYNVKDNPIPWLDEILNGVEHT 298

Query: 334 NFFETRVTEYQQGA 347
           NFFE RVTEY + A
Sbjct: 299 NFFENRVTEYSRAA 312


>gi|15229476|ref|NP_189000.1| RNR2A (RIBONUCLEOTIDE REDUCTASE 2A); ribonucleoside-diphosphate
           reductase [Arabidopsis thaliana]
 gi|27735240|sp|P50651|RIR2A_ARATH RecName: Full=Ribonucleoside-diphosphate reductase small chain A;
           AltName: Full=Ribonucleoside-diphosphate reductase R2A
           subunit; Short=AtRNR2; Short=Protein R2at; AltName:
           Full=Ribonucleotide reductase small subunit A
 gi|13937232|gb|AAK50108.1|AF372971_1 AT3g23580/MDB19_7 [Arabidopsis thaliana]
 gi|9294514|dbj|BAB02776.1| ribonucleotide reductase [Arabidopsis thaliana]
 gi|23505945|gb|AAN28832.1| At3g23580/MDB19_7 [Arabidopsis thaliana]
 gi|332643258|gb|AEE76779.1| Ribonucleoside-diphosphate reductase small chain A [Arabidopsis
           thaliana]
          Length = 341

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 156/327 (47%), Gaps = 29/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L A++    + P++Y   WE Y  A  + W   EV +  D+  W++   LTD E+  I 
Sbjct: 21  LLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEA---LTDSEKHFIS 77

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +   D  
Sbjct: 78  HILAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSK 137

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I+ KA W L + Q  S  SF                V +   EG++
Sbjct: 138 EKDRLFNAIETIPCISKKAKWCLDWIQ--SPMSFAVR------------LVAFACVEGIF 183

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++ + P        +K
Sbjct: 184 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPL-------EK 236

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R    +G E  +K  ENPF
Sbjct: 237 VYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-AENPF 295

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E I L+ + NFFE RV EYQ+ +
Sbjct: 296 DWM-EFISLQGKTNFFEKRVGEYQKAS 321


>gi|207343947|gb|EDZ71248.1| YJL026Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 399

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 156/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+S+V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDSIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|15612081|ref|NP_223733.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori J99]
 gi|11387046|sp|Q9ZKC3|RIR2_HELPJ RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|4155613|gb|AAD06604.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA CHAIN [Helicobacter
           pylori J99]
 gi|307637755|gb|ADN80205.1| Ribonucleotide reductase of classIa beta subunit [Helicobacter
           pylori 908]
 gi|325996356|gb|ADZ51761.1| Ribonucleotide reductase of class Ia beta subunit [Helicobacter
           pylori 2018]
 gi|325997944|gb|ADZ50152.1| Ribonucleosidase diphosphate reductase beta subunit [Helicobacter
           pylori 2017]
          Length = 341

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 169/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL ANN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|260950985|ref|XP_002619789.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
 gi|238847361|gb|EEQ36825.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
          Length = 419

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/318 (30%), Positives = 152/318 (47%), Gaps = 29/318 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  D+  WK  N +TD+ER  I R L FFA+S+
Sbjct: 106 LFPIKYNEIWQMYKKAEASFWTAEEIDLSKDINDWK--NRMTDNERFFISRVLAFFAASD 163

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I S   D  E   LFN   
Sbjct: 164 GIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDSYIKDPKEADFLFNAIE 223

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA WAL++                D+    +  V +   EG++F   FA I  
Sbjct: 224 NIPCIKKKAEWALRWIAD-------------DEALFAERLVAFAAVEGIFFSGSFASIFW 270

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEAT 269
           L +   M G+    + I RDE LH +F   + + +    NP +  K        ++ EA 
Sbjct: 271 LKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLNNRPNPAIVEK--------IITEAV 322

Query: 270 LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 329
            +E  Y  + +P   +G+N     QY++F+A+R    +G + ++  T NPF +M E I L
Sbjct: 323 TIEKEYFTDALPASLLGMNCDLMCQYVEFVADRLLVALGNKKVYNVT-NPFDFM-ENISL 380

Query: 330 KKEKNFFETRVTEYQQGA 347
             + NFFE RV++YQ+  
Sbjct: 381 AGKTNFFEKRVSDYQKAG 398


>gi|210135249|ref|YP_002301688.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori P12]
 gi|210133217|gb|ACJ08208.1| ribonucleoside-diphosphate reductase 1 beta subunit [Helicobacter
           pylori P12]
          Length = 341

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 169/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL ANN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|332519182|ref|ZP_08395649.1| Ribonucleoside-diphosphate reductase [Lacinutrix algicola 5H-3-7-4]
 gi|332045030|gb|EGI81223.1| Ribonucleoside-diphosphate reductase [Lacinutrix algicola 5H-3-7-4]
          Length = 327

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 160/329 (48%), Gaps = 28/329 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P+++   WE Y  +  + W   E+ +  DL  W SK  LTDDER  IK
Sbjct: 8   ILQENKDRFVIFPIQHHDLWEWYKKSEASMWTAEEIDLHQDLTDWSSK--LTDDERYFIK 65

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE 
Sbjct: 66  HVLAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEK 125

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN     P+I  KA WAL++   + SPSF             +  + +   EG++
Sbjct: 126 EKAMLFNAIETFPAIKKKAEWALKW---IESPSFA------------ERLIAFAAVEGIF 170

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE +H +F       + +   HL  K  +++
Sbjct: 171 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDFA------VHLHEHHLINKVPKER 224

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R +L +A  +E  +  E++P   +G+N+    QY++F+ +     +G E  +  T NPF
Sbjct: 225 IREILVDALNIEREFITESLPVSLIGMNSKLMSQYLEFVTDGLLQDLGCEKEYG-TANPF 283

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +M ++I L+ + NFFE RV+EYQ+   L
Sbjct: 284 DFM-DMISLQGKTNFFEKRVSEYQKAGVL 311


>gi|150024561|ref|YP_001295387.1| ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
 gi|149771102|emb|CAL42569.1| Ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
          Length = 325

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 163/322 (50%), Gaps = 28/322 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+K+   WE Y S   + W   E+ +  DL  W +K  L++DER  +K  L FFA+S+
Sbjct: 17  IFPIKHHDIWEFYKSMEASFWTAEEIDLSQDLNDWNNK--LSNDERYFVKHILAFFAASD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELFNMYR 150
            +V  N+       +   E + +   Q   E +HS T+  +I +   DE    ELFN   
Sbjct: 75  GIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEVEKDELFNALE 134

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             P+I  KA+WALQ+ ++ S              F + L  F  V EG++F   F  I  
Sbjct: 135 VFPAIKKKADWALQWIESDS--------------FAERLIAFAAV-EGIFFSGAFCSIYW 179

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F       + + N HL  K  +++ R+++ +A  
Sbjct: 180 LKKRGLMPGLTFSNELISRDEGVHCDFA------VHLHNHHLVNKVPKERIRSIIVDALN 233

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+NA    QY++F+A+R   ++G +  +  T NPF +M ++I L+
Sbjct: 234 IEREFITESLPVSLIGMNAVLMTQYLEFVADRLLVELGCDREYN-TANPFDFM-DMISLQ 291

Query: 331 KEKNFFETRVTEYQQGAELKWD 352
            + NFFE +V EYQ+   +  D
Sbjct: 292 GKTNFFEKKVAEYQKAGVMNTD 313


>gi|296271635|ref|YP_003654266.1| ribonucleoside-diphosphate reductase [Arcobacter nitrofigilis DSM
           7299]
 gi|296095810|gb|ADG91760.1| Ribonucleoside-diphosphate reductase [Arcobacter nitrofigilis DSM
           7299]
          Length = 339

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/349 (28%), Positives = 172/349 (49%), Gaps = 18/349 (5%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSD-VNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           MA  T  +P    + + ++ D+R+     D +     +KY WA   + +   N W P EV
Sbjct: 1   MARKTIYNP----DSKESLSDRRIFGGNPDGMINFTKMKYQWALNLWDTMEANTWFPREV 56

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            M  D   +K    LT  E+ M    L      +SL  NN++  I  +++ PE    L R
Sbjct: 57  QMTGDAKDYKY---LTPAEKRMYDLVLSQLIFMDSLQTNNLMDNINPYITVPEINACLSR 113

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           Q++EEA HS ++  ++ S+  +  E+++M++    +  K N+       LS         
Sbjct: 114 QSYEEANHSKSYAVMVESISDNTDEIYDMWKNDTQLREKNNYIAAVYDNLSD-------N 166

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
             D++ +  +F   ++ EG++FY GFA I +LG++ KM+G ++  ++I RDE  HL    
Sbjct: 167 ITDEKMVLAMFANQIL-EGLYFYAGFAAIYALGKSGKMLGSSQMIKFIQRDEVTHLLLFQ 225

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           ++IN  + E P L+T E + K R M  +A  LE A+         +G       QY+Q++
Sbjct: 226 NMINSTRKERPDLFTPELEVKVRAMFRKAVELEAAWGAYITQGQILGFTDGIITQYIQYL 285

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           A++R   +G +P +   ++P PW+        ++ NFFE  V  Y +G+
Sbjct: 286 ADKRLDAVGYKPEYN-VKHPIPWVDGYSSFNDQRTNFFEGNVVNYSKGS 333


>gi|291388369|ref|XP_002710634.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Oryctolagus cuniculus]
          Length = 339

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/333 (30%), Positives = 163/333 (48%), Gaps = 28/333 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N LT D
Sbjct: 16  NEDEEPLLKKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NRLTSD 72

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  +I +
Sbjct: 73  EKYFISHVLAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT 132

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  +   LFN    +P +  KA+WAL++     S   T G +           V + 
Sbjct: 133 YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----------VVAFA 179

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         +L  
Sbjct: 180 AVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ-------YLVN 232

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 233 KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLMELGFSKVFQ 292

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 293 -AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 323


>gi|150863757|ref|XP_001382334.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
 gi|149385013|gb|ABN64305.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
          Length = 417

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 157/327 (48%), Gaps = 29/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           M N R  V  L P+KY   W+ Y  A  + W   E+ +  D+  W   N L D+ER  I 
Sbjct: 95  MENTRRFV--LFPIKYNEVWQMYKKAEASFWTAEEIDLSKDITDWN--NRLNDNERFFIS 150

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I S   D  
Sbjct: 151 RILAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDSYIKDPK 210

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA+WAL++              D D  F + L  F  V EG++
Sbjct: 211 EADFLFNAIDNIPCIRKKADWALRWIS------------DDDALFGERLVAFAAV-EGIF 257

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   + +       HL  +   + 
Sbjct: 258 FSGSFASIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFS-------HLQNRPDAEI 310

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +G + ++  T NPF
Sbjct: 311 VEKIITEAVKIEKEFFTDALPSSLLGMNAELMCQYVEFVADRLLVALGNKKVYNVT-NPF 369

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 370 DFM-ENISLAGKTNFFEKRVSDYQKAG 395


>gi|66822029|ref|XP_644369.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|66823381|ref|XP_645045.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|41019487|sp|P42521|RIR2_DICDI RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|29611978|gb|AAB72227.2| ribonucleotide reductase small subunit [Dictyostelium discoideum]
 gi|60472492|gb|EAL70444.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|60472997|gb|EAL70945.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
          Length = 338

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/326 (30%), Positives = 161/326 (49%), Gaps = 30/326 (9%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   L P+KY   W  Y  A  +HW+  E+ + +D   W+ K  LTD+ER  I 
Sbjct: 14  ILKENKDRFVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWEYK--LTDNERHFIS 71

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD-- 141
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   D  
Sbjct: 72  HVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIETYIKDKQ 131

Query: 142 -EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
            + +LFN    +P I  KA WAL++              D+D  F + L  F  V EG++
Sbjct: 132 TKDKLFNAIETIPCIKKKAEWALRWIN------------DSDS-FAERLVAFAAV-EGIF 177

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQ 259
           F   F  I  L +   M G+    + I RDE LH +F   +  +++ + +P +  K    
Sbjct: 178 FSGSFCSIFWLKKRGLMQGLTFSNELISRDEGLHCDFACLLYTKLQRKLDPKVIEK---- 233

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
               M+ +A   E  +  E++P   +G+N+ S  QY++F A+R    +G + +F  + NP
Sbjct: 234 ----MIRDAVECEKEFICESLPVDLIGMNSRSMSQYIEFCADRLVVSLGYKKIFN-SSNP 288

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQ 345
           F WM E+I L+++ NFFE +V EY +
Sbjct: 289 FEWM-EMISLQRKSNFFEGKVAEYAK 313


>gi|182419335|ref|ZP_02950587.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum 5521]
 gi|237666940|ref|ZP_04526925.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182376666|gb|EDT74238.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum 5521]
 gi|237658139|gb|EEP55694.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 344

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 175/337 (51%), Gaps = 19/337 (5%)

Query: 19  VDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +  KR++N  + ++N    +KY W  + Y    NN W+P EV +  DL   K    L D+
Sbjct: 17  ITKKRLINGNTTNLNDFNNMKYTWVSDWYRQGMNNFWIPEEVNLSQDL---KDYQNLLDE 73

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER+   + L F    +S+   N+   I  +++  E    L  Q+F+EAVHS ++ Y++ S
Sbjct: 74  ERIAYDKILSFLIFLDSIQTANLS-NINNYITASEVNLCLTIQSFQEAVHSQSYSYMLDS 132

Query: 138 LGLDE--GELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           +   E   E+   +++   +  +  +    Y + + +P+        ++  L+ L   Y+
Sbjct: 133 ICSPEKRNEILYQWKDDEILLNRNKFIGDLYNEFIDNPT--------EETLLKTLMANYI 184

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY+GF    +L R  KM G A++ +YI RDE+ HL    ++I +++ EN  L+T
Sbjct: 185 L-EGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNIIKELQNENAELFT 243

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           +E + + R M+      EI + H  +     G+N    E+Y++++ N+R  +I LEPLF+
Sbjct: 244 EEIKNELREMMKTGVEQEILWGHYVIGDKIQGINKKLIEEYIKYLGNKRLKEINLEPLFE 303

Query: 315 -YTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
            +  NP PW+    +    K +FFE R T Y + A L
Sbjct: 304 GHDVNPAPWVDRQSNANSVKTDFFEARSTAYAKAATL 340


>gi|255079598|ref|XP_002503379.1| predicted protein [Micromonas sp. RCC299]
 gi|226518645|gb|ACO64637.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/327 (29%), Positives = 156/327 (47%), Gaps = 29/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L+   D   + P+KYG  WE Y  A  + W   EV + DD+  W   N L +DE+  IK
Sbjct: 17  LLDPNDDRFTMFPIKYGDIWEMYKKAEASFWTAEEVDLSDDMVHW---NKLNNDEKHFIK 73

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I +   D  
Sbjct: 74  HILAFFAASDGIVLENLGVRFMGEVQFPEARAFYGFQIAIENIHSEMYSLLIDAYVKDAQ 133

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF   + +P I  KA+WA ++ ++               +F + L  F  + EG++
Sbjct: 134 EKTYLFQAIQNIPCIAKKADWAFKWIES-------------SADFAERLIAFACI-EGIF 179

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + I         K  +  
Sbjct: 180 FSGSFCSIYWLKKRGLMPGLTFSNELISRDEGLHRDFACLLYSYIN-------KKPNESV 232

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R ++ EA  +E  +  + +P   VG+NA    +Y++F+A+    Q+G+   +    NPF
Sbjct: 233 VRQIVKEAVEIEKEFVCDALPCALVGMNADLMSEYIEFVADHLLGQLGMSKEYN-AANPF 291

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV EYQ+  
Sbjct: 292 DWM-ELISLQGKTNFFEKRVGEYQKSG 317


>gi|840719|emb|CAA54549.1| ribonucleotide reductase R2 [Arabidopsis thaliana]
          Length = 340

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/330 (30%), Positives = 160/330 (48%), Gaps = 36/330 (10%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L A++    + P++Y   WE Y  A  + W   EV +  D+  W++   LTD E+  I 
Sbjct: 21  LLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEA---LTDSEKHFIS 77

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSN---PECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
             L FFA+S+ +V  N+     R L++   PE R +   Q   E +HS  +  ++ +   
Sbjct: 78  HILAFFAASDGIVLENLA----RFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIK 133

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P I+ KA W L + Q  S  SF                V +   E
Sbjct: 134 DSKEKDRLFNAIETIPCISKKAKWCLDWIQ--SPMSFAVR------------LVAFACAE 179

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +I+ +++  P       
Sbjct: 180 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLISLLQLHVP------- 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +K   ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R    +G E  +K  E
Sbjct: 233 LEKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-AE 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           NPF WM E I L+ + NFFE RV EYQ+ +
Sbjct: 292 NPFDWM-EFISLQGKTNFFEKRVGEYQKAS 320


>gi|308184827|ref|YP_003928960.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SJM180]
 gi|308060747|gb|ADO02643.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SJM180]
          Length = 341

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 169/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
           +++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 VSWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|73974198|ref|XP_539109.2| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 2 [Canis familiaris]
          Length = 351

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/337 (30%), Positives = 163/337 (48%), Gaps = 28/337 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  V  D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEVKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +   S   T G +           
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKS---TFGER----------V 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------- 240

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           +L  K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 241 YLVNKPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +F+  ENPF +M E I L+ + NFFE RV EYQ+ A
Sbjct: 301 KVFQ-AENPFDFM-ENISLEGKTNFFEKRVAEYQRFA 335


>gi|85109237|ref|XP_962820.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
 gi|30316285|sp|Q9C167|RIR2_NEUCR RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|16273691|gb|AAK14804.2| small subunit of ribonucleotide reductase [Neurospora crassa]
 gi|28924456|gb|EAA33584.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
          Length = 410

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/344 (30%), Positives = 165/344 (47%), Gaps = 35/344 (10%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           L P +A E  +  + +R +        L P+KY   W+ Y  A  + W   E+ +  DL 
Sbjct: 70  LKPEEANEPLLTENPQRFV--------LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLH 121

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   N L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +
Sbjct: 122 DWN--NRLNDDEKFFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENI 179

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   +  +   LFN    +P I  KA+WAL++    SS            
Sbjct: 180 HSETYSLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWITDKSST----------- 228

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 229 -FAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFS 286

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
                  HL  +  +Q  + ++ +A  +E  +  E +P   +G+NA   +QY++F+A+R 
Sbjct: 287 -------HLNNRPSKQLIQEIIVDAVRIEQEFLTEALPCALLGMNADLMKQYIEFVADRL 339

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +G E +++ T NPF +M E I L  + NFFE RV +YQ+  
Sbjct: 340 LVALGNEKIYRST-NPFDFM-ENISLGGKTNFFEKRVGDYQKAG 381


>gi|42520108|ref|NP_966023.1| ribonucleotide-diphosphate reductase subunit beta [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|58696705|ref|ZP_00372253.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|58698234|ref|ZP_00373154.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630036|ref|YP_002726827.1| ribonucleotide-diphosphate reductase beta subunit [Wolbachia sp.
           wRi]
 gi|42409845|gb|AAS13957.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|58535261|gb|EAL59340.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58537117|gb|EAL60231.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592017|gb|ACN95036.1| ribonucleotide-diphosphate reductase beta subunit [Wolbachia sp.
           wRi]
          Length = 329

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 159/314 (50%), Gaps = 15/314 (4%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L+  E+ ++ +   FF  ++ +
Sbjct: 12  PFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWKTK--LSSVEKNLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPS 154
             NN  +  Y ++  P E    L   +  E +H   + Y++ ++G+ E E +  + +  +
Sbjct: 69  EVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAAYSYLLDTIGMPESE-YQAFLKYDA 127

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  K  + L++ ++          K   +   + L VF    EG+  +  FA +L+  R 
Sbjct: 128 MRKKYEYMLEFEES---------KKHDKKHVAKTLAVFGAFTEGLQLFASFAILLNFQRF 178

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  
Sbjct: 179 GKMKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFKEELYSACRTIVELEDE 238

Query: 275 YAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           +       G V GL+A     Y++++ANRR  Q+GLE ++   +NP PW+ E+++  +  
Sbjct: 239 FIKLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVNDNPIPWLDEILNGVEHT 298

Query: 334 NFFETRVTEYQQGA 347
           NFFE RVTEY + A
Sbjct: 299 NFFENRVTEYSRAA 312


>gi|86132508|ref|ZP_01051102.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
 gi|85817069|gb|EAQ38253.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
          Length = 328

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P+++   WE Y  +  + W   E+ +  DL  WK K  LTDDER  IK
Sbjct: 7   ILAENKDRFVIFPIQHDDIWEWYKKSEASFWTAEEIDLHQDLVDWKGK--LTDDERYFIK 64

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE 
Sbjct: 65  HILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEV 124

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN     P+I  KA+WAL++   + SPSF            + L  F  V EG++
Sbjct: 125 EKDKLFNALENFPAIKKKADWALKW---IDSPSFA-----------ERLIAFAAV-EGIF 169

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE +H +F       + + N HL  K  +++
Sbjct: 170 FSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFA------VHLHNHHLVNKVPKER 223

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++  A  +E  +  E++P   +G+N+    QY++++ +R   ++  E ++  T NPF
Sbjct: 224 ITEIIVNALDIEREFITESLPVSLIGMNSNLMTQYLEYVTDRLLTELDCEKVYN-TANPF 282

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            +M ++I L+ + NFFE RV EYQ+   +K
Sbjct: 283 DFM-DMISLQGKTNFFEKRVGEYQKAGVVK 311


>gi|79160106|gb|AAI08038.1| Rrm2b protein [Danio rerio]
          Length = 349

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 166/347 (47%), Gaps = 31/347 (8%)

Query: 5   TGLSPIQAGEKRVN---VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T ++  Q G K V+   V+D+ +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 10  TVITGYQNGHKDVDPNSVEDEPLLRENPKRFVIFPIQYPDIWKMYKQAQASFWTVEEVDL 69

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   +GL  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q 
Sbjct: 70  SKDLTHW---DGLKSEEKHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQI 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +   D  E   LFN  + +P +  KA+WALQ+             
Sbjct: 127 LIENVHSEMYSMLINTYIRDLKERDYLFNAVQTMPCVRRKADWALQWIS----------- 175

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F + L  F  V EG++F   FA I  L R   M G+    + I RDE LH NF 
Sbjct: 176 -DTNSTFGERLVAFAAV-EGIFFSGSFAAIYWLKRRGLMPGLTYSNELISRDEGLHCNFA 233

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
                   +   +L  K    +   ++ +A  +E  +  E +P   +G+N    +QY++F
Sbjct: 234 C-------LMYSYLVKKPSVDRVNDIIAKAVSIEQEFLTEALPVNLIGMNCSLMKQYIEF 286

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +A+R    +GL P    +ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 287 VADRLLTDLGL-PKAYCSENPFDFM-ESISLEGKTNFFEKRVAEYQR 331


>gi|15644992|ref|NP_207162.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori 26695]
 gi|2500210|sp|P55983|RIR2_HELPY RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2313466|gb|AAD07432.1| ribonucleoside diphosphate reductase, beta subunit (nrdB)
           [Helicobacter pylori 26695]
          Length = 341

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL ANN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer
          Length = 419

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 98  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 155

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 156 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 215

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 216 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 262

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 263 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 315

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 316 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 374

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 375 DFM-ENISLAGKTNFFEKRVSDYQKAG 400


>gi|321263951|ref|XP_003196693.1| ribonucleotide reductase small subunit [Cryptococcus gattii WM276]
 gi|317463170|gb|ADV24906.1| Ribonucleotide reductase small subunit, putative [Cryptococcus
           gattii WM276]
          Length = 430

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 153/316 (48%), Gaps = 28/316 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+    DL  W  +  +T+ ER  I R L FFA+S+
Sbjct: 112 LFPIKYNEIWQAYKRAQASFWTAEELDFGHDLIDWHDR--MTEQERFFILRILAFFAASD 169

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  NIV      +   E R +   Q+  E VHS T+  +I +   D  E   LF    
Sbjct: 170 GIVGENIVSQFSLEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDAQEKDFLFRGME 229

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL+Y                D+   +   V +   EG++F   FA I  
Sbjct: 230 NIPCIKQKADWALKYI--------------TDELPFRTRLVAFACVEGIFFSGSFAAIFW 275

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F   + N +K    H  + +   +   ++ EA +
Sbjct: 276 LKKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLK----HRCSTD---EVHRIVSEALV 328

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF WM E+I L+
Sbjct: 329 IEKQFLTDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPFDWM-ELISLQ 386

Query: 331 KEKNFFETRVTEYQQG 346
            + NFFE+RV+ YQ+ 
Sbjct: 387 GKANFFESRVSAYQKA 402


>gi|296116311|ref|ZP_06834927.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977130|gb|EFG83892.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 334

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 157/317 (49%), Gaps = 24/317 (7%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA++ +L+    HW+P EVP+ DD+  W     LT+ ER ++ +   FF  S+  
Sbjct: 27  PFRYPWAYDAWLTQQQVHWLPEEVPLADDVKDWH--RSLTESERHLVTQIFRFFTQSDVE 84

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E   F  Y+E
Sbjct: 85  V-NNCYMKHYSQVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPESEYSAFLKYKE 142

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y Q      F+   K    E  + L  F    EG+  +  FA +L+ 
Sbjct: 143 MKD-------KYDYMQ-----EFSVSNK---YEIARTLAAFGAFTEGLQLFASFAILLNF 187

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
            R NK+ G+ +   + +RDE+LH      +      ENP +WT++ Q   R +  +    
Sbjct: 188 PRFNKLKGMGQIVSWSVRDETLHCVSMARLFRVFVQENPEIWTQKLQDDIRQICRDIVEH 247

Query: 272 EIAYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           E A+   +   G V GL+A   ++Y++F+ANRR  Q+GL+ L+    NP PW+ E+++  
Sbjct: 248 EDAFIDLSFEMGPVEGLDAAQVKRYIRFVANRRLGQLGLDGLYDVATNPLPWVDEMVNAV 307

Query: 331 KEKNFFETRVTEYQQGA 347
           +  NFFE R TEY + A
Sbjct: 308 EHANFFENRSTEYSRAA 324


>gi|208434985|ref|YP_002266651.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori G27]
 gi|208432914|gb|ACI27785.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori G27]
          Length = 341

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL ANN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQANNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|50311465|ref|XP_455757.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644893|emb|CAG98465.1| KLLA0F15103p [Kluyveromyces lactis]
          Length = 401

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 154/318 (48%), Gaps = 29/318 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   WE Y  A  + W   E+ +  DL  W   N + ++ER  I R L FFA+S+
Sbjct: 88  LFPIKYHEIWEAYKRAEASFWTAEEIDLSKDLHDWN--NRMNENERFFISRILAFFAASD 145

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 146 GIVNENLVENFSAEVQAPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESEFLFNAIE 205

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA WA+++ Q            D D  F + L  F  V EG++F   FA I  
Sbjct: 206 TIPQIKEKAEWAIRWIQ------------DDDALFGERLVAFAAV-EGVFFSGSFAAIFW 252

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEAT 269
           L +   M G+    + I RDE LH +F   +   +K + NP +  K        ++ EA 
Sbjct: 253 LKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPNPEIVEK--------IITEAV 304

Query: 270 LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 329
            +E  Y  + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L
Sbjct: 305 EIEKRYFMDALPVSLLGMNADLMNQYVEFVADRLLVALGNKKYFNVT-NPFDFM-ENISL 362

Query: 330 KKEKNFFETRVTEYQQGA 347
             + NFFE RV++YQ+  
Sbjct: 363 AGKTNFFEKRVSDYQKAG 380


>gi|15896521|ref|NP_349870.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           acetobutylicum ATCC 824]
 gi|15026352|gb|AAK81210.1|AE007823_4 Ribonucleotide reductase beta subunit [Clostridium acetobutylicum
           ATCC 824]
 gi|325510679|gb|ADZ22315.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           acetobutylicum EA 2018]
          Length = 344

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 173/334 (51%), Gaps = 19/334 (5%)

Query: 22  KRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           K+++N  + ++N    +KY W  + Y    NN W+P E+ +  DL   K    LTD+ER 
Sbjct: 20  KKIVNGNTTNLNDFNNMKYTWVSDWYRQGMNNFWIPEEINLSQDL---KDYGKLTDNERT 76

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
              + L F    +S+   N+   I  +++  E    L  QAF+EAVHS ++ Y++ ++  
Sbjct: 77  AYDKILSFLIFLDSVQTANLG-NINDYITASEVNLCLTIQAFQEAVHSQSYSYMLDTICS 135

Query: 141 DE--GELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
            E   E+   +++   + ++  +    Y   +  PS        D+ FL+ +   YV+ E
Sbjct: 136 PEKRNEILFQWKDDEVLLSRNKFIGDIYNNFVEEPS--------DENFLKAIMGNYVL-E 186

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++FY+GF    +L R  KM G A++ +YI RDE+ HL    ++I +++ E P ++T+E 
Sbjct: 187 GIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNIIKELQKEEPDMFTEEI 246

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YT 316
           +++ + M+      EI + H  +     G+N    E Y++++ NRR   IG EP+++ Y 
Sbjct: 247 KKELKDMVKTGVENEITWGHYVIGDNIQGINKKLIEDYIKYLGNRRLEAIGFEPIYEGYD 306

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
           ENP  W+    D    K +FFE + T Y + + L
Sbjct: 307 ENPALWVDIYADANSVKTDFFEAKSTAYAKASTL 340


>gi|151945057|gb|EDN63308.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae YJM789]
 gi|190409471|gb|EDV12736.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae RM11-1a]
 gi|256271075|gb|EEU06176.1| Rnr2p [Saccharomyces cerevisiae JAY291]
          Length = 399

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|55742360|ref|NP_001007164.1| ribonucleoside-diphosphate reductase subunit M2 B [Danio rerio]
 gi|29561808|emb|CAD87804.1| novel protein similar to vertebrate ribonucleotide reductase M2 B
           (TP53 inducible) (RRM2B) [Danio rerio]
          Length = 349

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 107/347 (30%), Positives = 168/347 (48%), Gaps = 31/347 (8%)

Query: 5   TGLSPIQAGEKRVN---VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T ++  Q G K V+   V+D+ +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 10  TVITGYQNGHKDVDPNSVEDEPLLRENPKRFVIFPIQYPDIWKMYKQAQASFWTVEEVDL 69

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   +GL  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q 
Sbjct: 70  SKDLTHW---DGLKSEEKHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQI 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +   D  E   LFN  + +P +  KA+WALQ+             
Sbjct: 127 LIENVHSEMYSMLINTYIRDLKERDYLFNAVQTMPCVRRKADWALQWIS----------- 175

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F + L  F  V EG++F   FA I  L +   M G+    + I RDE LH NF 
Sbjct: 176 -DTNSTFGERLVAFAAV-EGIFFSGSFAAIYWLKKRGLMPGLTYSNELISRDEGLHCNFA 233

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +I    ++ P +       +   ++ +A  +E  +  E +P   +G+N    +QY++F
Sbjct: 234 C-LIYSYLVKKPSV------DRVNDIIAKAVSIEQEFLTEALPVNLIGMNCSLMKQYIEF 286

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +A+R    +GL P    +ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 287 VADRLLTDLGL-PKAYCSENPFDFM-ESISLEGKTNFFEKRVAEYQR 331


>gi|323347997|gb|EGA82256.1| Rnr2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 399

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|323308423|gb|EGA61668.1| Rnr2p [Saccharomyces cerevisiae FostersO]
          Length = 399

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|290771185|emb|CAY80753.2| Rnr2p [Saccharomyces cerevisiae EC1118]
          Length = 399

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|109947017|ref|YP_664245.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           acinonychis str. Sheeba]
 gi|109714238|emb|CAJ99246.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           acinonychis str. Sheeba]
          Length = 341

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLIDEVIEMFKKAVKIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|6322434|ref|NP_012508.1| Rnr2p [Saccharomyces cerevisiae S288c]
 gi|1172946|sp|P09938|RIR2_YEAST RecName: Full=Ribonucleoside-diphosphate reductase small chain 1;
           AltName: Full=Ribonucleotide reductase R2 subunit 1;
           AltName: Full=Ribonucleotide reductase small subunit 1
 gi|52695523|pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695524|pdb|1SMQ|B Chain B, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695525|pdb|1SMQ|C Chain C, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695526|pdb|1SMQ|D Chain D, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|172450|gb|AAA34988.1| ribonucleoside diphosphate reductase small subunit [Saccharomyces
           cerevisiae]
 gi|1008142|emb|CAA89317.1| RNR2 [Saccharomyces cerevisiae]
 gi|285812874|tpg|DAA08772.1| TPA: Rnr2p [Saccharomyces cerevisiae S288c]
          Length = 399

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 155/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|187932511|ref|YP_001884520.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           botulinum B str. Eklund 17B]
 gi|187720664|gb|ACD21885.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B str. Eklund 17B]
          Length = 344

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 175/335 (52%), Gaps = 21/335 (6%)

Query: 22  KRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KR++N  + ++N    +KY WA + Y    NN W+P E+ +  DL  +K    L  DER 
Sbjct: 20  KRVINGNTTNLNDFNNMKYTWASDWYRQGMNNFWIPEEINLAQDLKDYKK---LLPDERT 76

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
              + L F    +S+   N+   I  +++  E    L  Q+F+EAVHS ++ Y++ S+  
Sbjct: 77  AYDKILSFLIFLDSIQTANLS-NINSYITASEINLCLTIQSFQEAVHSQSYSYMLDSICS 135

Query: 141 DE--GELFNMYREVPSITAKANWALQ--YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            E   E+   +++   I  K N  +   Y + +++P+        +   ++ L   Y++ 
Sbjct: 136 PEERNEILYQWKD-DEILLKRNKFIGDLYNEFINNPN--------EYNLIKTLMANYIL- 185

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY+GF    +L R  KM G A++ +YI RDE+ HL    ++I +++ ENP  +T +
Sbjct: 186 EGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNIIKELQSENPESFTAD 245

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-Y 315
            + + R M+H     EI + H  +     G+N    E Y++++ N+R  +IGLEPLF  Y
Sbjct: 246 LKNELREMMHIGVENEILWGHYVIGDKIQGINKKLIEDYIKYLGNKRLKEIGLEPLFSGY 305

Query: 316 TENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
            ENP  W+  V +    K +FFE + T Y + + L
Sbjct: 306 EENPATWVDVVANSNSVKTDFFEAKSTAYAKVSTL 340


>gi|155122339|gb|ABT14207.1| hypothetical protein MT325_M653L [Paramecium bursaria chlorella
           virus MT325]
          Length = 326

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 157/314 (50%), Gaps = 28/314 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P+KY   +  Y  A +  W   EVP+  D+A W+ K  L DDER  IK  LGFFA S+ 
Sbjct: 21  FPIKYPDVFAMYKKAVSTFWTVEEVPLNQDIADWRDK--LNDDERHFIKTILGFFAGSDG 78

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYRE 151
           +V  NI       +++P  R +   Q F E++HS  +  ++ +L  D+ E   LF+    
Sbjct: 79  MVMENIANNFSTEVTDPSARLFYAYQMFNESIHSEMYSLLLDALIEDDAERNSLFDAIET 138

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA ++                D+ F + L V +V  EG+ F   F  I  L
Sbjct: 139 IPAVGKKAAWAQKFLSQ-------------DKSFAERL-VAWVCVEGLLFSGSFCAIFWL 184

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG  + +  K+EN     K    + + ++ EA   
Sbjct: 185 RNRGVMPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLAQVKAIVEEAVAN 237

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  E +P   +G+N+    QY++F+A+R    +G    +  T NPF +M E+I L+ 
Sbjct: 238 EKEFICEAIPCRMIGMNSELMGQYLEFVADRIFVALGHPKQYNAT-NPFDFM-ELISLEG 295

Query: 332 EKNFFETRVTEYQQ 345
           + NFFE RV+EYQ+
Sbjct: 296 KSNFFERRVSEYQR 309


>gi|118443949|ref|YP_878438.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           novyi NT]
 gi|118134405|gb|ABK61449.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           novyi NT]
          Length = 342

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 168/320 (52%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA E Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYNWANELYRTMLNNFWIPEEISLNEDV---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++ PE    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE  +
Sbjct: 89  SENLP-NISRYITAPEVSSLLNVQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDKN 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q+ +    T       + FL+ +   Y++ EG++FY+GF+   +L R 
Sbjct: 148 LLERNKFIAGIYQSFNENPTT-------ENFLRTIMANYIL-EGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I ++K ENP ++T+   ++ R M+      EI 
Sbjct: 200 GKMTATSTIFKYINRDEITHLILFQNIIKELKNENPDIFTESIMEEFRMMMKMGVEHEIK 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +G+N    E+Y+++++N R + IGLE L+ + TE+P  W+     L   K
Sbjct: 260 WGQYVTNNEILGINDNLIEKYIKYLSNLRLNAIGLEVLYPEITEHPMEWIENFSKLNNTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|256421019|ref|YP_003121672.1| ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
 gi|256035927|gb|ACU59471.1| Ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
          Length = 323

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (48%), Gaps = 30/334 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +N++++ +L    D   LLP+ Y   WEKY     + W   E+ +  D+  W   N L D
Sbjct: 1   MNLENELLLKENKDRFVLLPINYPKVWEKYKQHEASFWTAEEIDLSADMKDW---NNLND 57

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            ER  I   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I 
Sbjct: 58  GERHFITHVLAFFAASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLID 117

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LF+    VP++T KA WAL++ +              +  F + L  F 
Sbjct: 118 TYVKDPVEKDRLFHAIETVPAVTKKAKWALRWIE--------------NGNFAERLVAFA 163

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++F   F  I  L +   M G+    + I RDE LH  F   +   ++   P   
Sbjct: 164 AV-EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCEFACLLYGMLENRLP--- 219

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               +++  T++ +A  +E  +  + +P   +G+N+    +Y++F+A+R   ++G   +F
Sbjct: 220 ----EEQVHTIIRDAVAIEKEFITDALPVALIGMNSKLMSEYIEFVADRWLSELGYTKIF 275

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             T NPF +M E+I L+ + NFFE RV +YQ+  
Sbjct: 276 N-TANPFDFM-EMISLQGKTNFFEKRVGDYQKAG 307


>gi|155370749|ref|YP_001426283.1| hypothetical protein FR483_N651L [Paramecium bursaria Chlorella
           virus FR483]
 gi|155124069|gb|ABT15936.1| hypothetical protein FR483_N651L [Paramecium bursaria Chlorella
           virus FR483]
          Length = 348

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 157/314 (50%), Gaps = 28/314 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P+KY   +  Y  A +  W   EVP+  D+A W+ K  L DDER  IK  LGFFA S+ 
Sbjct: 43  FPIKYPDVFAMYKKAVSTFWTVEEVPLNQDIADWRDK--LNDDERHFIKTILGFFAGSDG 100

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYRE 151
           +V  NI       +++P  R +   Q F E++HS  +  ++ +L  D+ E   LF+    
Sbjct: 101 MVMENIANNFSTEVTDPSARLFYAYQMFNESIHSEMYSLLLDALIEDDAERNSLFDAIET 160

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA ++                D+ F + L V +V  EG+ F   F  I  L
Sbjct: 161 IPAVGKKAAWAQKFLSQ-------------DKSFAERL-VAWVCVEGLLFSGSFCAIFWL 206

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG  + +  K+EN     K    + + ++ EA   
Sbjct: 207 RNRGVMPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLAQVKAIVEEAVAN 259

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  E +P   +G+N+    QY++F+A+R    +G    +  T NPF +M E+I L+ 
Sbjct: 260 EKEFICEAIPCRMIGMNSELMGQYLEFVADRIFVALGHPKQYNAT-NPFDFM-ELISLEG 317

Query: 332 EKNFFETRVTEYQQ 345
           + NFFE RV+EYQ+
Sbjct: 318 KSNFFERRVSEYQR 331


>gi|225677302|ref|ZP_03788281.1| ribonucleotide-diphosphate reductase beta [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225590665|gb|EEH11913.1| ribonucleotide-diphosphate reductase beta [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 329

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 158/314 (50%), Gaps = 15/314 (4%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L+  E+ ++ +   FF  ++ +
Sbjct: 12  PFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWKTK--LSSVEKNLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPS 154
             NN  +  Y ++  P E    L   +  E +H   + Y++ ++G+ E E +  + +  +
Sbjct: 69  EVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAAYSYLLDTIGMPESE-YQAFLKYDA 127

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  K  + L++ ++          K   +   + L VF    EG+  +  FA +L+  R 
Sbjct: 128 MRKKYEYMLEFEES---------KKHDKKHVAKTLAVFGAFTEGLQLFASFAILLNFQRF 178

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  
Sbjct: 179 GKMKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDDEFKEELYSACRTIVELEDE 238

Query: 275 YAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           +       G V GL+A     Y+ ++ANRR  Q+GLE ++   +NP PW+ E+++  +  
Sbjct: 239 FIKLAFDFGDVEGLSAEEVRNYIHYVANRRLMQLGLESIYDVNDNPIPWLDEILNGVEHT 298

Query: 334 NFFETRVTEYQQGA 347
           NFFE RVTEY + A
Sbjct: 299 NFFENRVTEYSRAA 312


>gi|254455551|ref|ZP_05068980.1| ribonucleoside-diphosphate reductase, beta subunit [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082553|gb|EDZ59979.1| ribonucleoside-diphosphate reductase, beta subunit [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 335

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 160/320 (50%), Gaps = 30/320 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y W ++ +L+    HW+P EVP+ DD+  W+    L+  E+ ++ +   FF  ++  
Sbjct: 28  PFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQK--NLSQSEKNLLTQIFRFFTQADVE 85

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL--FNMYREV 152
           V NN  L  Y  +  P E    +   A  E VH   + +++ ++G+ E E   F  Y+E+
Sbjct: 86  V-NNCYLRHYTTVFKPTEVLMMMTAFAAMETVHVAAYSHLLDTIGMPESEYSAFMKYKEM 144

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
                       Y Q      F   +K   ++  + + VF    EG+  +  FA +L+  
Sbjct: 145 KD-------KYDYMQ-----DFNVNSK---EDIAKTVAVFSAFTEGLQLFASFAILLNFP 189

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT----KEFQQKSRTML-HE 267
           R NKM G+ +   + +RDE+LH N  I +  +   ENP +WT    KE  +  RT++ HE
Sbjct: 190 RHNKMKGMGQIVTWSVRDETLHCNSMIRIFKEFINENPEIWTPKLKKELYEACRTIIAHE 249

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
              +++A+    M     GL A   + Y++FI NRR  Q+GLEP++   +NP  W+  ++
Sbjct: 250 DAFIDLAFEMGPME----GLTAQEVKDYIRFIGNRRLTQLGLEPIYDVDKNPLGWLDTML 305

Query: 328 DLKKEKNFFETRVTEYQQGA 347
           +  +  NFFE R TEY + +
Sbjct: 306 NAVEHMNFFEGRATEYSKAS 325


>gi|317012862|gb|ADU83470.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Lithuania75]
          Length = 341

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|146298285|ref|YP_001192876.1| ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
 gi|146152703|gb|ABQ03557.1| Ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
          Length = 325

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 159/322 (49%), Gaps = 28/322 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+K+   WE Y     + W   E+ +  DL  W +K  L DDER  IK  L FFA+S+
Sbjct: 17  IFPIKHHDIWEWYKKMEASFWTAEEIDLHQDLTDWNNK--LNDDERYFIKHILAFFAASD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG---ELFNMYR 150
            +V  N+       +   E + +   Q   E +HS T+  +I +   DE    ELFN   
Sbjct: 75  GIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEAEKTELFNALE 134

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             P+I  K  WAL++ ++ S              F + L  F  V EG++F   F  I  
Sbjct: 135 VFPAIAKKGEWALKWIESDS--------------FAERLIAFAAV-EGIFFSGAFCSIYW 179

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F       + + N HL  K  +++ + ++ +A  
Sbjct: 180 LKKRGLMPGLTFSNELISRDEGVHCDFA------VHLHNHHLVNKVPKERIKEIIVDALD 233

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+NA    QY++F+A+R   ++G E ++  + NPF +M ++I L+
Sbjct: 234 IERQFVTESLPVSLIGMNAGLMTQYLEFVADRLLVELGCERVYG-SANPFDFM-DMISLQ 291

Query: 331 KEKNFFETRVTEYQQGAELKWD 352
            + NFFE RV EYQ+   +  D
Sbjct: 292 GKTNFFEKRVAEYQKSGVMNTD 313


>gi|99036000|ref|ZP_01315041.1| hypothetical protein Wendoof_01000112 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 329

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 159/314 (50%), Gaps = 15/314 (4%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L+  E+ ++ +   FF  ++ +
Sbjct: 12  PFNYPWAYDAWLQQQRIHWIPEEVPLADDVKDWKTK--LSSVEKNLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPS 154
             NN  +  Y ++  P E    L   +  E +H   + Y++ ++G+ E E +  + +  +
Sbjct: 69  EVNNCYMRHYSNIFKPTEICMMLASFSNMETIHIAAYSYLLDTIGMPESE-YQAFLKYDA 127

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  K  + L++ ++          K   +   + L VF    EG+  +  FA +L+  R 
Sbjct: 128 MRKKYEYMLEFEES---------KKHDKKHVAKTLAVFGAFTEGLQLFASFAILLNFQRF 178

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  
Sbjct: 179 GKMKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFKEELYSACRTIVELEDE 238

Query: 275 YAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 333
           +       G V GL+A     Y++++ANRR  Q+GLE ++   +NP PW+ E+++  +  
Sbjct: 239 FIKLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVNDNPTPWLDEILNGVEHT 298

Query: 334 NFFETRVTEYQQGA 347
           NFFE RVTEY + A
Sbjct: 299 NFFENRVTEYSRAA 312


>gi|157952945|ref|YP_001497837.1| hypothetical protein NY2A_B641R [Paramecium bursaria Chlorella
           virus NY2A]
 gi|155123172|gb|ABT15040.1| hypothetical protein NY2A_B641R [Paramecium bursaria Chlorella
           virus NY2A]
          Length = 324

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 157/314 (50%), Gaps = 28/314 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P++Y   W  Y  A    W   EVP+  D+A W+ K  L +DER  IK  LGFFA S+ 
Sbjct: 19  FPIQYHDLWNMYKKAVATFWTTEEVPLNADVADWREK--LNNDERHFIKHILGFFAGSDG 76

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYRE 151
           +V  N+       +  PE RQ+   Q F E+VHS  +  +I +L  DE E   LF+    
Sbjct: 77  IVMENLQTNFGVEVMAPEARQFYAYQTFNESVHSEMYALLIDALISDEQERLDLFDAIET 136

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA ++ +              ++ F + L V ++  EG+ F   F  +  L
Sbjct: 137 IPAVHNKAKWAQKWLK-------------PERSFAERL-VAWICVEGILFSGSFCALFWL 182

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG       ++    L  K   +  + ++ EA   
Sbjct: 183 RNKGVMPGLCLSNEFISRDEGLHQQFG-------ELMYSKLQNKLSFETIKQIIMEAVTN 235

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  + +P   +G+NA    QY++F+A+R    +G E ++  ++NPF +M E+I L+ 
Sbjct: 236 EKEFICDAIPCSMIGMNADLMNQYIEFVADRIFTALGYEKVYN-SKNPFAFM-ELISLEG 293

Query: 332 EKNFFETRVTEYQQ 345
           + NFFE RV++YQ+
Sbjct: 294 KTNFFEKRVSDYQR 307


>gi|58260834|ref|XP_567827.1| ribonucleotide reductase small subunit [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|134117207|ref|XP_772830.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255448|gb|EAL18183.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229908|gb|AAW46310.1| ribonucleotide reductase small subunit, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 430

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 151/316 (47%), Gaps = 28/316 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+    DL  W  +  +T+ ER  I R L FFA+S+
Sbjct: 112 LFPIKYNEIWQAYKHAQASFWTAEELDFGHDLIDWHDR--MTEQERFFILRILAFFAASD 169

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  NIV      +   E R +   Q+  E VHS T+  +I +   D  E   LF    
Sbjct: 170 GIVGENIVSQFALEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDAQEKDFLFRGMT 229

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL+Y                D+   +   V +   EG++F   FA I  
Sbjct: 230 NIPCIKQKADWALKYI--------------TDELPFRTRLVAFACVEGIFFSGSFAAIFW 275

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F   + N +K       T E       ++ EA +
Sbjct: 276 LKKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLK---HRCSTDEVHH----IVSEALV 328

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF WM E+I L+
Sbjct: 329 IEKQFLTDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPFDWM-ELISLQ 386

Query: 331 KEKNFFETRVTEYQQG 346
            + NFFE+RV+ YQ+ 
Sbjct: 387 GKANFFESRVSAYQKA 402


>gi|317178607|dbj|BAJ56395.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F30]
          Length = 341

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSTEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|254779643|ref|YP_003057749.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori B38]
 gi|254001555|emb|CAX29573.1| Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide
           reductase small subunit) [Helicobacter pylori B38]
          Length = 341

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSTEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|317011285|gb|ADU85032.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SouthAfrica7]
          Length = 341

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EKNILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLIDEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|188527870|ref|YP_001910557.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Shi470]
 gi|188144110|gb|ACD48527.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Shi470]
 gi|308063873|gb|ADO05760.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Sat464]
          Length = 341

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EESILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|308183194|ref|YP_003927321.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori PeCan4]
 gi|308065379|gb|ADO07271.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori PeCan4]
          Length = 341

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|289177074|ref|NP_001165948.1| ribonucleoside-diphosphate reductase subunit M2 B isoform 2 [Homo
           sapiens]
          Length = 423

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 103/346 (29%), Positives = 166/346 (47%), Gaps = 28/346 (8%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            G S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  D
Sbjct: 87  AGRSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKD 146

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           L  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E
Sbjct: 147 LPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIE 203

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            VHS  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +  
Sbjct: 204 NVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER-- 258

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
                    V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 259 --------VVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLM 310

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
                    +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+
Sbjct: 311 FQ-------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVAD 363

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           R   ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 364 RLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 407


>gi|297380266|gb|ADI35153.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori v225d]
 gi|308062365|gb|ADO04253.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Cuz20]
 gi|317180823|dbj|BAJ58609.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F32]
 gi|332673890|gb|AEE70707.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           pylori 83]
          Length = 341

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|86134368|ref|ZP_01052950.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
 gi|85821231|gb|EAQ42378.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
          Length = 323

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 160/319 (50%), Gaps = 32/319 (10%)

Query: 34  LLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           + P+++   W W K   AC   W   E+ +  DL  W +K  LTDDER  IK  L FFA+
Sbjct: 17  IFPIQHNDLWEWYKKQQAC--FWTAEEIDLHSDLVDWTTK--LTDDERYFIKHILAFFAA 72

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYRE 151
           S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE E   ++R 
Sbjct: 73  SDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEVEKDRLFRA 132

Query: 152 V---PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQI 208
           +   P+I  KA+WAL++ ++              + F + L  F  V EG++F   F  I
Sbjct: 133 IEVFPAIKKKADWALKWIES--------------ESFAERLIAFAAV-EGIFFSGAFCSI 177

Query: 209 LSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEA 268
             L +   + G+    + I RDE +H +F       + + N H+  +  + + + ++ +A
Sbjct: 178 FWLKKRGLLPGLTFSNELISRDEGMHCDFA------VHLHNNHIVNRVPKDRIKEIIVDA 231

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E  +  E++P   +G+NA    QY++F+ +R   + G E ++  T NPF +M E+I 
Sbjct: 232 LDIEREFVTESLPVSLIGMNAKLMTQYLEFVTDRLLLEFGCEKVYDVT-NPFDFM-EMIS 289

Query: 329 LKKEKNFFETRVTEYQQGA 347
           L+ + NFFE RV+EYQ+  
Sbjct: 290 LEGKTNFFEKRVSEYQKAG 308


>gi|118383611|ref|XP_001024960.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila]
 gi|89306727|gb|EAS04715.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila SB210]
          Length = 376

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 167/347 (48%), Gaps = 35/347 (10%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           N+ G +P +  E      D+ +L    +   L P+KY   WE Y     + W   E+ + 
Sbjct: 45  NDEGKAPKEGYE------DEPLLKDNPNRFVLFPIKYNKVWEMYKKELASFWTADEIDLY 98

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W+    LTD+ER  IK  L FFA+S+ +V  N+       +  PE R +   Q  
Sbjct: 99  QDLKDWER---LTDNERHFIKYVLAFFAASDGIVLENLAEQFMCEVQIPEARAFYGFQIA 155

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS T+  +I +   DE E   LF   + VP I  KA WAL++              
Sbjct: 156 MENIHSETYSLLIDTYIKDEVEKDYLFKASQNVPVIHKKAQWALKWINN----------- 204

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
             +  F   L  F  + EG++F   F  I  L + + M G+    + I RDE LH +F  
Sbjct: 205 --NDNFASRLIAFAAI-EGIFFSGSFCAIFWLKKRSLMPGLTFSNELISRDEGLHTDFAC 261

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            + + +   N  L  +E  +    ++ EA  +E  +  E +P   +G+N+   +QY++F+
Sbjct: 262 LLYSML---NKKLTKEEIYE----IITEAVEIEKEFISEALPVELIGMNSNMMKQYLEFV 314

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQG 346
           A+R    +G+ P F  ++NPF WM ++I ++ + NFFE RV EYQ+ 
Sbjct: 315 ADRLLFALGV-PKFYNSKNPFEWM-DMISIQGKTNFFEKRVGEYQKA 359


>gi|219110949|ref|XP_002177226.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411761|gb|EEC51689.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 409

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 153/322 (47%), Gaps = 36/322 (11%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
            L P+++   W  Y     + W   E+ +  DL  W  +  L D+ER  I   L FFA +
Sbjct: 95  SLFPIEHDDLWGMYKQHVASFWTVDEIDLSADLTDWHER--LNDNERHFISMVLAFFAGA 152

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMY 149
           + +V  N+     R ++ PE R +   Q   E +H  T+  +I S   D  +   LF  +
Sbjct: 153 DGIVVENLAERFCREVTVPEARAFYGFQMAMEGIHQETYCLLIDSYISDPKDREMLFAAH 212

Query: 150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQIL 209
            +VPS+  KA WA +Y  +             D  F + L  F  V EG++F   F  I 
Sbjct: 213 TKVPSVEKKARWAQRYIGS-------------DASFAERLVAFAAV-EGIFFSGAFCSIF 258

Query: 210 SLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH--- 266
            L +   M G+    + I RDE LH +F              L++K  ++ S T +H   
Sbjct: 259 WLKKRGLMPGLTFSNELISRDEGLHCSFAC-----------QLYSKLERKLSETDMHKLI 307

Query: 267 -EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            EA  +E  +  + +P G +G+NA    QY++F+A+R  H +G   L+  ++NPF WM +
Sbjct: 308 GEAVEVEKGFVCDALPVGLIGMNASLMSQYVEFVADRLLHDLGYRTLYG-SKNPFDWM-D 365

Query: 326 VIDLKKEKNFFETRVTEYQQGA 347
           +I L+ + NFFE RV EYQ+  
Sbjct: 366 MISLEGKTNFFEKRVGEYQKSG 387


>gi|281340156|gb|EFB15740.1| hypothetical protein PANDA_011632 [Ailuropoda melanoleuca]
          Length = 336

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 162/337 (48%), Gaps = 28/337 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 9   ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 65

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 66  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 125

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +   S   T G +           
Sbjct: 126 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKS---TFGER----------V 172

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 173 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------- 225

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           +L  K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 226 YLVNKPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 285

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +F+  ENPF +M E I L+ + NFFE RV EYQ+ A
Sbjct: 286 KVFQ-AENPFDFM-ENISLEGKTNFFEKRVAEYQRFA 320


>gi|315586979|gb|ADU41360.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           pylori 35A]
          Length = 341

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKVLFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|261838422|gb|ACX98188.1| ribonucleoside-diphosphate reductase 1 beta subunit [Helicobacter
           pylori 51]
          Length = 341

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 168/316 (53%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKVLFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            ++         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ASWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|301774462|ref|XP_002922647.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Ailuropoda melanoleuca]
          Length = 387

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 162/337 (48%), Gaps = 28/337 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 60  ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 116

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 117 LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 176

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +   S   T G +           
Sbjct: 177 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKS---TFGER----------V 223

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 224 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------- 276

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           +L  K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 277 YLVNKPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 336

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +F+  ENPF +M E I L+ + NFFE RV EYQ+ A
Sbjct: 337 KVFQ-AENPFDFM-ENISLEGKTNFFEKRVAEYQRFA 371


>gi|237749822|ref|ZP_04580302.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           bilis ATCC 43879]
 gi|229374572|gb|EEO24963.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           bilis ATCC 43879]
          Length = 351

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 173/340 (50%), Gaps = 21/340 (6%)

Query: 18  NVDDKRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +V+++R+     + + +L  +KY WA+    +   N W P EV M  D   +     LT 
Sbjct: 25  SVNERRIFGGNPTAIFELNKIKYQWAYNLLRTMFANTWFPEEVNMNQDKRDYME---LTL 81

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+    R L      +SL  NN+   I  +++ PE    L+RQAFEE++H+ ++  ++ 
Sbjct: 82  QEKQGYDRALAQLIFMDSLQTNNLTDNINPYITCPEINMLLVRQAFEESLHAQSYAVMVD 141

Query: 137 SLGLDEGELFNMYREVPSITAKANW-ALQYTQTLSSPSFTTGTKD--ADQEFLQDLFVFY 193
           S+  +  E++ M+R+   + +K ++ A  YT    +P+ T   K   A+Q          
Sbjct: 142 SISANTDEIYQMWRKDDKLRSKNDYIADVYTDLAKNPTETNLIKAMFANQ---------- 191

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY+GFA   +L R+ KM   AE  ++I RDE  HL     +I   + E P L+
Sbjct: 192 -ILEGIYFYSGFAFFYTLARSGKMQNSAEMIRFIQRDEITHLTIFQQMIISTRKERPDLF 250

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T+  Q +   M  +A  LE ++         +GL A    QY++++A++R   +   P+ 
Sbjct: 251 TQALQDEVMEMFRQAVDLESSWGEYITQGQILGLTAKIIRQYIEYLADKRLKAVDY-PIL 309

Query: 314 KYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAELKWD 352
             T+NP  W+ E ++   ++ NFFE +V  Y +G ELK++
Sbjct: 310 YNTQNPIQWVDEQVNFNNQRTNFFEAKVRNYTRG-ELKFE 348


>gi|330994651|ref|ZP_08318574.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
 gi|329758292|gb|EGG74813.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
          Length = 365

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 161/321 (50%), Gaps = 21/321 (6%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA++ +L+    HW+P EVP+ DD+  W     LT+ ER ++ +   FF  S+  
Sbjct: 57  PFRYPWAYDAWLTQQRVHWLPEEVPLADDVKDWHRT--LTESERHLVTQIFRFFTQSDVE 114

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E ++ + +  
Sbjct: 115 V-NNCYMKHYSQVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPETE-YSAFLKYK 171

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q++ +             + +  + L  F    EG+  +  FA +L+  R
Sbjct: 172 EMKDKYDYMQQFSVS------------DNYQIARTLAAFGAFTEGLQLFASFAILLNFPR 219

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
            NK+ G+ +   + +RDESLH +    +      ENP +WT   +   R +  +    E 
Sbjct: 220 HNKLKGMGQIVSWSVRDESLHCDSMARLFRVFVQENPEIWTDTLRDDIRQICRDIVEHED 279

Query: 274 AYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
           A+   +   G V GL+A   ++Y++F+ANRR  Q+GL+ ++    NP PW+ E+++  + 
Sbjct: 280 AFIDLSFEMGAVEGLDAGQVKRYIRFVANRRLGQLGLDGIYDIATNPLPWVDEMVNAVEH 339

Query: 333 KNFFETRVTEYQQGAEL-KWD 352
            NFFE R TEY + +    WD
Sbjct: 340 ANFFENRATEYSRASTTGTWD 360


>gi|320585888|gb|EFW98567.1| ribonucleotide reductase small subunit [Grosmannia clavigera
           kw1407]
          Length = 378

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 105/343 (30%), Positives = 163/343 (47%), Gaps = 32/343 (9%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           NNT +S I+A E      ++ +L   +    L P+KY   W+ Y     + W   E+ + 
Sbjct: 47  NNTAVSAIKAAEA-----EEPLLKENAQRFVLFPIKYHEIWQMYKKHEASFWTAEEIDLS 101

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L DDER  +   L FFA+S+ +V  N+V      +  PE R +   Q  
Sbjct: 102 KDLHDWN--NRLNDDERFFVSHILAFFAASDGIVNENLVERFSAEVQVPEARCFYGFQIM 159

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS T+  +I +   D  +   LFN    +P I  KA+WAL++              
Sbjct: 160 MENVHSETYSLLIDTYIKDTAQRTHLFNAIDTIPCIRKKADWALKWIS------------ 207

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           D +  F Q L  F  V EG++F   F+ I  L +   M G+    + I RDE LH +F  
Sbjct: 208 DRESTFAQRLVAFAAV-EGIFFSGAFSSIFWLKKRGLMPGLTFSNELISRDEGLHTDFAC 266

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            + +       HL  +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F+
Sbjct: 267 LLFS-------HLKNRPSKQLIEEIIVDAVKIEQEFLTEALPCALLGMNSTLMKQYIEFV 319

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTE 342
           A+R    +G + ++  T NPF +M E I L  + NFFE RV E
Sbjct: 320 ADRLLVALGNDKVYNST-NPFDFM-ENISLGGKTNFFEKRVPE 360


>gi|224000239|ref|XP_002289792.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975000|gb|EED93329.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 335

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 94/318 (29%), Positives = 159/318 (50%), Gaps = 28/318 (8%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
            L P+ Y   W  Y     + W   E+ +  DL+ W  K  L  DER  I   L FFA +
Sbjct: 14  SLFPIAYPDLWSMYKQHVASFWTADEIDLSADLSDWHKK--LNPDERHFISMVLAFFAGA 71

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD---EGELFNMY 149
           + +V  N+     R ++ PE R +   Q   E++H  T+  +I +   D      LF+ +
Sbjct: 72  DGIVVENLAERFCREVTVPEARCFYGFQMAMESIHQETYCLLIDTYITDPKVRERLFSAH 131

Query: 150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQIL 209
             VPS+  KA+WA +Y  + +S             F + L  F  V EG++F   F  I 
Sbjct: 132 ATVPSVERKASWAQRYIGSKAS-------------FAERLVAFAAV-EGIFFSGSFCAIF 177

Query: 210 SLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEAT 269
            L +   M G+    + I RDE LH +F   + +++K+       K  Q++ +T+++EA 
Sbjct: 178 WLKKRGLMPGLTFSNELISRDEGLHCSFACQLYSKLKL-------KLSQEEIQTIINEAV 230

Query: 270 LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 329
            +E ++  + +P   +G+N+    QY++F+A+R    +G + ++  ++NPF WM ++I L
Sbjct: 231 DVEKSFICDALPVSLIGMNSRLMAQYIEFVADRMLTDLGYQAMYG-SKNPFDWM-DMISL 288

Query: 330 KKEKNFFETRVTEYQQGA 347
           + + NFFE RV EYQ+  
Sbjct: 289 EGKTNFFEKRVGEYQKSG 306


>gi|296536499|ref|ZP_06898590.1| ribonucleotide-diphosphate reductase subunit beta [Roseomonas
           cervicalis ATCC 49957]
 gi|296263178|gb|EFH09712.1| ribonucleotide-diphosphate reductase subunit beta [Roseomonas
           cervicalis ATCC 49957]
          Length = 343

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 160/321 (49%), Gaps = 32/321 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA++ +++    HW+P EVPM DD+  W+    LT+ ER ++ +   FF  ++  
Sbjct: 21  PFRYPWAYDAWMTQQRVHWLPEEVPMADDVKDWQ--KNLTESERNLLTQIFRFFTQADVE 78

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E   F  Y+E
Sbjct: 79  V-NNCYMKHYSQVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPETEYQAFLKYKE 136

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y Q+ S  + T        E  + L  F    EG+  +  FA +++ 
Sbjct: 137 MKD-------KYDYMQSFSVENKT--------EIAKTLAAFGAFTEGLQLFASFAILMNF 181

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLH 266
            R NKM G+ +   + +RDE+LH    I +      ENP +WT++ +       +  + H
Sbjct: 182 PRFNKMKGMGQIVSWSVRDETLHCLSVIRLFRTFIQENPEIWTEQLKADLVEICTTIVEH 241

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+       G  G+     +QY++FIA+RR  Q+GLEP +   +NP PW+ E+
Sbjct: 242 EDAFIDLAFEL----GGVQGMEPEDVKQYIRFIADRRLQQLGLEPHYGTEKNPLPWLDEI 297

Query: 327 IDLKKEKNFFETRVTEYQQGA 347
           ++  +  NFFE R TEY + +
Sbjct: 298 LNAVEHMNFFEGRATEYSKAS 318


>gi|217032591|ref|ZP_03438080.1| hypothetical protein HPB128_159g17 [Helicobacter pylori B128]
 gi|298735909|ref|YP_003728434.1| ribonucleoside-diphosphate reductase subunit beta [Helicobacter
           pylori B8]
 gi|216945727|gb|EEC24352.1| hypothetical protein HPB128_159g17 [Helicobacter pylori B128]
 gi|298355098|emb|CBI65970.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           pylori B8]
          Length = 341

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|207092116|ref|ZP_03239903.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori HPKX_438_AG0C1]
          Length = 341

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  I   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNINPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|41054952|ref|NP_955770.1| ribonucleoside-diphosphate reductase subunit M2 B [Mus musculus]
 gi|81885688|sp|Q6PEE3|RIR2B_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|34786000|gb|AAH58103.1| Ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus]
 gi|74218244|dbj|BAE23760.1| unnamed protein product [Mus musculus]
          Length = 351

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 162/337 (48%), Gaps = 28/337 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  V  +++ +L   S    + P++Y   W  Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++     S   T G +           
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----------V 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------- 240

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           +L  K  + + R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 241 YLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 301 KIFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|42544136|ref|NP_056528.2| ribonucleoside-diphosphate reductase subunit M2 B isoform 1 [Homo
           sapiens]
 gi|114621161|ref|XP_001153916.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B
           isoform 2 [Pan troglodytes]
 gi|74727333|sp|Q7LG56|RIR2B_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|261278726|pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2
 gi|261278727|pdb|3HF1|B Chain B, Crystal Structure Of Human P53r2
 gi|7229086|dbj|BAA92434.1| ribonucleotide reductase [Homo sapiens]
 gi|7229115|dbj|BAA92493.1| ribonucleotide reductase [Homo sapiens]
 gi|45259569|dbj|BAD12267.1| p53-inducible ribonucleotide reductase small subunit 2 [Homo
           sapiens]
 gi|52545612|emb|CAB70703.2| hypothetical protein [Homo sapiens]
 gi|63055293|gb|AAY29059.1| ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|80473666|gb|AAI08262.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|109659128|gb|AAI17497.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|119612247|gb|EAW91841.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_b [Homo
           sapiens]
 gi|120660296|gb|AAI30629.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|190689549|gb|ACE86549.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|190690911|gb|ACE87230.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|261859014|dbj|BAI46029.1| ribonucleotide reductase M2 B [synthetic construct]
 gi|313882916|gb|ADR82944.1| ribonucleotide reductase M2 B (TP53 inducible) [synthetic
           construct]
          Length = 351

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 165/343 (48%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 18  SSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPH 77

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VH
Sbjct: 78  W---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVH 134

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +     
Sbjct: 135 SEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----- 186

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
                 V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 187 -----VVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ- 240

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R  
Sbjct: 241 ------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLL 294

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 295 VELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|296227440|ref|XP_002759377.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           isoform 1 [Callithrix jacchus]
          Length = 351

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 164/343 (47%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 18  SSADTNENEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPH 77

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VH
Sbjct: 78  W---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVH 134

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +     
Sbjct: 135 SEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----- 186

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
                 V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 187 -----VVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ- 240

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R  
Sbjct: 241 ------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLL 294

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G    F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 295 VELGFSKFFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|315635423|ref|ZP_07890689.1| ribonucleotide-diphosphate reductase beta subunit [Arcobacter
           butzleri JV22]
 gi|315480181|gb|EFU70848.1| ribonucleotide-diphosphate reductase beta subunit [Arcobacter
           butzleri JV22]
          Length = 339

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/349 (27%), Positives = 176/349 (50%), Gaps = 18/349 (5%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSD-VNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           M   T  +P    + + +++D+R+    SD +     +KY WA   + +   N W P EV
Sbjct: 1   MERKTNYNP----DSKESLNDRRVFGGNSDGMINFTRMKYQWALNLWDTMEANTWFPREV 56

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            M  D   +K    LT  E+ M    L      +SL  NN++  I  +++ PE    L R
Sbjct: 57  QMTGDAKDYKF---LTPAEKRMYDLVLSQLIFMDSLQTNNLMDNINPYITAPEINACLAR 113

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           Q++EEA HS ++  ++ S+  +   +++M++    +  K  +  +  + LS      G  
Sbjct: 114 QSYEEANHSKSYAVMVESISDNTDLIYDMWKNDAKLREKNTYIAEVYKNLS------GDI 167

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           D D++ +  LF   ++ EG++FY GFA I +LG++ KM+G ++  ++I RDE  HL    
Sbjct: 168 D-DRKIVLALFANQIL-EGLYFYAGFAAIYALGKSGKMLGSSQMIRFIQRDEVTHLLLFQ 225

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           ++IN ++ E P L+T+E ++  R M  +A  LE ++         +G       QY++++
Sbjct: 226 NMINSVRKERPDLFTQELEETVRAMFRKAVDLEASWGAYITQGQILGFTDGIIRQYIEYL 285

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           A+RR   +G +  +   ++P PW+        ++ NFFE  V  Y +G+
Sbjct: 286 ADRRLEAVGYKAEYG-VKHPIPWVDGYASFNDQRTNFFEGNVVNYSKGS 333


>gi|7023557|dbj|BAA92005.1| unnamed protein product [Homo sapiens]
          Length = 351

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 165/343 (48%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 18  SSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPH 77

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VH
Sbjct: 78  W---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVH 134

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +     
Sbjct: 135 SEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----- 186

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
                 V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 187 -----VVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ- 240

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R  
Sbjct: 241 ------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGVNCILMKQYIEFVADRLL 294

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 295 VELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|197101489|ref|NP_001125944.1| ribonucleoside-diphosphate reductase subunit M2 B [Pongo abelii]
 gi|75041724|sp|Q5R9G0|RIR2B_PONAB RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|55729743|emb|CAH91600.1| hypothetical protein [Pongo abelii]
          Length = 351

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 165/343 (48%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 18  SSSDTNENEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPH 77

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VH
Sbjct: 78  W---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVH 134

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +     
Sbjct: 135 SEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----- 186

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
                 V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 187 -----VVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ- 240

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R  
Sbjct: 241 ------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLL 294

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 295 VELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|291336894|gb|ADD96423.1| hypothetical protein [uncultured organism MedDCM-OCT-S09-C426]
          Length = 147

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 99/145 (68%)

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +L+LGR NK+ G+++Q +Y +RDESLH+NFG  +IN +K + P +WTK+F++++   + +
Sbjct: 2   LLALGRQNKLPGLSDQIRYTLRDESLHINFGTYLINTLKEQYPTIWTKKFEEETIEHIKK 61

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A  LEI YAH+ +P+G +GLNA     YM +I NRR   IGL+  F+   NPFPW+SEV+
Sbjct: 62  AVQLEINYAHDVLPRGILGLNADMFVDYMHYIGNRRLEGIGLDYRFESDTNPFPWLSEVV 121

Query: 328 DLKKEKNFFETRVTEYQQGAELKWD 352
           D     NFFE +V +YQ    L+ D
Sbjct: 122 DTGAMTNFFERKVKDYQNSGVLEDD 146


>gi|239502693|ref|ZP_04662003.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB900]
          Length = 309

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/320 (31%), Positives = 166/320 (51%), Gaps = 19/320 (5%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P+K+ WA        NN W P  V M DD+A   S N L   +R M  + L F ++ + +
Sbjct: 5   PMKHTWAKGILDRMENNTWFPHVVNMADDVA---SYNRLNAADRFMFDKALAFLSNLDGI 61

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSI 155
             NNI   I +H+++PE    L RQA+EEA+H  ++  II ++ LD   ++  +     +
Sbjct: 62  QFNNINQNIAKHVTSPEVSMCLSRQAWEEALHVKSYATIIETVSLDPMSVYMTFERDGLL 121

Query: 156 TAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRAN 215
             K  + L+ ++ L       G K + + F     V  V+ EG++F++GF     L    
Sbjct: 122 AQKNQFILKQSRLL-------GEKFSAEGFALSC-VSNVLLEGVYFFSGFLSFYLLADKG 173

Query: 216 KMVGIAEQYQYIMRD-ESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
           +M+G A+  +YI RD E  HL+    +++ ++ EN  ++T+ F  K+  +   ++ +EI+
Sbjct: 174 EMLGSADMIRYIQRDEEGTHLDLFAHMLDTLRHENKDVFTQSFWNKALEVFLTSSEMEIS 233

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY--TENPFPWMSEVIDLK-K 331
           +  + + KG    N  + E Y++ +AN R  QI   P   Y   +NPFPW+ +       
Sbjct: 234 WG-KYITKGVT--NPKAIEDYIKHLANLRAEQIQ-APFVPYPGVKNPFPWVEQFSKPNTS 289

Query: 332 EKNFFETRVTEYQQGAELKW 351
           EKNFFETRVT+Y+ G  L W
Sbjct: 290 EKNFFETRVTDYKVGGALVW 309


>gi|116191729|ref|XP_001221677.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
 gi|88181495|gb|EAQ88963.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
          Length = 409

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 155/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W +K  + DDE+  I   L FFA+S+
Sbjct: 88  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNK--INDDEKYFISHILAFFAASD 145

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 146 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPAQRTHLFNAID 205

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P+I  KA+WAL++              D    F Q L  F  V EG++F   FA I  
Sbjct: 206 TIPAIRKKADWALRWIT------------DQKSTFAQRLVAFAAV-EGIFFSGAFASIFW 252

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  +Q    ++ +A  
Sbjct: 253 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQIIEDIIVDAVR 305

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G E +++ T NPF +M E I L 
Sbjct: 306 IEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYRST-NPFDFM-ENISLG 363

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+  
Sbjct: 364 GKTNFFEKRVGEYQKAG 380


>gi|224046583|ref|XP_002198998.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 362

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/344 (29%), Positives = 167/344 (48%), Gaps = 28/344 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S   A E   ++D++ +L        + P++Y   W+ Y  A  + W   EV +  DL 
Sbjct: 28  MSSSSAAENGSDLDEEPLLRKNHRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLP 87

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E V
Sbjct: 88  HW---NKLKADEKYFISHVLAFFAASDGIVNENLVARFSQEVQIPEARCFYGFQILIENV 144

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I +   D  +   LFN    +P +  KA+WAL++ +            D + 
Sbjct: 145 HSEMYSLLIDTYIKDPKKRDFLFNAIETMPCVKKKADWALKWIE------------DRES 192

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F + +  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 193 TFGERVVAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFH 251

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
                  +L  +  +++   ++  A  +E  +  E +P G +G+N    +QY++F+A+R 
Sbjct: 252 -------YLVNRPSEERVCEIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRL 304

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 305 LMELGFSKVFN-VENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 346


>gi|225561749|gb|EEH10029.1| ribonucleotide reductase M2 B [Ajellomyces capsulatus G186AR]
 gi|240275354|gb|EER38868.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H143]
 gi|325091193|gb|EGC44503.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H88]
          Length = 413

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/346 (29%), Positives = 162/346 (46%), Gaps = 35/346 (10%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TG+  ++A E  +  +  R +        L PLKY   W+ Y  A  + W   E+ +  D
Sbjct: 70  TGVKALEADEPLLQENPNRFV--------LFPLKYHEIWQMYKKAEASFWTAEEIDLSKD 121

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           L  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E
Sbjct: 122 LHDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQIMME 179

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ +            D 
Sbjct: 180 NIHSETYSLLIDTYIKEPKQRTYLFDAIETIPCIRKKADWAIRWIE------------DK 227

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           D  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 228 DSTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLL 286

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
            +       HL  +   +    ++ EA  +E  +  + +P   +G+NA    QY++F+A+
Sbjct: 287 FS-------HLRHRPSPEAVEKIITEAVTIEQEFLSDALPVALLGMNAKLMCQYIEFVAD 339

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           R    +G + ++  T NPF +M   I L  + NFFE RV +YQ+  
Sbjct: 340 RLLVALGNKKVYNST-NPFDFMDN-ISLAGKTNFFEKRVGDYQKAG 383


>gi|157736292|ref|YP_001488975.1| ribonucleotide-diphosphate reductase subunit beta [Arcobacter
           butzleri RM4018]
 gi|157698146|gb|ABV66306.1| ribonucleoside-diphosphate reductase, beta chain [Arcobacter
           butzleri RM4018]
          Length = 339

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 171/336 (50%), Gaps = 14/336 (4%)

Query: 14  EKRVNVDDKRMLNARSD-VNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           + + +++D+R+    SD +     +KY WA   + +   N W P EV M  D   +K   
Sbjct: 10  DSKESLNDRRVFGGNSDGMINFTRMKYQWALNLWDTMEANTWFPREVQMTGDAKDYKF-- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT  E+ M    L      +SL  NN++  I  +++ PE    L RQ++EEA HS ++ 
Sbjct: 68  -LTPAEKRMYDLVLSQLIFMDSLQTNNLMDNINPYITAPEINACLARQSYEEANHSKSYA 126

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            ++ S+  +   +++M++    +  K  +  +  + LS      G  D D++ +  LF  
Sbjct: 127 VMVESISDNTDLIYDMWKNDAKLREKNTYIAEVYKNLS------GDID-DRKIVLALFAN 179

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
            ++ EG++FY GFA I +LG++ KM+G ++  ++I RDE  HL    ++IN ++ E P L
Sbjct: 180 QIL-EGLYFYAGFAAIYALGKSGKMLGSSQMIRFIQRDEVTHLLLFQNMINSVRKERPDL 238

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           +T E ++  R M  +A  LE ++         +G       QY++++A+RR   +G +  
Sbjct: 239 FTSELEETVRAMFRKAVDLEASWGAYITQGQILGFTDGIIRQYIEYLADRRLEAVGYKAE 298

Query: 313 FKYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGA 347
           +   ++P PW+        ++ NFFE  V  Y +G+
Sbjct: 299 YG-VKHPIPWVDGYASFNDQRTNFFEGNVVNYSKGS 333


>gi|239947951|ref|ZP_04699704.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922227|gb|EER22251.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 327

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 161/319 (50%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA+E + +    HW+P EVP+ DD+  WK    LT  E+ ++ +   FF  ++ +
Sbjct: 12  PFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWKY--NLTPGEKHLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++ + +  
Sbjct: 69  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YSAFLKYK 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              D  ++    L VF    EG+  +  FA +L+  R
Sbjct: 127 EMKDKYDYMQQFGV------------DTKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +     IENP +WT+  +++      T++H E 
Sbjct: 175 FNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVIENPEVWTETLRKRIYEACTTIVHFED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 235 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 291 GVEHTNFFENRATEYSKAA 309


>gi|225010999|ref|ZP_03701465.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
 gi|225004906|gb|EEG42862.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
          Length = 328

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 163/334 (48%), Gaps = 32/334 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+K+   W W K   AC   W   E+ + +DL  W +K  L +DER  
Sbjct: 8   ILTENPDRFVIFPIKHDDLWEWYKKCEAC--FWTAEEIDLSEDLNDWNNK--LNEDERYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  VKHILAFFAASDGIVNENLAENFVSEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++ +   SPSF            + L  F  V EG
Sbjct: 124 EKEKNKLFKALENFPAIKEKADWALKWIE---SPSFA-----------ERLIAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H ++       + + N HL  K  +
Sbjct: 169 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYA------VHLHNHHLINKVPK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            + R +L +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E  +  + N
Sbjct: 223 ARIREILVDALNIERTFITESLPASLIGMNAKLMTQYLEFVTDRLLVELQCEKEYNVS-N 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M ++I L+ + NFFE RV+EYQ+   L  D
Sbjct: 282 PFDFM-DMISLQGKTNFFEKRVSEYQKAGVLNKD 314


>gi|217034470|ref|ZP_03439882.1| hypothetical protein HP9810_890g15 [Helicobacter pylori 98-10]
 gi|216943072|gb|EEC22549.1| hypothetical protein HP9810_890g15 [Helicobacter pylori 98-10]
 gi|317177841|dbj|BAJ55630.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F16]
          Length = 341

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 SLWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|108563454|ref|YP_627770.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori HPAG1]
 gi|107837227|gb|ABF85096.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori HPAG1]
          Length = 341

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKVLFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|149721713|ref|XP_001493623.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) [Equus
           caballus]
          Length = 351

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/338 (30%), Positives = 162/338 (47%), Gaps = 28/338 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
            E     +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N
Sbjct: 23  NENEAKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---N 79

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  + 
Sbjct: 80  KLTSDEKYFISHVLAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYS 139

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  +   LFN    +P +  KA+WALQ+     S   T G +          
Sbjct: 140 LLIDTYIRDPKKREFLFNAIETMPYVKKKADWALQWIADRKS---TFGER---------- 186

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +        
Sbjct: 187 VVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------ 240

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
            +L  K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G 
Sbjct: 241 -YLVNKPSEERVREIIVNAVEIEQEFLTEALPVDLIGMNCVLMKQYIEFVADRLLVELGF 299

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 300 SKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|261839822|gb|ACX99587.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori 52]
          Length = 341

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKVLFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|317009697|gb|ADU80277.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori India7]
          Length = 341

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 167/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSVEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            + +K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKSKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|326792202|ref|YP_004310023.1| ribonucleotide reductase [Clostridium lentocellum DSM 5427]
 gi|326542966|gb|ADZ84825.1| ribonucleotide reductase [Clostridium lentocellum DSM 5427]
          Length = 342

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 168/321 (52%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA   Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWAQTLYRTMLNNFWIPEEIALNEDV---KGFPFLTDGERHAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++ PE    L  QAF+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-HLSRYITAPEVASLLNIQAFQEEIHAQSYSYILDTVTNPVTRDKIYDQWREDEE 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P+        D+ FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLKRNRFIADIYERFNEEPN--------DKNFLRAIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K ENP L+T+   ++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEITHLVVFQNIIKELKKENPELFTESMIEEFREMMRVGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
           A+         +G+N    + Y+++++N+R   IGLE L+ + T +P  W+     L   
Sbjct: 259 AWGQYVTANEIMGINDQLIDAYIKYLSNQRLKAIGLEELYPEITTHPMAWIDSFSKLNNT 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|288817346|ref|YP_003431693.1| ribonucleotide reductase beta subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|288786745|dbj|BAI68492.1| ribonucleotide reductase beta subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|308750953|gb|ADO44436.1| ribonucleotide reductase [Hydrogenobacter thermophilus TK-6]
          Length = 342

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/336 (28%), Positives = 177/336 (52%), Gaps = 18/336 (5%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLS-ACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           K +    +++ +L  +KY WA++ Y +    N W+P E+PM +D   ++    L+  E+ 
Sbjct: 19  KVIFGNPTNIMELNNVKYQWAFDLYKTMGFTNFWVPEEIPMHEDKKQYEK--DLSPYEKR 76

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
             +  L F  + +S   N ++    R+++ PE    L  Q F+EA+HS+++Q+I+ S+  
Sbjct: 77  AYEMVLSFLIALDSYQVN-MLKEFARYITAPELVMALTSQEFQEALHSYSYQFILESVVE 135

Query: 141 DE--GELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
            +   E++N +R+   +  +     Q Y + +  P+        ++ F++  F  YV+ E
Sbjct: 136 PQVADEIYNYWRQDTVLMERNQVIAQLYNEFIRHPT--------EENFIKATFGNYVL-E 186

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
            ++FY+GFA   +LGR  KM    +Q +YI RDE  H+    ++I  IK ENP L+T E 
Sbjct: 187 SLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELTHVTLFRNIIQTIKQENPELFTPEL 246

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYT 316
           ++        AT  EI +         +G+N    ++Y++++AN R  Q+G +PL+ + T
Sbjct: 247 EKWVYEFFKYATDAEIKWGQYVTQNQILGINNTLIDRYIKYLANLRLTQLGYKPLYPEIT 306

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAELKW 351
           ENP  W+ +   +   K +FF+ +   Y + +ELKW
Sbjct: 307 ENPMKWIDQFRTINDTKTDFFQAKPQTYAKRSELKW 342


>gi|255711354|ref|XP_002551960.1| KLTH0B03938p [Lachancea thermotolerans]
 gi|238933338|emb|CAR21522.1| KLTH0B03938p [Lachancea thermotolerans]
          Length = 403

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 151/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N + ++ER  I R + FFA+S+
Sbjct: 90  LFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLHDWN--NRMNENERFFISRVIAFFAASD 147

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      + +PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 148 GIVNENLVENFSAEVQSPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESDFLFNAIE 207

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA WA+++ Q            D D  F + L  F  V EG++F   FA I  
Sbjct: 208 TIPQIKEKAEWAIRWIQ------------DEDALFAERLVAFAAV-EGVFFSGSFAAIFW 254

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         HL  K        ++ EA  
Sbjct: 255 LKKKGLMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIIERIITEAVE 307

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M E I L 
Sbjct: 308 IEQRYFRDALPVSLLGMNADLMNQYVEFVADRLLVALGNQKFYNVT-NPFDFM-ENISLA 365

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 366 GKTNFFEKRVSDYQKAG 382


>gi|312889900|ref|ZP_07749444.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
 gi|311297432|gb|EFQ74557.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
          Length = 343

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/355 (29%), Positives = 166/355 (46%), Gaps = 36/355 (10%)

Query: 7   LSPIQAGEKRVNV------DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           LS I    K+VN       +++ +L    D   +LP+ Y   WE Y     + W   E+ 
Sbjct: 4   LSAINTKYKKVNTVTRMSQENELLLRENKDRFVILPINYPQIWEMYKKHEASFWTAEEID 63

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           + DD+  W   N L D ER  I   L FFA+S+ +V  N+ +     +  PE R +   Q
Sbjct: 64  LSDDMKDW---NNLNDGERHFISHILAFFAASDGIVNENLAVNFMSEVQLPEARCFYGFQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS T+  +I +   D  E   LF+    VP +  K  WAL++ +         G
Sbjct: 121 IMMENIHSETYALLIDTYIKDTTEKNRLFHAIETVPCVKKKGEWALKWIE--------NG 172

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
           T      F + L  F  V EG++F   F  I  L +   M G+    + I RDE +H  F
Sbjct: 173 T------FAERLVAFAAV-EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCEF 225

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              + + +         K  ++   T++ +A  +E  +  + +P   +G+NA    QY++
Sbjct: 226 ACLLYSMLS-------NKLSKEAVTTIIADAVEIEKEFVTDALPVNLIGMNAKLMSQYIE 278

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F+A+R   ++G + L+  T NPF +M E+I L+ + NFFE RV +YQ+   L  D
Sbjct: 279 FVADRWLQELGYDKLYHAT-NPFDFM-EMISLQGKTNFFEKRVGDYQKSGVLNND 331


>gi|75076588|sp|Q4R741|RIR2B_MACFA RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|67969468|dbj|BAE01083.1| unnamed protein product [Macaca fascicularis]
          Length = 351

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 165/343 (48%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           S     +  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 18  SSSDTNDNEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPH 77

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VH
Sbjct: 78  W---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVH 134

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +     
Sbjct: 135 SEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----- 186

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
                 V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 187 -----VVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ- 240

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 +L  K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R  
Sbjct: 241 ------YLVNKPSEERVREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLL 294

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 295 VELGFSKIFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|281200507|gb|EFA74725.1| ribonucleotide reductase small subunit [Polysphondylium pallidum
           PN500]
          Length = 335

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 162/332 (48%), Gaps = 32/332 (9%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   L P+KY   W+ Y  A  + W   E+ +  D+  W++K  L D+ER  I 
Sbjct: 9   ILKENKDRFVLFPIKYADIWQMYKKAEASFWTAEEIDLAGDIGDWENK--LNDNERHFIT 66

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD-- 141
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   D  
Sbjct: 67  NVLAFFAASDGIVNENLATKFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDTYIKDSE 126

Query: 142 -EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
            +  +F+    +P++  KA+WAL++     S             F + L  F  V EG++
Sbjct: 127 TKRNIFHAIDTIPAVKKKADWALRWISNSKS-------------FAERLVAFAAV-EGIF 172

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI--KIENPHLWTKEFQ 258
           F   F  I  L +   M G+    + I RDE LH +F   +  ++  K++N  +      
Sbjct: 173 FSGSFCSIFWLKKRGLMHGLTFSNELISRDEGLHCDFACLLYQKLQNKLDNNTI------ 226

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
               T++ +A   E  +  E++P   +G+N+ S  QY++F A+R    +G + ++  + N
Sbjct: 227 ---ETIIRDAVACEKEFITESLPVDLIGMNSRSMSQYIEFCADRLLLSLGYKKIYN-SSN 282

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF WM E+I L+++ NFFE +V+EYQ+    K
Sbjct: 283 PFDWM-EMISLQRKTNFFEGKVSEYQKSGVAK 313


>gi|168186576|ref|ZP_02621211.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum C str. Eklund]
 gi|169295422|gb|EDS77555.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum C str. Eklund]
          Length = 342

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 168/320 (52%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA E Y +  NN W+P E+ + +D+   K  + LTD ER    + + F    +S+ 
Sbjct: 32  IKYNWANELYRNMLNNFWIPEEISLNEDV---KQFSYLTDGERNAFDKIISFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++ PE    L  QAF+E +H+ ++ YI+ ++   +   ++++ +RE  +
Sbjct: 89  SENLP-NISRYITAPEVSSILNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDKN 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  +    T       + FL+ +   Y++ EG++FY+GF+   +L R 
Sbjct: 148 LLERNKFIAGIYQRFNENPTT-------ENFLRTIMANYIL-EGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I ++K EN  ++T+   ++ R M+      EI 
Sbjct: 200 GKMTATSTIFKYINRDEITHLILFQNIIKELKNENLDIFTESIIEEFRMMMKTGVEHEIK 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +G+N    E+Y+++++N R + IGLE L+ + TE+P  W+     L   K
Sbjct: 260 WGQYVTNNEILGINNNLIEKYIKYLSNLRLNAIGLEVLYPEITEHPMEWIENFSKLNNTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|330804590|ref|XP_003290276.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
 gi|325079602|gb|EGC33194.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
          Length = 335

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 157/327 (48%), Gaps = 32/327 (9%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   L P+KY   W  Y  A  + W   E+ +  DL  W SK  L D+ER  I 
Sbjct: 9   ILKENKDRFVLFPIKYPDIWSMYKQAEASFWTAEEIDLAPDLNDWSSK--LNDNERHFIS 66

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD-- 141
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   D  
Sbjct: 67  NVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDTYIKDNE 126

Query: 142 -EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
            + +LFN    +P I  KA+WAL++     S             F + L  F  V EG++
Sbjct: 127 QKSKLFNAIDTIPCIKKKADWALKWINNSDS-------------FAERLVAFAAV-EGIF 172

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI--KIENPHLWTKEFQ 258
           F   F  I  L +   M G+    + I RDE LH NF   +  ++  K+E+  L      
Sbjct: 173 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCNFACLLYTKLINKLESKTL------ 226

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
                ++ +A + E  +  +++P   +G+N+ S  QY++F A+R    +G + ++  + N
Sbjct: 227 ---EAIIRDAVVCEKEFICDSLPVDLIGMNSRSMSQYIEFCADRLLVSLGYKKIYNAS-N 282

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           PF WM E+I L+++ NFFE +V EY +
Sbjct: 283 PFDWM-EMISLQRKTNFFEGKVAEYAK 308


>gi|73974202|ref|XP_858105.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 4 [Canis familiaris]
          Length = 374

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 169/353 (47%), Gaps = 37/353 (10%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  V  D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEVKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +   S   T G +           
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIEDRKS---TFGER----------V 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG-------IDVIN 243
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F        ++  +
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPS 247

Query: 244 QIKIENPHLWTKEFQQKSRT--MLHEATLLEIA-------YAHETMPKGFVGLNAPSCEQ 294
           + ++    +   E +Q SR   M+  +  LEIA       +  E +P G +G+N    +Q
Sbjct: 248 EERVREIIVNAVEIEQVSREAYMISTSLFLEIATCRSKHEFLTEALPVGLIGMNCVLMKQ 307

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           Y++F+A+R   ++G   +F+  ENPF +M E I L+ + NFFE RV EYQ+ A
Sbjct: 308 YIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVAEYQRFA 358


>gi|194673004|ref|XP_607398.4| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|297482473|ref|XP_002692807.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Bos
           taurus]
 gi|296480530|gb|DAA22645.1| ribonucleotide reductase M2 polypeptide-like [Bos taurus]
          Length = 351

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 162/337 (48%), Gaps = 28/337 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKKAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++     S   T G +           
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER----------V 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------- 240

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           +L  K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 241 YLVNKPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLTELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 301 KVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|317182342|dbj|BAJ60126.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F57]
          Length = 341

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 166/316 (52%), Gaps = 15/316 (4%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L  +KY WA   + +   N W   EV M DD    +    L+ +E++   R L      +
Sbjct: 33  LNKIKYQWADHLWKTMLANTWFAEEVSMNDDK---RDYLKLSAEEKIGYDRALAQLIFMD 89

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           SL  NN++  +   +++PE    L+RQA+EEA+HSH +  ++ S+  +  E+++M+R   
Sbjct: 90  SLQTNNLIDNVNPFITSPEINLCLVRQAYEEALHSHAYAVMVESISANTEEIYDMWRNDM 149

Query: 154 SITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
            +  K ++  Q Y +   +P+        ++  L+ LF   ++ EG++FY+GF+   +L 
Sbjct: 150 QLKNKNDYIAQVYMELAKNPT--------EENILKALFANQIL-EGIYFYSGFSYFYTLA 200

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           R+ KM+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E
Sbjct: 201 RSGKMLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIE 260

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
             +         +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       ++
Sbjct: 261 ALWGDYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQ 319

Query: 333 K-NFFETRVTEYQQGA 347
           + NFFE RV+ Y +G+
Sbjct: 320 RSNFFEARVSNYAKGS 335


>gi|291220709|ref|XP_002730368.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 402

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 103/347 (29%), Positives = 164/347 (47%), Gaps = 31/347 (8%)

Query: 5   TGLSPIQAGEKRV---NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T + P++  +++    N +D+ +L        + P+KY   W+ Y  A  + W   EV +
Sbjct: 63  TDVEPVKLEKRKSKPQNNEDEPLLRDNPRRFVIFPIKYHDIWQMYKKAEASFWTAEEVDL 122

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DLA W S   L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q 
Sbjct: 123 SKDLAHWAS---LKDDERHFISHVLAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQI 179

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS  +  +I +   D  E   LFN    +P +  KA WAL +             
Sbjct: 180 AIENIHSEMYSLLIDTYIRDPQEREYLFNAIETLPPVKRKAQWALNWI------------ 227

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            +AD     +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 228 -NADNATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA 286

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + +       HL  K  QQ+   ++ +A  +E  +  + +P   +G+N    +QY++F
Sbjct: 287 CLMFS-------HLTNKPSQQRIIEIIRDAVKIEQEFLTDALPVSLIGMNKDLMKQYIEF 339

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +A+R    +G   ++   ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 340 VADRLLLDLGCNKIYN-KENPFDFM-ENISLEGKTNFFEKRVGEYQK 384


>gi|298207002|ref|YP_003715181.1| probable ribonucleoside-diphosphate reductase small chain
           [Croceibacter atlanticus HTCC2559]
 gi|83849636|gb|EAP87504.1| probable ribonucleoside-diphosphate reductase small chain
           [Croceibacter atlanticus HTCC2559]
          Length = 325

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 96/324 (29%), Positives = 161/324 (49%), Gaps = 32/324 (9%)

Query: 34  LLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           + P+++   W W K + AC   W   E+ +  DL  W SK  L DDER  IK  L FFA+
Sbjct: 17  IFPIQHNDIWEWYKKMEAC--FWTAEEIDLHQDLTDWNSK--LNDDERYFIKHILAFFAA 72

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYRE 151
           S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE E   ++R 
Sbjct: 73  SDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDEAEKDQLFRA 132

Query: 152 V---PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQI 208
           +   P+I  KA+WAL++ ++ S              F + L  F  V EG++F   F  I
Sbjct: 133 IEVFPAIKKKADWALKWIESDS--------------FAERLIAFAAV-EGIFFSGAFCSI 177

Query: 209 LSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEA 268
             L +   M G+    + I RDE +H +F       + + N HL  K  +++ R ++ +A
Sbjct: 178 FWLKKRGLMPGLTFSNELISRDEGMHCDFA------VHLHNKHLVNKVSKERIREIIVDA 231

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E  +  E++P   +G+N+    QY++F+ +R   ++  E  +  T NPF +M ++I 
Sbjct: 232 LNIEREFITESLPASLIGMNSNLMTQYLEFVTDRLLLELECEKEYN-TANPFDFM-DMIS 289

Query: 329 LKKEKNFFETRVTEYQQGAELKWD 352
           L+ + NFFE RV +YQ+   +  D
Sbjct: 290 LQGKTNFFEKRVGDYQKAGVMDQD 313


>gi|254586079|ref|XP_002498607.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
 gi|238941501|emb|CAR29674.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
          Length = 412

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 148/317 (46%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W +K  +++ ER  I R L FFA+S+
Sbjct: 101 LFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLDDWNNK--MSEGERYFISRVLAFFAASD 158

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 159 GIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYSRDTEESEFLFNAIE 218

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA WA+++ Q              D     +  V +   EG++F   FA I  
Sbjct: 219 NIPPIKEKAEWAIRWIQD-------------DTALYAERLVAFAAVEGVFFSGSFAAIFW 265

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         HL  +        ++ EA  
Sbjct: 266 LKKKGLMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNRPSPDIVERIITEAVS 318

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  + +P   +G+NA    QY++F+A+R    +G E  +  T NPF +M E I L 
Sbjct: 319 IEKRYFEDALPVALLGMNAALMNQYVEFVADRLLVALGNEKYYNVT-NPFDFM-ENISLA 376

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 377 GKTNFFEKRVSDYQKAG 393


>gi|88607783|ref|YP_505152.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           phagocytophilum HZ]
 gi|88598846|gb|ABD44316.1| ribonucleoside-diphosphate reductase, beta subunit [Anaplasma
           phagocytophilum HZ]
          Length = 323

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 160/315 (50%), Gaps = 17/315 (5%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+   L++ E+ ++ +   FF  ++ +
Sbjct: 12  PFDYPWAYDAWLCQQRIHWLPEEVPLADDVQDWKTM--LSEKEKNLLVQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y ++  P     ++  AF   E +H   + Y++ ++G+ E E +  + +  
Sbjct: 69  EVNNCYMKHYSNIFRP-TEICMMLSAFSNMETIHVAAYSYLLDTIGMPEVE-YQAFLKFE 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  ++ +         G K   +   + L VF    EG+  +  FA +L+  R
Sbjct: 127 VMKKKYDYMQRFEEC------RRGDK---RHVAKTLAVFGAFTEGLQLFASFAILLNFQR 177

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM G+ +   +  RDESLH +  I + N    EN  +W  + +Q+         +LE 
Sbjct: 178 FGKMKGMGQIIAWSARDESLHTDSIIRLFNTFVHENGEIWDDDLKQELYDACKVIVMLED 237

Query: 274 AYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            +       G V GL+A   ++Y++FIANRR  Q+ LEP++   ENP PW+ E+++  + 
Sbjct: 238 EFIDLAFALGDVEGLSACEVKRYIRFIANRRLKQLHLEPIYDVAENPLPWLDEILNGVEH 297

Query: 333 KNFFETRVTEYQQGA 347
            NFFE RVTEY + A
Sbjct: 298 TNFFENRVTEYARAA 312


>gi|91215505|ref|ZP_01252476.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
 gi|91186457|gb|EAS72829.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
          Length = 326

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 158/317 (49%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+ +   WE Y     + W   E+ +Q D+  WK+K  L+ DE+  IK  L FFA+S+
Sbjct: 17  LFPITHPDIWEWYKKCEASFWTAEEIDLQQDITDWKTK--LSKDEQYFIKHILAFFAASD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+       +   E + +   Q   E +HS T+  +I +   D+ E   LF    
Sbjct: 75  GIVNENLAENFVNEVQYTEAKFFYGFQIMVENIHSETYSLLIDTYVDDDKEKDLLFKAIE 134

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             P+I  KA+WALQ+ ++ S              F + L  F  V EG++F   F  I  
Sbjct: 135 NFPAIKKKADWALQWIESDS--------------FAERLIAFAAV-EGIFFSGAFCSIFW 179

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F       + + N HL  +  +++ R ++ +A  
Sbjct: 180 LKKRGLMPGLTFSNELISRDEGVHCDFA------VHLHNEHLVNQVPKERIRAIIVDALT 233

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+N+    QY++F+A+R   ++G +  +  T NPF +M ++I L+
Sbjct: 234 IEREFVTESLPVSLIGMNSNLMTQYLEFVADRLLFELGCDKEYG-TANPFDFM-DMISLQ 291

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+  
Sbjct: 292 GKTNFFEKRVGEYQKAG 308


>gi|225012154|ref|ZP_03702591.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
 gi|225003709|gb|EEG41682.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
          Length = 325

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/319 (30%), Positives = 156/319 (48%), Gaps = 28/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+K+   WE Y     + W   E+ +  DL  W +K  LT+DE+  IK  L FFA+S+
Sbjct: 17  IFPIKHHDIWEWYKKMEASFWTAEEIDLHQDLTDWNTK--LTEDEKYFIKHILAFFAASD 74

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+       +   E + +   Q   E +HS T+  +I +   D+ E   LF    
Sbjct: 75  GIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKDDVEKDRLFKAIE 134

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             P+I  KA+WAL++  + S              F + L  F  V EG++F   F  I  
Sbjct: 135 VFPAIKKKADWALRWIDSDS--------------FAERLIAFAAV-EGIFFSGAFCSIYW 179

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F +       + N HL  K    + + +L +A  
Sbjct: 180 LKKRGLMPGLTFSNELISRDEGVHCDFAV------HLHNHHLVNKVPPARIKEILLDALT 233

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+NA    QY++F+ +R   ++GLE  F  T NPF +M ++I L+
Sbjct: 234 IEREFITESLPISLIGMNAKLMTQYLEFVTDRLLQELGLEKEFNVT-NPFDFM-DMISLQ 291

Query: 331 KEKNFFETRVTEYQQGAEL 349
            + NFFE RV EYQ+   L
Sbjct: 292 GKTNFFEKRVGEYQKAGVL 310


>gi|324519017|gb|ADY47264.1| Ribonucleoside-diphosphate reductase small chain [Ascaris suum]
          Length = 376

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 156/322 (48%), Gaps = 28/322 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+KY   W+ Y  A  + W   EV +  D   W++   L+D ER  I R L FFA+S+
Sbjct: 69  IFPIKYHDIWDFYKRAVASFWTVEEVDLSKDYQHWEN---LSDGERFFISRVLAFFAASD 125

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E +HS  +  ++ +   D+ E   LFN   
Sbjct: 126 GIVNENLVERFAQEVQVPEARFFYGFQIMIENIHSEMYSKMVETYIRDDNERKKLFNAIN 185

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
           E   I  KA+WAL++     +P            + + L  F  V EG++F   FA I  
Sbjct: 186 EFEFIKKKADWALKWIADKQAP------------YAERLIAFAAV-EGIFFSGSFAAIFW 232

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  K  +++   ++ EA  
Sbjct: 233 LKKRGLMPGLTHSNELISRDEGLHRDFACLMFS-------HLKKKPNKERIYEIIREAVK 285

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  E +P G +G+N     QY++++A+    ++    L+   ENPF +M+  I ++
Sbjct: 286 IEQEYLTEALPVGLIGMNCELMSQYIEYVADHLLTELKCPKLYN-MENPFDFMAR-ISIE 343

Query: 331 KEKNFFETRVTEYQQGAELKWD 352
            + NFFE RV+EYQ+   L  D
Sbjct: 344 AKTNFFEKRVSEYQKAGVLSTD 365


>gi|330941350|gb|EGH44202.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 109

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/109 (60%), Positives = 82/109 (75%)

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR
Sbjct: 1   QIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRR 60

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 61  LSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 109


>gi|157964544|ref|YP_001499368.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           massiliae MTU5]
 gi|157844320|gb|ABV84821.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia
           massiliae MTU5]
          Length = 336

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 161/319 (50%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA+E + +    HW+P EVP+ DD+  WK    LT  E+ ++ +   FF  ++ +
Sbjct: 13  PFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWKY--NLTPGEKHLLTQIFRFFTQAD-I 69

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++ + +  
Sbjct: 70  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YSAFLKYK 127

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              DA ++    L VF    EG+  +  FA +L+  R
Sbjct: 128 EMKDKYDYMQQFGV------------DAKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 175

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E 
Sbjct: 176 FNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFED 235

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 236 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 291

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 292 GVEHTNFFENRATEYSKAA 310


>gi|91763118|ref|ZP_01265082.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717531|gb|EAS84182.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 342

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 157/320 (49%), Gaps = 30/320 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y W ++ +L+    HW+P EVP+ DD+  W+    LT  E+ ++ +   FF  ++  
Sbjct: 35  PFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQ--KNLTQSEKNLLTQIFRFFTQADVE 92

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL--FNMYREV 152
           V  N  L  Y  +  P E    +   A  E VH   + +++ ++G+ E E   F  Y+E+
Sbjct: 93  V-QNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFMKYKEM 151

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
                       Y Q     S         ++    + VF    EG+  +  FA +L+  
Sbjct: 152 KD-------KYDYMQNFDMSS--------KKDIALTVAVFSAFTEGLQLFASFAILLNFP 196

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ----QKSRTML-HE 267
           R NKM G+ +   + +RDE+LH N  I +  +   ENP +WT E +    +  RT++ HE
Sbjct: 197 RHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHE 256

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
              +++A+    M     GL A   + Y++FIANRR  Q+GLEP++   +NP  W+  ++
Sbjct: 257 DAFIDLAFEMGPMQ----GLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWLDSML 312

Query: 328 DLKKEKNFFETRVTEYQQGA 347
           +  +  NFFE R TEY + A
Sbjct: 313 NAVEHMNFFEGRSTEYSKAA 332


>gi|225432510|ref|XP_002279943.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 340

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 152/317 (47%), Gaps = 29/317 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   WE Y  A  + W   EV +  D+  W+S   L++ E+  I   L FFA+S+
Sbjct: 31  MFPIRYRQLWEMYKKAEASFWTAEEVDLSHDVQQWES---LSNSEKHFISHVLAFFAASD 87

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+       +  PE R +   Q   E +HS  +  ++ +   D  E   LFN   
Sbjct: 88  GIVLENLAARFLHDIQIPEARAFYGFQIAMENIHSEMYSLLLETYIKDSKEKHRLFNAIE 147

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +  +  KA WAL + Q+ +              F + L  F  V EG++F   F  I  
Sbjct: 148 SISCVAGKAKWALDWIQSSTL-------------FAERLIAFACV-EGIFFSGSFCAIFW 193

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + + ++ + P  W     QK   ++HEA  
Sbjct: 194 LKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLP--W-----QKVHHIVHEAVE 246

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+NA    QY++F+A+R    +G E  +   ENPF WM E I L+
Sbjct: 247 IETQFVCEALPCALIGMNATLMSQYIKFVADRLLVALGYERKYN-VENPFDWM-EFISLQ 304

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+ +
Sbjct: 305 GKANFFERRVGDYQKAS 321


>gi|31322342|gb|AAP15464.1| ribonucleotide reductase small subunit [Rickettsia rickettsii str.
           'Sheila Smith']
          Length = 336

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/325 (28%), Positives = 163/325 (50%), Gaps = 32/325 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK------SKNGLTDDERLMIKRNLGFF 89
           P  Y WA+E + +    HW+P EVP+ DD+  WK       K+ LT  E+ ++ +   FF
Sbjct: 12  PFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWKYNLTPGEKHLLTPGEKHLLTQIFRFF 71

Query: 90  ASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFN 147
             ++ +  NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++
Sbjct: 72  TQAD-IEVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YS 128

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
            + +   +  K ++  Q+              DA ++    L VF    EG+  +  FA 
Sbjct: 129 AFLKYKEMKDKYDYMQQFGV------------DAKEDIATTLAVFGAFTEGLQLFASFAI 176

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRT 263
           +L+  R NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T
Sbjct: 177 MLNFPRFNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTT 236

Query: 264 MLH-EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
           ++H E   +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW
Sbjct: 237 IVHFEDAFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPW 292

Query: 323 MSEVIDLKKEKNFFETRVTEYQQGA 347
           + E+++  +  NFFE R TEY + A
Sbjct: 293 LDEMLNGVEHTNFFENRTTEYSKAA 317


>gi|120437796|ref|YP_863482.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
 gi|117579946|emb|CAL68415.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
          Length = 325

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 99/334 (29%), Positives = 167/334 (50%), Gaps = 32/334 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+K+   W W K + AC   W   E+ + +DL+ W +K  L+ DER  
Sbjct: 7   ILQENKDRFVIFPIKHHDIWDWYKKMEAC--FWTAEEIDLHEDLSDWNNK--LSADERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   +
Sbjct: 63  LKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKN 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++ ++ S              F + L  F  V EG
Sbjct: 123 EKEKDQLFKAIEVFPAIKKKADWALKWIESDS--------------FAERLIAFAAV-EG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + NQ      HL  +  +
Sbjct: 168 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDFAVHLHNQ------HLVNQVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +K R +L +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E  +  + N
Sbjct: 222 EKIREILIDALNIEREFVTESLPVSLIGMNAKLMTQYLEFVTDRLLVELDCEKEYNVS-N 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M ++I+L+ + NFFE RV+EYQ+   +  D
Sbjct: 281 PFDFM-DMINLQGKTNFFEKRVSEYQKAGVMNKD 313


>gi|71083845|ref|YP_266565.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062958|gb|AAZ21961.1| ribonucleoside-diphosphate reductase beta chain [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 337

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 157/320 (49%), Gaps = 30/320 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y W ++ +L+    HW+P EVP+ DD+  W+    LT  E+ ++ +   FF  ++  
Sbjct: 30  PFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQ--KNLTQSEKNLLTQIFRFFTQADVE 87

Query: 96  VANNIVLAIYRHLSNP-ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL--FNMYREV 152
           V  N  L  Y  +  P E    +   A  E VH   + +++ ++G+ E E   F  Y+E+
Sbjct: 88  V-QNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAFMKYKEM 146

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
                       Y Q     S         ++    + VF    EG+  +  FA +L+  
Sbjct: 147 KD-------KYDYMQNFDMSS--------KKDIALTVAVFSAFTEGLQLFASFAILLNFP 191

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ----QKSRTML-HE 267
           R NKM G+ +   + +RDE+LH N  I +  +   ENP +WT E +    +  RT++ HE
Sbjct: 192 RHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHE 251

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
              +++A+    M     GL A   + Y++FIANRR  Q+GLEP++   +NP  W+  ++
Sbjct: 252 DAFIDLAFEMGPMQ----GLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWLDSML 307

Query: 328 DLKKEKNFFETRVTEYQQGA 347
           +  +  NFFE R TEY + A
Sbjct: 308 NAVEHMNFFEGRSTEYSKAA 327


>gi|15892574|ref|NP_360288.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           conorii str. Malish 7]
 gi|34580440|ref|ZP_00141920.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           sibirica 246]
 gi|157828524|ref|YP_001494766.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933242|ref|YP_001650031.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. Iowa]
 gi|229586746|ref|YP_002845247.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           africae ESF-5]
 gi|238650260|ref|YP_002916112.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           peacockii str. Rustic]
 gi|15619738|gb|AAL03189.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia conorii
           str. Malish 7]
 gi|28261825|gb|EAA25329.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           sibirica 246]
 gi|157801005|gb|ABV76258.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908329|gb|ABY72625.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           rickettsii str. Iowa]
 gi|228021796|gb|ACP53504.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia africae
           ESF-5]
 gi|238624358|gb|ACR47064.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           peacockii str. Rustic]
          Length = 328

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 161/319 (50%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA+E + +    HW+P EVP+ DD+  WK    LT  E+ ++ +   FF  ++ +
Sbjct: 12  PFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWKY--NLTPGEKHLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++ + +  
Sbjct: 69  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YSAFLKYK 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              DA ++    L VF    EG+  +  FA +L+  R
Sbjct: 127 EMKDKYDYMQQFGV------------DAKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E 
Sbjct: 175 FNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 235 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 291 GVEHTNFFENRTTEYSKAA 309


>gi|261189551|ref|XP_002621186.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239591422|gb|EEQ74003.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239613047|gb|EEQ90034.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis ER-3]
 gi|327356917|gb|EGE85774.1| ribonucleotide reductase M2 B [Ajellomyces dermatitidis ATCC 18188]
          Length = 413

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 102/346 (29%), Positives = 162/346 (46%), Gaps = 35/346 (10%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TG+  ++A E  +  +  R +        L PLKY   W+ Y  A  + W   E+ +  D
Sbjct: 70  TGMKALEAEEPLLQENPNRFV--------LFPLKYHEIWQMYKKAEASFWTAEEIDLSKD 121

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           L  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E
Sbjct: 122 LHDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSSEVQVPEARCFYGFQIMME 179

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ +            D 
Sbjct: 180 NIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRWIE------------DK 227

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 228 ESSFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLL 286

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
            +       HL  +   +    ++ EA  +E  +  + +P   +G+NA    QY++F+A+
Sbjct: 287 FS-------HLRHRPSPEAVERIITEAVTIEQEFLSDALPVALLGMNAKLMCQYIEFVAD 339

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           R    +G + ++  T NPF +M   I L  + NFFE RV +YQ+  
Sbjct: 340 RLLVALGNKKVYNST-NPFDFMDN-ISLAGKTNFFEKRVGDYQKAG 383


>gi|325286576|ref|YP_004262366.1| Ribonucleoside-diphosphate reductase [Cellulophaga lytica DSM 7489]
 gi|324322030|gb|ADY29495.1| Ribonucleoside-diphosphate reductase [Cellulophaga lytica DSM 7489]
          Length = 328

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/327 (29%), Positives = 161/327 (49%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P+K+   W+ Y     + W   E+ +  DL  WK+K  L DDER  IK
Sbjct: 8   ILEKNEDRFVIFPIKHNDLWDWYKKCEASFWTAEEIDLHADLDDWKNK--LNDDERYFIK 65

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   DE 
Sbjct: 66  HILAFFAASDGIVNENLAENFVSEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKDEK 125

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF+     P+I  KA+WAL++ +   SPSF            + L  F  V EG++
Sbjct: 126 EKDILFHALENFPAIRKKADWALKWIE---SPSFA-----------ERLIAFAAV-EGIF 170

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE +H ++       + + N HL  K  +++
Sbjct: 171 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYA------VHLHNHHLINKVPKER 224

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              +L +A  +E  +  E++P   +G+N+    QY++F+ +R   ++  + ++  T NPF
Sbjct: 225 ITEILVDALDIEREFITESLPVSLIGMNSKLMTQYLEFVTDRLLVELNCDKVYNST-NPF 283

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M ++I L+ + NFFE RV EYQ+  
Sbjct: 284 DFM-DMISLQGKTNFFEKRVAEYQKSG 309


>gi|313844096|ref|YP_004061759.1| hypothetical protein OlV1_126 [Ostreococcus lucimarinus virus OlV1]
 gi|312599481|gb|ADQ91503.1| hypothetical protein OlV1_126 [Ostreococcus lucimarinus virus OlV1]
          Length = 408

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/313 (30%), Positives = 156/313 (49%), Gaps = 28/313 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + PLKY   WE Y  A  ++W   EV +  DL  WK+   L ++E+  IK  L FFA S+
Sbjct: 105 VFPLKYPHLWELYKKAQMSNWTAEEVDLSKDLDDWKT---LNENEKKFIKYILAFFAGSD 161

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL---GLDEGELFNMYR 150
            +V  NI       + + E R +   Q   E VH  T+  +I      G ++ +LF   +
Sbjct: 162 GIVFENINNNFADEVQSSEARSFYAYQCHNEMVHGETYSKLIDKYIKDGAEKKQLFEAIQ 221

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            VP I  KA+WA+++  T S            + F + LF F  V EG++F   F  I  
Sbjct: 222 TVPCIQKKADWAMKWFDTKS------------RSFAERLFAFACV-EGIFFSGSFCAIYW 268

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH  F +++   ++I       K   +   +++ EA  
Sbjct: 269 LKKRGLMPGLCFSNELISRDEGLHQEFAVELFKLLRI-------KPTTETIHSIVKEAVE 321

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    +Y++++++R   QIG+ P++  ++NPF +M E I L 
Sbjct: 322 IEKGFILDALPCALIGMNSEKMSEYIEYVSDRLLKQIGVPPIWN-SKNPFDFM-ENISLD 379

Query: 331 KEKNFFETRVTEY 343
            + NFFE RV +Y
Sbjct: 380 GKTNFFEKRVGDY 392


>gi|154250961|ref|YP_001411785.1| ribonucleotide-diphosphate reductase subunit beta [Parvibaculum
           lavamentivorans DS-1]
 gi|154154911|gb|ABS62128.1| Ribonucleoside-diphosphate reductase [Parvibaculum lavamentivorans
           DS-1]
          Length = 319

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 165/319 (51%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E +L+    HW+P EVP+ DD+  W  K  LT+ ER ++ +   FF  ++  
Sbjct: 12  PFRYPWAYEAWLTQQRIHWLPEEVPLADDVKDWSKK--LTEGERNLLTQIFRFFVQADVE 69

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
           V NN  +  Y  +  P   Q +L  AF   E VH   + +++ ++G+ E E +  + +  
Sbjct: 70  V-NNCYMKHYSRVFKPTEVQMML-AAFSNIETVHISAYSHLLDTIGMPEAE-YEAFLKYE 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  ++              +   +  + L VF    EG+  +  FA +++  R
Sbjct: 127 QMKTKFDYMQEWGV------------ETKADIAKTLAVFGGFTEGVQLFASFAILMNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ----QKSRTMLH-EA 268
            NKM G+ +   +  RDE+LH    + +      ENP +WT+E +    +   T++H E 
Sbjct: 175 FNKMKGMGQIVTWSARDETLHTVSAMKLFRTFVDENPEIWTEELRRDIYKACETIIHHED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +++A+   ++     GL+A   + Y+++IA+RR  Q+ L+P+++  +NP PWM E+++
Sbjct: 235 AFIDLAFEMGSIE----GLSAQEVKNYIRYIADRRLVQLNLQPIYRTEKNPLPWMDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + +
Sbjct: 291 GIEHTNFFENRATEYSKAS 309


>gi|50545856|ref|XP_500466.1| YALI0B03630p [Yarrowia lipolytica]
 gi|49646332|emb|CAG82692.1| YALI0B03630p [Yarrowia lipolytica]
          Length = 403

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 154/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P++Y   W+ Y  A  + W   E+ +  D+  W+  N L +DER  I   L FFA+S+
Sbjct: 89  LFPIQYHEIWQMYKKAEASFWTAEEIDLGKDMGDWE--NRLNNDERFFISHVLAFFAASD 146

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 147 GIVNENLVERFSGEVQAPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKERTYLFNAIE 206

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL++              D +  F + L  F  V EG++F   FA I  
Sbjct: 207 TIPCIKKKADWALKWIS------------DEESTFGERLIAFAAV-EGIFFSGSFASIFW 253

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  
Sbjct: 254 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLENRPSKKIVEDVIVEAVG 306

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P G +G+NA    QY++F+A+R    +G   ++  T NPF +M E I L 
Sbjct: 307 IEQEFLTDALPCGLLGMNAKLMCQYIEFVADRLLVALGNSKVYNST-NPFDFM-ENISLA 364

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 365 GKTNFFEKRVSDYQKAG 381


>gi|301166951|emb|CBW26530.1| putative ribonucleoside-diphosphate reductase small chain subunit
           [Bacteriovorax marinus SJ]
          Length = 322

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 158/332 (47%), Gaps = 33/332 (9%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   L PLKY   +E Y +     W   E+    D+  W+    L  DE+  IK
Sbjct: 4   ILAPNDDRFVLFPLKYHSIFEMYKNHMAVFWTADELDFASDITDWEK---LNKDEQHFIK 60

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD-- 141
             L FFA+S+ +V  N+ L  Y  +  PE R +   Q   E +HS T+  +I +   D  
Sbjct: 61  HILAFFAASDGIVNENLALRFYNDVQIPEARCFYGFQIAMENIHSETYSLLIDTYVKDPK 120

Query: 142 -EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
            + ELF+     P +  KA+WA+++ Q+  S             F + L  F  + EG++
Sbjct: 121 EKDELFHAVTHFPFVEKKADWAMKWMQSKRS-------------FAERLIAFAAI-EGIF 166

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    ++I RDE LH  F   +          L T E Q  
Sbjct: 167 FSGSFCSIYWLKKRGLMPGLCTSNEFISRDEGLHCEFACHI--------HELLTPEEQLN 218

Query: 261 SRT---MLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
             T   ++ EA  +E  +  E +P   +G+NA    +Y++F+A+   +++G E  +  TE
Sbjct: 219 KETITQIITEAVSIEKEFITEAIPVSLIGMNADMMSRYIEFVADYWLNRLGCEKAYN-TE 277

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF WM E+I L+ + NFFE RV+EYQ+   L
Sbjct: 278 NPFDWM-ELISLEGKTNFFEKRVSEYQKPGVL 308


>gi|260061082|ref|YP_003194162.1| putative ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
 gi|88785214|gb|EAR16383.1| probable ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
          Length = 328

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 162/329 (49%), Gaps = 32/329 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+++   W W K   AC   W   E+ +  DL+ W +K  L+DDE+  
Sbjct: 8   ILKENKDRFVIFPIQHHDLWEWYKKCEAC--FWTAEEIDLHQDLSDWNNK--LSDDEKYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++   + SPSF            + L  F  V EG
Sbjct: 124 EKEKNVLFQAIENFPAIKKKADWALKW---IESPSFA-----------ERLIAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H ++       + + N HL  K  +
Sbjct: 169 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYA------VHLHNNHLVNKVPK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++  A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E ++  T N
Sbjct: 223 ERITQIITNALDIEREFITESLPVSLIGMNAKLMTQYLEFVTDRLLVELECEKVYNST-N 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           PF +M ++I L+ + NFFE RV+EYQ+  
Sbjct: 282 PFDFM-DMISLQGKTNFFEKRVSEYQKAG 309


>gi|45184688|ref|NP_982406.1| AAL136Cp [Ashbya gossypii ATCC 10895]
 gi|44980034|gb|AAS50230.1| AAL136Cp [Ashbya gossypii ATCC 10895]
          Length = 422

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 152/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  D+  W   N +T++ER  I R L FFA+S+
Sbjct: 109 LFPIKYHDIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMTENERFFISRVLAFFAASD 166

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 167 GIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEADHLFNAIE 226

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA WA+++ Q            D D  F + L  F  V EG++F   FA I  
Sbjct: 227 TIPEIKEKAEWAIRWIQ------------DKDALFAERLVAFAAV-EGIFFSGSFAAIFW 273

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         HL  K   +    ++ EA  
Sbjct: 274 LKKKGLMPGLTFSNELICRDEGLHTDFACLLF-------AHLNNKPDTEIVEKIITEAVE 326

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  + +P   +G+N+    QY++F+A+R    +G +  +  + NPF +M E I L 
Sbjct: 327 IEKRYFQDAIPVALLGMNSSLMNQYVEFVADRLLVALGNKKYYNVS-NPFDFM-ENISLA 384

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 385 GKTNFFEKRVSDYQKAG 401


>gi|226950223|ref|YP_002805314.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A2 str. Kyoto]
 gi|226843961|gb|ACO86627.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A2 str. Kyoto]
          Length = 342

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 167/321 (52%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRVIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K ENPH++T+E +++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEVTHLVLFQNIIKELKNENPHIFTEELEEEFRQMMRIGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYLEINKHPMEWIDSFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|149248382|ref|XP_001528578.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146448532|gb|EDK42920.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 422

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 153/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W+ Y  A  + W   E+ +  D+  WK+K  L ++ER  I R L FFA+S+
Sbjct: 111 MFPIRYHEIWQMYKKAEASFWTAEEIDLGKDMHDWKNK--LNENERFFISRILAFFAASD 168

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 169 GIVNENLVENFSAEVQIPEAKSFYGFQIMMENIHSETYSLLIDTYIKDPKEADFLFNAID 228

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++              + D     +  V +   EG++F   FA I  
Sbjct: 229 NIPQIKKKADWAIRWI-------------NDDNALFAERLVAFAAVEGVFFSGSFASIFW 275

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +   +    ++ EA  
Sbjct: 276 LKKRGLMPGLTFSNELICRDEGLHTDFACLLFS-------HLENRPDPKIVEKIISEAVE 328

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N     QY++F+A+R    +G E ++K T NPF +M E I L 
Sbjct: 329 IEKEFFTDALPVSLLGMNCKLMCQYVEFVADRLLVALGNEKIYKVT-NPFDFM-ENISLA 386

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 387 GKTNFFEKRVSDYQKAG 403


>gi|118087248|ref|XP_418364.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 353

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 158/317 (49%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+++   W+ Y  A  + W   EV +  DL  W   N L  DE+  I   L FFA+S+
Sbjct: 46  IFPIQHPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NKLKADEKYFISHVLAFFAASD 102

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E VHS  +  +I +   D  +   LFN   
Sbjct: 103 GIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSLLIDTYIKDPEKRDFLFNAIE 162

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL++ +            D +  F + +  F  V EG++F   FA I  
Sbjct: 163 TMPCVKKKADWALKWIE------------DRESTFGERVVAFAAV-EGIFFSGSFAAIFW 209

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       +L  +  +++ R ++  A  
Sbjct: 210 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFH-------YLVNRPSEERVREIIVNAVE 262

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P G +G+N    +QY++F+A+R   ++G   +F + ENPF +M E I L+
Sbjct: 263 IEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLMELGFSKVF-HAENPFDFM-ENISLE 320

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV+EYQ+ A
Sbjct: 321 GKTNFFEKRVSEYQRFA 337


>gi|194474072|ref|NP_001124015.1| ribonucleoside-diphosphate reductase subunit M2 B [Rattus
           norvegicus]
 gi|149066498|gb|EDM16371.1| ribonucleotide reductase M2 B (TP53 inducible) (predicted) [Rattus
           norvegicus]
          Length = 351

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 100/340 (29%), Positives = 164/340 (48%), Gaps = 28/340 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           +  E  V  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W  
Sbjct: 21  ETKENEVRSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW-- 78

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  
Sbjct: 79  -NKLKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEM 137

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   LFN    +P +  KA+WAL++     S   T G +        
Sbjct: 138 YSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKS---TFGER-------- 186

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
              V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +      
Sbjct: 187 --VVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ---- 240

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
              +L  K  +++   ++ +A  +E  +  E +P G +G+N    +QY++F+A+R   ++
Sbjct: 241 ---YLVNKPSEERVMEIIVDAVKIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGEL 297

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 298 GFSKIFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|150015087|ref|YP_001307341.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           beijerinckii NCIMB 8052]
 gi|149901552|gb|ABR32385.1| Ribonucleoside-diphosphate reductase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 344

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 100/338 (29%), Positives = 173/338 (51%), Gaps = 21/338 (6%)

Query: 19  VDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +  KR++N  + ++N    +KY W  + Y    NN W+P EV +  DL   K    L ++
Sbjct: 17  ISKKRIINGNTTNLNDFNNMKYSWVSDWYRQGMNNFWIPEEVNLSQDL---KDYQNLLEE 73

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER+   + L F    +S+   N+   I  +++  E    L  Q+F+EAVHS ++ Y++ S
Sbjct: 74  ERIAYDKILSFLIFLDSIQTANLS-NINNYITASEINLCLTIQSFQEAVHSQSYSYMLDS 132

Query: 138 LGLDE--GELFNMYREVPSITAKANWALQ--YTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   E   E+   +++   I  K N  +   Y + + +P+        +   L+ L   Y
Sbjct: 133 ICSPEKRNEILYQWKD-DDILLKRNKFIGDLYNEFIENPT--------EYNLLRTLMANY 183

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF    +L R  KM G A++ +YI RDE+ HL    ++I +++ ENP L+
Sbjct: 184 IL-EGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNIIKELQNENPELF 242

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T+E + + R M+      EI + H  +     G+N    E Y++++ N+R  +I L PLF
Sbjct: 243 TEEVKNELRNMMKIGVEQEILWGHYVIGDKIQGINKQLIENYIKYLGNKRLKEINLSPLF 302

Query: 314 KYTE-NPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
           K  + NP  W+  + +    K +FFE R T Y +   L
Sbjct: 303 KEQDKNPASWVDTLSNANSVKTDFFEARSTAYAKVTTL 340


>gi|189199548|ref|XP_001936111.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187983210|gb|EDU48698.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 410

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 161/349 (46%), Gaps = 27/349 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A++  + P  A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 52  ADDEEVKPTVAPTIKPEEADEPLLQENPGRFVLFPIKYHDVWQMYKKAEASFWTAEEIDL 111

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W  +  L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 112 SKDLHDWNKR--LNDDERFFISHVLAFFAASDGIVNENLVERFSSEVQIPEARCFYGFQI 169

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS T+  +I +   D  +   LFN    +P I  KA+WAL++             
Sbjct: 170 MMENVHSETYSLLIDTYISDTRQRKYLFNAIENIPCIRKKADWALRWIS----------- 218

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F   L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F 
Sbjct: 219 -DKNSTFANRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFA 276

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         +   ++ R ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 277 CLLFSLLN-------NRPSNEEVRAIITEAVEIEQEFLSDALPCALLGMNATLMCQYIEF 329

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           +A+R    +G   ++  T NPF +M E I L  + NFFE RV +YQ+  
Sbjct: 330 VADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAG 376


>gi|302783485|ref|XP_002973515.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
 gi|302787555|ref|XP_002975547.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300156548|gb|EFJ23176.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300158553|gb|EFJ25175.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
          Length = 347

 Score =  145 bits (366), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 155/317 (48%), Gaps = 29/317 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   WE Y  A  + W   EV +  D   W+S   LTD+E+  +   L FFA+S+
Sbjct: 36  MFPIRYPRVWEMYKKAEASFWTAEEVDLSQDAKHWES---LTDNEKHFVSHVLAFFAASD 92

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD---EGELFNMYR 150
            +V  N+ +   + +  PE R +   Q   E +HS  +  ++ +   D   + +LFN   
Sbjct: 93  GIVLENLAVRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLETYIKDNEVKAKLFNAIE 152

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL++              D+ Q F + +  F  V EG++F   F  I  
Sbjct: 153 TIPCVAKKADWALRWI-------------DSSQSFAERIVAFACV-EGIFFSGSFCAIFW 198

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + + + +       K  +++ + ++ +A  
Sbjct: 199 LKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLNV-------KLDEKRVKEIVSDAVE 251

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +    VG+NA    QY+ F+A+R    +G   LF    NPF WM ++I L+
Sbjct: 252 IERQFVCEALSCDLVGMNARLMSQYIDFVADRLMVVLGYNKLFNAI-NPFDWM-DLISLQ 309

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+ +
Sbjct: 310 GKTNFFEKRVGEYQKAS 326


>gi|289548460|ref|YP_003473448.1| ribonucleoside-diphosphate reductase [Thermocrinis albus DSM 14484]
 gi|289182077|gb|ADC89321.1| Ribonucleoside-diphosphate reductase [Thermocrinis albus DSM 14484]
          Length = 342

 Score =  145 bits (366), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 173/329 (52%), Gaps = 18/329 (5%)

Query: 29  SDVNQLLPLKYGWAWEKYLS-ACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLG 87
           +++ +L  +KY WA++ Y +    N W+P E+ M +D   ++    L+  E+   +  L 
Sbjct: 26  TNIMELNNVKYQWAFDLYKTMGFTNFWIPEEISMMEDRKQYE--RVLSAHEKRAYEMVLS 83

Query: 88  FFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL--GLDEGEL 145
           F  + +S   N ++    R L+ PE    +  Q F+EA+HS+++Q+I+ S+   +   E+
Sbjct: 84  FLIALDSYQVN-MLKEFARFLTAPELTMAITAQEFQEALHSYSYQFILESVVDPVKADEI 142

Query: 146 FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE-FLQDLFVFYVVFEGMWFYTG 204
           +N +RE        +  L     + +  +    +  D+E FL+ +F  YV+ E ++FY+G
Sbjct: 143 YNYWRE--------DKVLMERNRVIADLYNDFVRKQDEETFLKAVFGNYVL-ESLYFYSG 193

Query: 205 FAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTM 264
           FA   +LGR  KM+   +Q +YI RDE  H++   ++I  +K ENP L+T E ++  +  
Sbjct: 194 FAFFYTLGRQGKMLSTVQQIKYINRDELTHVSLFRNIILTLKKENPELFTPEMEKWVKEF 253

Query: 265 LHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWM 323
              A   EI +         +G+N    ++Y++++AN R  QIG EP+F   TENP  W+
Sbjct: 254 FRYAASEEIKWGQYVTRNQILGINDQLIDRYIKYLANLRLTQIGYEPVFPDVTENPMKWI 313

Query: 324 SEVIDLKKEK-NFFETRVTEYQQGAELKW 351
                +   K +FF+ +   Y + +ELKW
Sbjct: 314 DTFRTINDTKTDFFQAKPQTYAKRSELKW 342


>gi|155370982|ref|YP_001426516.1| hypothetical protein ATCV1_Z035L [Acanthocystis turfacea Chlorella
           virus 1]
 gi|155124302|gb|ABT16169.1| hypothetical protein ATCV1_Z035L [Acanthocystis turfacea Chlorella
           virus 1]
          Length = 325

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 156/321 (48%), Gaps = 28/321 (8%)

Query: 35  LPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSES 94
            P++Y   ++ Y  A    W   EV +  D+  W+ K  L DDER  IK  LGFFA S+ 
Sbjct: 20  FPIRYPDIFQMYKKAVATFWTVEEVQLNQDVVDWREK--LNDDERHFIKHILGFFAGSDG 77

Query: 95  LVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYRE 151
           +V  N+       +++P  R +   Q + E+VHS  +  ++ +L  DE E   LF     
Sbjct: 78  MVMENLNNNFAEEVTDPSARMFYAYQGYNESVHSEQYSLLLDALIEDETERNKLFEAIET 137

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P++  KA WA +Y                D+ F + L V +V  EG+ F   F  I  L
Sbjct: 138 IPAVGKKAAWASKYFSR-------------DRSFAERL-VAWVCVEGLLFSGSFCAIFWL 183

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+    ++I RDE LH  FG  + +  K+EN     K      ++++ EA   
Sbjct: 184 RNRGLMPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLDVVKSIVEEAVAN 236

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  +  + +P   +G+N+    QY++F+A+R    +G    F   ENPF +M E+I L+ 
Sbjct: 237 EKDFICDAIPCRMIGMNSDLMSQYIEFVADRIFTALGYPKQFG-AENPFDFM-ELISLEG 294

Query: 332 EKNFFETRVTEYQQGAELKWD 352
           + NFFE RV+EYQ+   +  D
Sbjct: 295 KSNFFERRVSEYQKAGVMNAD 315


>gi|229827460|ref|ZP_04453529.1| hypothetical protein GCWU000182_02849 [Abiotrophia defectiva ATCC
           49176]
 gi|229788398|gb|EEP24512.1| hypothetical protein GCWU000182_02849 [Abiotrophia defectiva ATCC
           49176]
          Length = 354

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA   Y +  NN W+P E+ + +D+   K  + LT  ER    + + F    +S+ 
Sbjct: 44  IKYDWANVMYRTMLNNFWIPEEISLGEDI---KQFSYLTAGERKAFDKIISFLNFLDSIQ 100

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
             N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +RE P 
Sbjct: 101 CENLP-NLARYITAAEVASLLNVQAFQEEIHAQSYSYILDTVTNPVTRDKIYDEWREDPI 159

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    PS         + F++ +   Y++ EG++FY+GF+   +L R
Sbjct: 160 LLRRNKFIADMYQRFADDPS--------TENFVRSVMANYIL-EGIYFYSGFSFFYTLAR 210

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++  ENP ++T E + + R M+   TL EI
Sbjct: 211 QGKMTATSTIFKYINRDEITHLVLFQNIIRELMKENPEIFTDELKGELREMVKVGTLNEI 270

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +G+N    E+Y+++++N R   IGL   F + TENP  W+    +L   
Sbjct: 271 EWGQYVTNNEILGINNELIERYIKYLSNLRLRAIGLPVWFPEITENPMAWIESFSNLNAT 330

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 331 KTDFFEAKVTNYTKAAAFDFD 351


>gi|194036959|ref|XP_001925036.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B [Sus
           scrofa]
          Length = 351

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/338 (29%), Positives = 160/338 (47%), Gaps = 28/338 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
            E      ++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N
Sbjct: 23  SENEAKSSEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---N 79

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  + 
Sbjct: 80  RLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYS 139

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  +   LFN    +P +  KA+WAL++              D    F + +
Sbjct: 140 LLIDTYIRDPKQREFLFNAIETMPYVKKKADWALRW------------IADRKATFGERV 187

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
             F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +        
Sbjct: 188 VAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ------ 240

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
            +L  K  + + R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G 
Sbjct: 241 -YLVNKPSEARVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLTELGF 299

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 300 SKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 335


>gi|45360749|ref|NP_989048.1| ribonucleotide reductase M2, gene 1 [Xenopus (Silurana) tropicalis]
 gi|38174078|gb|AAH61353.1| ribonucleotide reductase M2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 378

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/334 (29%), Positives = 162/334 (48%), Gaps = 28/334 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W++   L
Sbjct: 52  KDPRIQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEA---L 108

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 109 KPEERYFISYVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL 168

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D  E   LFN    +P +  KA WAL++     +P            F + +  
Sbjct: 169 IDTYIKDPKEREFLFNAIETLPCVKKKAEWALRWISDREAP------------FCERIVA 216

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +         H
Sbjct: 217 FAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFK-------H 268

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           +  K  +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + 
Sbjct: 269 VVHKPSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCKLMKQYIEFVADRLLLELGFKK 328

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +FK +ENPF +M E I L+ + NFFE +V EYQ+
Sbjct: 329 IFK-SENPFDFM-ENISLEGKTNFFEKKVAEYQK 360


>gi|91081999|ref|XP_969259.1| PREDICTED: similar to AGAP006818-PA [Tribolium castaneum]
 gi|270007377|gb|EFA03825.1| hypothetical protein TcasGA2_TC013940 [Tribolium castaneum]
          Length = 374

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 160/317 (50%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W+KY  A  + W   EV +  DL  WK+K  L  DER  I   L FFA+S+
Sbjct: 67  VFPIQYPDIWDKYKQAEASFWTTEEVDLSKDLDDWKNK--LNSDERYFISHVLAFFAASD 124

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +   E R +   Q   E +HS  +  +I +   +  E   LFN   
Sbjct: 125 GIVNENLVERFSQEVQVTEARCFYGFQIAIENIHSEMYSMLIETYISEPQEKEFLFNAIE 184

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL +   ++S + T G +           V +   EG++F   FA I  
Sbjct: 185 TLPCVKKKADWALLW---INSKNATFGER----------IVAFAAVEGIFFSGSFASIFW 231

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L + N M G+    + I RDE LH +F   + +       HL  K  +++ ++++ +A  
Sbjct: 232 LKKRNLMPGLTFSNELISRDEGLHCDFACLMFS-------HLVQKPSKERIQSIIQDAVK 284

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N     QY++F+A+R   ++G E ++  ++NPF +M+ +I  +
Sbjct: 285 IEKEFLTEALPVSMIGMNCALMCQYIEFVADRLLGELGCEKIYN-SQNPFDFMT-IISNE 342

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE +V EYQ+  
Sbjct: 343 GKTNFFEKKVGEYQKSG 359


>gi|50286273|ref|XP_445565.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524870|emb|CAG58476.1| unnamed protein product [Candida glabrata]
          Length = 400

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 152/330 (46%), Gaps = 27/330 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           D+ +LN   D   L P+KY   W+ Y  A  + W   E+ +  DL  W   N L ++ER 
Sbjct: 75  DEPLLNDDPDRLTLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLHDWN--NRLNENERF 132

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N+V         PE + +   Q   E +HS T+  +I +   
Sbjct: 133 FISRVLAFFAASDGIVNENLVENFSTEAVIPEAKAFYGFQIMIENIHSETYSLLIDTYIK 192

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P I  KA WAL++                 +    +  V +   E
Sbjct: 193 DPKESEFLFNAIHTIPEIGEKAEWALRWIAN-------------SEALFAERLVAFAAIE 239

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +         HL  K  
Sbjct: 240 GVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLF-------AHLNHKPD 292

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +    ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G + ++   E
Sbjct: 293 PEVVERIVTEAVEIEQRYFLDALPVALLGMNAQLMNQYVEFVADRLLVAFGNKKVYN-VE 351

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           NPF +M E I L  + NFFE RV++YQ+  
Sbjct: 352 NPFDFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|313894221|ref|ZP_07827786.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           oral taxon 158 str. F0412]
 gi|313441045|gb|EFR59472.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           oral taxon 158 str. F0412]
          Length = 342

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 162/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           + A+  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLARNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E ++K   M+ + T  EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEEKITDMIRQGTENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|225684487|gb|EEH22771.1| ribonucleoside-diphosphate reductase small chain A
           [Paracoccidioides brasiliensis Pb03]
          Length = 413

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 154/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PLKY   W+ Y  A  + W   E+ +  DL  W   N L DDER  I   L FFA+S+
Sbjct: 91  LFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERYFISHVLAFFAASD 148

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+   
Sbjct: 149 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAID 208

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ +            D +  F Q L  F  V EG++F   FA I  
Sbjct: 209 TIPCIRKKADWAIRWIE------------DKESTFAQRLVAFAAV-EGIFFSGSFASIFW 255

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + + ++    H  + E  QK   ++ EA  
Sbjct: 256 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLR----HRPSPEAVQK---IITEAVA 308

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L 
Sbjct: 309 IEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLT 366

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 367 GKTNFFEKRVGDYQKAG 383


>gi|145349720|ref|XP_001419276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144579507|gb|ABO97569.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 329

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 161/344 (46%), Gaps = 37/344 (10%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +SP+   E  ++ +D+R          + P++Y   WE Y  A  + W   EV + DD+ 
Sbjct: 1   MSPLPLAEPLLDENDQRF--------TMFPIQYPQVWEMYKKAEASFWTAEEVDLSDDMK 52

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W++   LT DE+  +   L FFA+S+ +V  N+ +     +  PE R +   Q   E +
Sbjct: 53  HWET---LTKDEKHFVSHVLAFFAASDGIVLENLGVRFMGEVQIPEARAFYGFQIAIENI 109

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I     D  E   LF     +P +  KA+WAL++              D+  
Sbjct: 110 HSEMYSLLIDQYIKDPVEKDHLFRAIDTIPCVKKKADWALKWI-------------DSSD 156

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F + L  F  + EG++F   F  I  L +   M G+    + I RDE LH +F   + +
Sbjct: 157 SFAERLLAFACI-EGIFFSGSFCSIYWLKKRGLMPGLTFSNELISRDEGLHRDFACLLFS 215

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            +         K  ++  R ++ EA  +E  +  +++P   VG+NA     Y++++A+  
Sbjct: 216 MLN-------NKPSEETIRKIVTEAVEIEKEFVCDSLPCALVGMNAGMMSDYIEYVADHL 268

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +GL   +  T NPF WM E+I L+ + NFFE RV EYQ+  
Sbjct: 269 FCSLGLAKEYN-TTNPFDWM-ELISLQGKTNFFEKRVGEYQKAG 310


>gi|227498392|ref|ZP_03928542.1| ribonucleoside-diphosphate reductase [Acidaminococcus sp. D21]
 gi|226903854|gb|EEH89772.1| ribonucleoside-diphosphate reductase [Acidaminococcus sp. D21]
          Length = 342

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 162/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA   Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANTLYRTMLNNFWIPEEISLNEDI---KQFPYLTDSERRAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++ PE    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NISRYITAPEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDST 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S           +  FL  +   Y++ EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSDDP-------NEGNFLHTIVANYIL-EGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    +++ +++ E P L+TKE       M+ +    EI 
Sbjct: 200 GKMTATSTIFKYINRDEVTHLILFQNILRELRHERPDLFTKEQDAHIADMIRQGAENEIK 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL PL+ + ++NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNGLIEKYIKYLANIRLEAIGLAPLYPEISQNPMEWIESFSNLNGTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|303278144|ref|XP_003058365.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459525|gb|EEH56820.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 338

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 156/324 (48%), Gaps = 29/324 (8%)

Query: 27  ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNL 86
           A S+   + P+KYG  WE Y  A  + W   EV + DD+  W+    L+DDE+  I   L
Sbjct: 20  AGSERFTMFPIKYGDIWEMYKKAEASFWTAEEVDLSDDMKHWEK---LSDDEKHFISHIL 76

Query: 87  GFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE-- 144
            FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I +   D  +  
Sbjct: 77  AFFAASDGIVLENLGVRFMGEVQIPEARAFYGFQIAIENIHSEMYSLLIDAYIKDAAQKK 136

Query: 145 -LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYT 203
            LF     +P +  KA+WAL++ +  SS +F             +  + +   EG++F  
Sbjct: 137 YLFEAMENIPCVAKKADWALKWIE--SSATFA------------ERLIAFACIEGIFFSG 182

Query: 204 GFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRT 263
            F  I  L +   M G+    + I RDE LH +F   + +       +L  K      R 
Sbjct: 183 SFCSIYWLKKRGMMPGLTFSNELISRDEGLHRDFACLLYS-------YLQNKPDVSIVRQ 235

Query: 264 MLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWM 323
           ++ EA  +E  +  + +P   VG+N     +Y++F+A+    Q+GLE  +  T NPF +M
Sbjct: 236 IVCEAVEIEKEFVCDALPVSLVGMNKDLMSEYIEFVADHLLGQLGLEKEYN-TVNPFEFM 294

Query: 324 SEVIDLKKEKNFFETRVTEYQQGA 347
            E+I L+ + NFFE RV EYQ+  
Sbjct: 295 -ELISLQGKTNFFEKRVGEYQKSG 317


>gi|119174781|ref|XP_001239725.1| hypothetical protein CIMG_09346 [Coccidioides immitis RS]
          Length = 408

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 152/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PLKY   W+ Y  A  + W   E+ +  DL  W  +  L DDER  I R L FFA+S+
Sbjct: 89  LFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNHR--LNDDERYFISRVLAFFAASD 146

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+   
Sbjct: 147 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAID 206

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 207 TIPCIRKKADWAIRWIQ------------DQESTFAQRLIAFAAV-EGIFFSGSFASIFW 253

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +   +  + ++ EA  
Sbjct: 254 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPGPEAVQAIITEAVE 306

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 307 IEKEFLTDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYNAT-NPFDFMDN-ISLS 364

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 365 GKTNFFEKRVGDYQKAG 381


>gi|326917964|ref|XP_003205263.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Meleagris gallopavo]
          Length = 353

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 157/317 (49%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+++   W+ Y  A  + W   EV +  DL  W   N L  DE+  I   L FFA+S+
Sbjct: 46  IFPIQHPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NKLKPDEKYFISHILAFFAASD 102

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E VHS  +  +I +   D  +   LFN   
Sbjct: 103 GIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSLLIDTYIKDPEKRDFLFNAIE 162

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL++ +   S   T G +           V +   EG++F   FA I  
Sbjct: 163 TMPCVKKKADWALKWIEDRHS---TFGER----------VVAFAAVEGIFFSGSFAAIFW 209

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       +L  +  +++ R ++  A  
Sbjct: 210 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFH-------YLVNRPSEERVREIIVNAVE 262

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P G +G+N    +QY++F+A+R   ++G   +F + ENPF +M E I L+
Sbjct: 263 IEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLMELGFSKVF-HAENPFDFM-ENISLE 320

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV+EYQ+ A
Sbjct: 321 GKTNFFEKRVSEYQRFA 337


>gi|126322530|ref|XP_001380256.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 361

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 158/317 (49%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W+ Y  A  + W   EV +  DL  W   N L  DE+  I   L FFA+S+
Sbjct: 54  IFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NKLKSDEKYFISHILAFFAASD 110

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E +HS  +  +I +   D  +   LFN   
Sbjct: 111 GIVNENLVERFSQEVQVPEARCFYGFQILIENIHSEMYSLLIDTYIKDPQKREFLFNAIE 170

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WALQ+     S   T G +           V +   EG++F   FA I  
Sbjct: 171 TMPCVKRKADWALQWIADRKS---TFGER----------VVAFAAVEGIFFSGSFAAIFW 217

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       +L  K  +++ + ++  A  
Sbjct: 218 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFH-------YLVNKPSEERVKEIIINAVE 270

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P G +G+N+   +QY++F+A+R   ++G   +F+ ++NPF +M E I L+
Sbjct: 271 IEQEFLTDALPVGLIGINSTLMKQYIEFVADRLLVELGFSKVFQ-SDNPFDFM-ENISLE 328

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV+EYQ+ A
Sbjct: 329 GKTNFFEKRVSEYQRFA 345


>gi|303314521|ref|XP_003067269.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240106937|gb|EER25124.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320037571|gb|EFW19508.1| ribonucleoside-diphosphate reductase small subunit [Coccidioides
           posadasii str. Silveira]
          Length = 408

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 152/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PLKY   W+ Y  A  + W   E+ +  DL  W  +  L DDER  I R L FFA+S+
Sbjct: 89  LFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNHR--LNDDERYFISRVLAFFAASD 146

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+   
Sbjct: 147 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAID 206

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 207 TIPCIRKKADWAIRWIQ------------DQESTFAQRLIAFAAV-EGIFFSGSFASIFW 253

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +   +  + ++ EA  
Sbjct: 254 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPGPEAVQAIITEAVE 306

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 307 IEKEFLTDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYNAT-NPFDFMDN-ISLS 364

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 365 GKTNFFEKRVGDYQKAG 381


>gi|290995765|ref|XP_002680453.1| predicted protein [Naegleria gruberi]
 gi|284094074|gb|EFC47709.1| predicted protein [Naegleria gruberi]
          Length = 338

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/316 (30%), Positives = 157/316 (49%), Gaps = 28/316 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PL Y   WE Y     + W   EV +  D+  W+    L  +E+  IK  L FFA+S+
Sbjct: 31  LFPLHYPKMWEMYKKTMASFWTVEEVDLHTDITEWEK---LNSNEQHFIKTVLAFFAASD 87

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+       +  PE R +   Q   E +H+  +  +I +L  D+ E   LF+   
Sbjct: 88  GIVNENLCQQFMAQVQVPEARCFYGFQIAIENIHAEMYSTLIETLIKDQRERNRLFHAID 147

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            VPS+  KANWAL++              +++  F + L  F  V EG++F   F  I  
Sbjct: 148 TVPSVQKKANWALKWI-------------NSENLFAERLLAFACV-EGIFFSGSFCSIFW 193

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G++   + I RDE LH +F   + + +K      +TK  QQ   ++++EA  
Sbjct: 194 LKKRGLMPGLSFSNELISRDEGLHTDFACLLYSTLK------YTKLPQQVVHSLVYEAVE 247

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+N+   +QY++ +A+R    IG E ++  + NPF WM+ +I + 
Sbjct: 248 IEKEFISESLPVDLIGMNSRLMQQYIEMVADRLLVSIGYEKIYN-SSNPFDWMN-IISVS 305

Query: 331 KEKNFFETRVTEYQQG 346
            + NFFE +V EY + 
Sbjct: 306 GKTNFFEKKVGEYAKA 321


>gi|163781846|ref|ZP_02176846.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883066|gb|EDP76570.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1]
          Length = 350

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/338 (27%), Positives = 179/338 (52%), Gaps = 19/338 (5%)

Query: 21  DKRMLNAR-SDVNQLLPLKYGWAWEKYLS-ACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++R++N   +++ +L  +KY WA++ Y +   +N W+P E+P+ +D   ++    L+D E
Sbjct: 25  NRRIINGNPTNIIELNNIKYPWAFDLYKTMGFSNFWIPEEIPLMEDKKQYER--VLSDYE 82

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R   +  L F  + +S   + ++    R +S PE    L  Q F+E++H++++Q+I+ S+
Sbjct: 83  RRAYELVLSFLIALDSFQVD-MLKDFARMISAPEVEMALTAQEFQESIHAYSYQFILESV 141

Query: 139 --GLDEGELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
              +   E++N +RE   +  +     + Y + +  PS        ++ F++ +   Y++
Sbjct: 142 VDPIKADEIYNYWREDEKLKERNEVVAEVYNEFIRKPS--------EENFIKAVIGNYIL 193

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            E ++FY+GFA   +LGR  KM    +Q +YI RDE  H+    ++I  ++ E P L++ 
Sbjct: 194 -ESLYFYSGFAFFYTLGRQGKMTNTVQQIKYINRDELTHVTLFRNMILNLQKEQPELFSP 252

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-K 314
           E ++        A   EI +         +G+N    ++Y++++ N R  QIGLEPL+ +
Sbjct: 253 EIKKWIAEYFRYAIDQEIKWGQYVTQDQILGINNQLIDRYIKYLGNLRITQIGLEPLYPE 312

Query: 315 YTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAELKW 351
            TENP  W+ +   +   K +FF+ +   Y +  ELKW
Sbjct: 313 ITENPMKWIDDFRKINNTKTDFFQRKPQTYAKANELKW 350


>gi|310798394|gb|EFQ33287.1| ribonucleotide reductase [Glomerella graminicola M1.001]
          Length = 413

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 155/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W +K  + +DE+  I   L FFA+S+
Sbjct: 92  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNNK--INEDEKYFISHILAFFAASD 149

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LFN   
Sbjct: 150 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPAQRTYLFNAID 209

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL++              D    F Q L  F  V EG++F   FA I  
Sbjct: 210 TIPCIRKKADWALKWIS------------DEKSSFAQRLVAFAAV-EGIFFSGAFASIFW 256

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  
Sbjct: 257 LKKRGLMPGLTFSNELISRDEGLHTDFACLLYS-------HLKNRPSKQVIQDIIVDAVQ 309

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N+   +QY++F+A+R    +G + ++K + NPF +M E I L 
Sbjct: 310 IEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNDKVYK-SSNPFDFM-ENISLG 367

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 368 GKTNFFEKRVADYQKAG 384


>gi|319942042|ref|ZP_08016361.1| ribonucleoside-diphosphate reductase subunit beta [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804426|gb|EFW01304.1| ribonucleoside-diphosphate reductase subunit beta [Sutterella
           wadsworthensis 3_1_45B]
          Length = 344

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 154/317 (48%), Gaps = 26/317 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E ++ +   HW+ TEVPM +D+  ++ K  LTD ER  + + L FF   +  
Sbjct: 35  PFQYPWAYEAFMQSEQMHWLWTEVPMLEDVKDYQQK--LTDSERDFLTKILRFFTQGDID 92

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSI 155
           V+   V +       PE R  L   A  EAVH   + ++I +LGL E  ++N + +  ++
Sbjct: 93  VSGAYVNSYLPRFKQPEVRMMLSSFAAREAVHIAAYSHLIETLGLPES-IYNEFLQYEAM 151

Query: 156 TAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRAN 215
            AK ++            F    +D   +    +  F    EGM  ++ F  +L+  R  
Sbjct: 152 AAKHDF------------FNEVCRDKG-DLAAQIAAFSAFTEGMQLFSSFVMLLNFTRCG 198

Query: 216 KMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATL 270
            M G+ +   + + DE+LH      +  +   ENP LWT E + K    +  M+  E   
Sbjct: 199 TMKGMGQIIAWSIADETLHTESMTKIFREYITENPELWTDELKAKIYGIAEVMVDLEDKF 258

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +++A+    M +    L       Y+++IA+RR   +GL+ +FK T NP PW+  ++ + 
Sbjct: 259 IDLAFGVSEMKR----LTREDVRSYIRYIADRRLMGLGLKGIFKSTTNPLPWVDAMLGV- 313

Query: 331 KEKNFFETRVTEYQQGA 347
              NFFE RV +Y +GA
Sbjct: 314 THTNFFENRVVDYAKGA 330


>gi|254572986|ref|XP_002493602.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|238033401|emb|CAY71423.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|328354568|emb|CCA40965.1| ribonucleoside-diphosphate reductase subunit M2 [Pichia pastoris
           CBS 7435]
          Length = 400

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 152/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PLKY   W+ Y  A  + W   E+ +  DL  W   N + D+E+  I R L FFA+S+
Sbjct: 88  LFPLKYHDIWQMYKQAEASFWTAEEIDLGKDLHDWN--NRMNDNEKFFISRVLAFFAASD 145

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 146 GIVNENLVENFSAEVQLPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESEFLFNAIE 205

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++              D D  F + L  F  V EG++F   FA I  
Sbjct: 206 TIPCIKEKADWAMRWIS------------DDDALFAERLVAFAAV-EGIFFSGSFASIFW 252

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  
Sbjct: 253 LKKRGLMPGLTFSNELICRDEGLHTDFACLLFS-------HLNNRASEEIVEKIITEAVE 305

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  + +P   +G+N     QY++F+A+R    +G + ++    NPF +M E I L 
Sbjct: 306 IEKRYFTDALPVSLLGMNCSLMCQYVEFVADRLLVALGNKKVYN-VNNPFDFM-ENISLA 363

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 364 GKTNFFEKRVSDYQKAG 380


>gi|72008642|ref|XP_780110.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           isoform 1 [Strongylocentrotus purpuratus]
 gi|115928579|ref|XP_001179668.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           [Strongylocentrotus purpuratus]
          Length = 412

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 173/351 (49%), Gaps = 34/351 (9%)

Query: 2   ANNTGLSPIQAGEKRV--NVDDKRML--NARSDVNQLLPLKYGWAWEKYLSACNNHWMPT 57
           A +  + P  +G+K V  N +D+ +L  NAR  V  + P++Y   W+ Y  A  + W   
Sbjct: 66  AKSKLVKPENSGKKVVSFNKEDEPLLRENARRFV--IFPIQYHDIWQFYKKAEASFWTAE 123

Query: 58  EVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYL 117
           EV +  DL  W +   L D+ER  I   L FFA+S+ +V  N+V    + +   E R + 
Sbjct: 124 EVDLSKDLDHWAN---LKDEERHFISHVLAFFAASDGIVNENLVERFSQEVQVAEARCFY 180

Query: 118 LRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSF 174
             Q   E +HS  +  +I +   D  +   LFN    +P +T KA WAL +   + S S 
Sbjct: 181 GFQIAIENIHSEMYSLLIDTYIKDSVQRDFLFNAVETLPCVTKKAQWALNW---IGSDSA 237

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
             GT+           V +   EG++F   FA I  L +   M G+    + I RDE LH
Sbjct: 238 DFGTR----------IVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLH 287

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            +F   +         HL  K  ++  + ++ EA  +E  +  + +P   +G+NA   ++
Sbjct: 288 CDFACLMFK-------HLNNKPDEEHVQGIIKEAVAIEQEFLTDALPCSLIGMNAVLMKR 340

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           Y++F+A+R   ++G   ++K  ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 341 YIEFVADRLLVELGCGKIWK-VENPFDFM-ENISLEGKTNFFEKRVGEYQK 389


>gi|241166485|ref|XP_002409876.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
 gi|215494664|gb|EEC04305.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
          Length = 376

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 155/317 (48%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+ Y   W  Y  A  + W   EV +  DL  W   +GL  +ER  I   L FFA+S+
Sbjct: 69  MFPIVYEDIWRMYKKAEASFWTVEEVDLGKDLPHW---DGLKPEERHFISHILAFFAASD 125

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +   E R +   Q   E VHS  +  +I +   D  E   LFN   
Sbjct: 126 GIVNENLVERFSQEVQVTEARCFYGFQMAIENVHSEMYSLLIDTYIKDPSERDRLFNAVE 185

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL +   +S+ S T G +           V +   EG++F   FA I  
Sbjct: 186 TMPCIKRKADWALNW---ISNRSATFGER----------IVAFAAVEGIFFSGSFASIFW 232

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  K  Q + R ++ +A +
Sbjct: 233 LKKRGLMPGLTFSNELISRDEGLHTDFACLMFS-------HLVNKPSQARVRQIICDAVV 285

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N    ++Y++F+A+R   ++G E ++  +ENPF +M E I L+
Sbjct: 286 IEQEFLTDALPVALIGMNCELMKRYIEFVADRLLVELGCEKVYN-SENPFDFM-EHISLE 343

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+  
Sbjct: 344 GKTNFFEKRVGEYQKAG 360


>gi|255536887|ref|XP_002509510.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
 gi|223549409|gb|EEF50897.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
          Length = 329

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 157/332 (47%), Gaps = 29/332 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + ++ +L    D   + P++Y   WE Y  A  + W   EV +  DL  W+S   LT DE
Sbjct: 4   IPEEPLLAPNPDRFCMFPIQYPEIWEMYKKAEASFWTAEEVDLSQDLRHWES---LTPDE 60

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ + 
Sbjct: 61  KHFISHVLAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLETY 120

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LF+    VP I  KA WAL++              D  + F + +  F  V
Sbjct: 121 IKDSNEKNRLFHAIETVPCIAKKAEWALKWI-------------DGSESFAERIIAFACV 167

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G+    + I RDE LH +F   + + +K        K
Sbjct: 168 -EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLK-------KK 219

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G    +  
Sbjct: 220 LSEERVKGIVRDAVNIEREFVCDALPCALVGMNGELMSQYIEFVADRLLGALGCGKEYNV 279

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           + NPF WM E+I L+ + NFFE RV EYQ+ A
Sbjct: 280 S-NPFDWM-ELISLQGKTNFFEKRVGEYQKAA 309


>gi|89890041|ref|ZP_01201552.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
 gi|89518314|gb|EAS20970.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
          Length = 330

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 162/329 (49%), Gaps = 32/329 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+++   W W K   AC   W   E+ +Q D+  W+  N L  DER  
Sbjct: 8   ILQENPDRFVIFPIQHDDLWEWYKKQQAC--IWTAEEIDLQVDITDWQ--NSLNSDERYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGELFNMYREV---PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   ++R +   P+I  KA+WA+++   + SPSF             +  + +   EG
Sbjct: 124 DAEKDQLFRAIENFPAIKLKADWAMKW---IESPSFA------------ERLIAFAAVEG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F       + + N HL  K  +
Sbjct: 169 IFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGMHCDFA------VHLHNHHLVNKVPK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  +P++  T N
Sbjct: 223 ERITEIIVDALNIEREFITESLPASLIGMNAKLMTQYLEFVTDRLLGELECDPVYNVT-N 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           PF +M ++I ++ + NFFE RV EYQ+  
Sbjct: 282 PFDFM-DLIGMEGKTNFFEKRVGEYQKAG 309


>gi|322510876|gb|ADX06189.1| putative ribonucleotide reductase small subunit [Organic Lake
           phycodnavirus 2]
          Length = 324

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/313 (30%), Positives = 153/313 (48%), Gaps = 28/313 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+     W+ Y    +  W P E+    D+  W   N L  DE+  IK  L FFASS+
Sbjct: 19  MFPVSDETIWKMYKKQVDCFWRPEEIDTSKDMTHW---NKLNTDEQYFIKMILAFFASSD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+ L     +   E R +   Q   E +HS T+  +I S   D  E   LF+   
Sbjct: 76  GIVLENLGLRFMNEVQLSEARAFYGFQIAMENIHSETYSLLIDSYIKDSDEKHKLFHSLE 135

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
             P I  K +WA+++ Q   S SF T              V +   EG++F   F  I  
Sbjct: 136 HFPCIKKKGDWAMKWIQDKKS-SFATR------------LVAFACVEGIFFSGAFCSIYW 182

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE+LH  F + + N+++        K  ++K R ++ EA  
Sbjct: 183 LKKRGLMPGLTFSNELISRDEALHTEFAVYLYNRLE-------KKLNKKKVREIIEEAVT 235

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R   Q+G + ++  T NPF +M E+I L+
Sbjct: 236 IEKEFIVDALPCRMIGMNSELMTQYIEFVADRLMMQLGCDVIYA-TNNPFDFM-ELISLE 293

Query: 331 KEKNFFETRVTEY 343
           ++ NFFE+RV+EY
Sbjct: 294 QKTNFFESRVSEY 306


>gi|145249942|ref|XP_001401310.1| ribonucleoside-diphosphate reductase small chain [Aspergillus niger
           CBS 513.88]
 gi|134081995|emb|CAK46680.1| unnamed protein product [Aspergillus niger]
          Length = 396

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 152/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER  I   L FFA+S+
Sbjct: 80  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWH--NRLNDDERYFISHVLAFFAASD 137

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+   
Sbjct: 138 GIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAID 197

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 198 TIPCIAKKADWAIKWIQ------------DRESTFAQRLVAFAAV-EGIFFSGSFASIFW 244

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  +Q    ++ EA  
Sbjct: 245 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQVVEDIIVEAVG 297

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M E I L 
Sbjct: 298 IEQEFLTDALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYYNAT-NPFDFM-ESISLA 355

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 356 GKTNFFEKRVGDYQKAG 372


>gi|7106399|ref|NP_033130.1| ribonucleoside-diphosphate reductase subunit M2 [Mus musculus]
 gi|132626|sp|P11157|RIR2_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|22218698|pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|22218699|pdb|1H0O|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|52696260|pdb|1W68|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Oxidizing Conditions. A Fully Occupied
           Dinuclear Iron Cluster.
 gi|52696261|pdb|1W69|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Reducing Conditions. A Fully Occupied
           Dinuclear Iron Cluster And Bound Acetate.
 gi|157834262|pdb|1XSM|A Chain A, Protein R2 Of Ribonucleotide Reductase From Mouse
 gi|50720|emb|CAA33707.1| M2 ribonucleotide reductase [Mus musculus]
 gi|200768|gb|AAA40062.1| ribonucleotide reductase subunit M2 [Mus musculus]
 gi|26354034|dbj|BAC40647.1| unnamed protein product [Mus musculus]
 gi|54887418|gb|AAH85136.1| Ribonucleotide reductase M2 [Mus musculus]
 gi|74139292|dbj|BAE40793.1| unnamed protein product [Mus musculus]
 gi|74151119|dbj|BAE27683.1| unnamed protein product [Mus musculus]
 gi|74179887|dbj|BAE36508.1| unnamed protein product [Mus musculus]
 gi|74188932|dbj|BAE39238.1| unnamed protein product [Mus musculus]
 gi|74189151|dbj|BAE39331.1| unnamed protein product [Mus musculus]
 gi|74206394|dbj|BAE24918.1| unnamed protein product [Mus musculus]
 gi|74211991|dbj|BAE40165.1| unnamed protein product [Mus musculus]
          Length = 390

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/331 (29%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L  D
Sbjct: 67  SVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPD 123

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 124 ERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDT 183

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 184 YIKDPKEREYLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 230

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 231 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 284 KPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 344 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 372


>gi|327269406|ref|XP_003219485.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Anolis carolinensis]
          Length = 414

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 154/317 (48%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+ Y   W+ Y  A  + W   EV +  D   W   N L  +E+  I   L FFA+S+
Sbjct: 107 IFPIHYPDIWKMYKKAQASFWTAEEVDLSKDFPHW---NKLKSEEKYFISHILAFFAASD 163

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E VHS  +  +I +   D  E   LFN   
Sbjct: 164 GIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIKDPEERDFLFNAIE 223

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL++             +D    F + +  F  V EG++F   FA I  
Sbjct: 224 TMPCVKKKADWALRWI------------RDRKATFGERVVAFASV-EGIFFSGAFAAIFW 270

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  
Sbjct: 271 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVE 323

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+
Sbjct: 324 IEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLLELGFSKVFQ-AENPFDFM-ENISLE 381

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV+EYQ+ A
Sbjct: 382 GKTNFFEKRVSEYQRFA 398


>gi|258567064|ref|XP_002584276.1| ribonucleoside-diphosphate reductase small chain [Uncinocarpus
           reesii 1704]
 gi|237905722|gb|EEP80123.1| ribonucleoside-diphosphate reductase small chain [Uncinocarpus
           reesii 1704]
          Length = 401

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 149/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PLKY   W+ Y  A  + W   E+ +  DL  W  +  L DDER  I R L FFA+S+
Sbjct: 82  LFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNHR--LNDDERYFISRVLAFFAASD 139

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF    
Sbjct: 140 GIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFEALD 199

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D D  F Q L  F  V EG++F   FA I  
Sbjct: 200 NIPCIRKKADWAIRWIQ------------DKDSTFAQRLIAFAAV-EGIFFSGSFASIFW 246

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       H+  +        ++ EA  
Sbjct: 247 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HIRHRPTPAAVEAIITEAVE 299

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 300 IEKEFLTDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYHAT-NPFDFMDN-ISLA 357

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 358 GKTNFFEKRVGDYQKAG 374


>gi|212723480|ref|NP_001131892.1| hypothetical protein LOC100193273 [Zea mays]
 gi|194692834|gb|ACF80501.1| unknown [Zea mays]
 gi|195624040|gb|ACG33850.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 156/327 (47%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER  I 
Sbjct: 17  LLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVDLSADARHWD--EALSPDERHFIS 74

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   D+ 
Sbjct: 75  HVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIRDDV 134

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     VP++  KA+WA+++              D  + F + L  F  V EG++
Sbjct: 135 EKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVAFACV-EGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++       +K  + +
Sbjct: 181 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDVLR-------SKLDEAR 233

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            RT++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++  T NPF
Sbjct: 234 VRTIVADAVDIEREFVCDALPVSLVGMNGDLMSQYIEFVADRLLMALGCKKMYNVT-NPF 292

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV +YQ+ +
Sbjct: 293 DWM-ELISLQGKTNFFEKRVGDYQKAS 318


>gi|148705043|gb|EDL36990.1| ribonucleotide reductase M2 [Mus musculus]
          Length = 411

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/331 (29%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L  D
Sbjct: 88  SVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPD 144

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 145 ERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDT 204

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 205 YIKDPKEREYLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 251

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 252 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 305 KPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 365 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 393


>gi|74207686|dbj|BAE40088.1| unnamed protein product [Mus musculus]
          Length = 390

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/331 (30%), Positives = 162/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L  D
Sbjct: 67  SVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPD 123

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 124 ERHFISHALAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDT 183

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A   + + +  F  
Sbjct: 184 YIKDPKEREYLFNAIETMPCVKKKADWALRWI----------GDKEAT--YGERVMAFAA 231

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           V EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 232 V-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 284 KPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 344 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 372


>gi|225850104|ref|YP_002730338.1| ribonucleoside-diphosphate reductase, beta subunit [Persephonella
           marina EX-H1]
 gi|225645787|gb|ACO03973.1| ribonucleoside-diphosphate reductase, beta subunit [Persephonella
           marina EX-H1]
          Length = 329

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 154/308 (50%), Gaps = 6/308 (1%)

Query: 38  KYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVA 97
           +Y    E Y       W P E+ +Q D+  +KS   LT  E+ +   ++G+FASSE LV 
Sbjct: 23  RYPVFKEIYTKQKKAVWFPEELNIQQDVLDYKS---LTPTEKDLFDTSVGYFASSELLVQ 79

Query: 98  NNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITA 157
           N +    +  L++P  +     Q F E +HS  F+ I+ +  +D   ++N+  E   +  
Sbjct: 80  NVLGNGFFPVLTDPYAKMSFSTQMFMENIHSDFFEIILNTFEMDRKRIYNITLEDKLLME 139

Query: 158 KANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKM 217
           K    ++    ++       T +  ++ L  + +  ++ EGM+FY+ FA   ++    KM
Sbjct: 140 KQELIIRAVDRITYGKADPDTLEGKKQILTAILLNNIIQEGMFFYSAFAHFFAMKDTGKM 199

Query: 218 VGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE-FQQKSRTMLHEATLLEIAYA 276
             +    + I+ DESLHL  GI+ I  I  ENP +   E F +  +  + +A  LE+ Y 
Sbjct: 200 KNVVSGVELILIDESLHLQNGIEAILTIVEENPEIVDDEKFVENIKETIIDAVELELNYL 259

Query: 277 HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 335
                   + G++    E+YM++IA+RR  ++G +P FK  +NP  ++ +  D+KK  NF
Sbjct: 260 KTKFGGTTIFGVSYKELEKYMKYIADRRLEELGFDPQFKIDQNPLKFLQKE-DVKKLTNF 318

Query: 336 FETRVTEY 343
           FE   TEY
Sbjct: 319 FEVSSTEY 326


>gi|290977320|ref|XP_002671386.1| predicted protein [Naegleria gruberi]
 gi|284084954|gb|EFC38642.1| predicted protein [Naegleria gruberi]
          Length = 338

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 95/316 (30%), Positives = 156/316 (49%), Gaps = 28/316 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L PL+Y   WE Y  A  + W   EV +  D+  W +   LT +E+  IK  L FFA+S+
Sbjct: 31  LFPLEYPKIWEMYKKAMASFWTAEEVDLHTDITQWTT---LTPNEQHFIKSVLAFFAASD 87

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+       +  PE R +   Q   E +H+  +  +I +L  D+ E   LFN   
Sbjct: 88  GIVNENLCQQFMAEVQIPEARCFYGFQIAIENIHAEMYSTLIETLIKDQRERHRLFNAID 147

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            VPS+  KA WA+++                +  F + L  F  V EG++F   F  I  
Sbjct: 148 TVPSVQKKARWAMKWINN-------------ENLFAERLLAFACV-EGIFFSGSFCSIFW 193

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+A   + I RDE LH +F   + + +K      +TK  QQ   +++ EA  
Sbjct: 194 LKKRGLMPGLAFSNELISRDEGLHTDFACLLYSTLK------FTKLPQQVVHSLVSEAVE 247

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E++P   +G+N+   +QY++ +A+R    +G + ++  + NPF WM+ +I + 
Sbjct: 248 IEKEFICESLPVDLIGMNSRLMQQYIEMVADRLLVSLGYDKIYN-SPNPFDWMN-IISVS 305

Query: 331 KEKNFFETRVTEYQQG 346
            + NFFE +V EY + 
Sbjct: 306 GKTNFFEKKVGEYAKA 321


>gi|145553335|ref|XP_001462342.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124430181|emb|CAK94969.1| unnamed protein product [Paramecium tetraurelia]
          Length = 355

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 165/348 (47%), Gaps = 31/348 (8%)

Query: 5   TGLSPIQAGEKRVNVD--DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           T LS +QA +  +N +  D+ +L    +   L P+KY   W  Y     + W   E+ + 
Sbjct: 18  TPLSNVQASQTVLNQNYCDEPLLKQNPNRFVLFPIKYNDIWNMYKQHKASFWTAEEIDLY 77

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W+    LT DE+  IK  L FFA+S+ +V  N+       +  PE R +   Q  
Sbjct: 78  QDLKDWEK---LTADEKHFIKYVLAFFAASDGIVNENLAQQFCTEVQVPEARCFYGFQIA 134

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS T+  +I +   DE E   L +    VP I  KA WA+++              
Sbjct: 135 MENIHSETYSLLIDTYITDENEKNYLLHAIDNVPVIQKKAMWAMKWI------------- 181

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           + +  F + L  F  V EG++F   F  I  + + + M G+    + I RDE LH +F  
Sbjct: 182 NENDSFAERLIAFAAV-EGIFFSGSFCAIFWIKKRSLMPGLTFSNELISRDEGLHTDFAC 240

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
                  +   HL  K   Q+   ++  A  +E  +  E +P   +G+N+   +QY++F+
Sbjct: 241 -------LLYKHLVNKMSNQRIHEIISSAVEIEKEFISEALPVELIGMNSNLMKQYIEFV 293

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           A+R    +G   ++  ++NPF WM ++I L+ + NFFE RV +YQ+  
Sbjct: 294 ADRLIFALGAPKIYN-SKNPFEWM-DMISLQGKTNFFERRVGDYQKAG 339


>gi|301772278|ref|XP_002921557.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Ailuropoda melanoleuca]
          Length = 393

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/331 (29%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +
Sbjct: 70  SVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPE 126

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 127 ERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT 186

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 187 YIKDSKEREFLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 233

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 234 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 286

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 287 KPSEQRVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR 346

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 347 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 375


>gi|328872436|gb|EGG20803.1| ribonucleotide reductase small subunit [Dictyostelium fasciculatum]
          Length = 335

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 158/330 (47%), Gaps = 28/330 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   L P+KY   W  Y  A  + W   E+ +  D+  W++K  L D+ER  IK
Sbjct: 9   LLKENKDRFVLFPIKYTDIWNMYKKAEASFWTAEEIDLASDVNEWENK--LNDNERHFIK 66

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   +  
Sbjct: 67  NVLAFFAASDGIVNENLATKFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDTYIKNPD 126

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P +  KA+WAL++     S             F + L  F  V EG++
Sbjct: 127 EKKVLFNAIETIPCVKKKADWALRWITNSKS-------------FAERLVAFAAV-EGIF 172

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + N++   N  L  K  +  
Sbjct: 173 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYNKL---NNKLDVKTIE-- 227

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
             +++ +A   E  +  +++P   +G+N+    +Y++F A+R    +G + ++  + NPF
Sbjct: 228 --SIIRDAVECEKEFVTDSLPVDLIGMNSREMSKYIEFCADRLLVSLGYKKIYN-SANPF 284

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            WM E+I L ++ NFFE +V+EY +    K
Sbjct: 285 DWM-EMISLMRKANFFEGKVSEYAKAGVAK 313


>gi|294794440|ref|ZP_06759576.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           3_1_44]
 gi|294454770|gb|EFG23143.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           3_1_44]
          Length = 342

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 161/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ + T  EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGTENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|315041979|ref|XP_003170366.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
 gi|311345400|gb|EFR04603.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
          Length = 408

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 149/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  D+  W   N L DDER  I   L FFA+S+
Sbjct: 89  LFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN--NRLNDDERFFISHVLAFFAASD 146

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE R +   Q   E +HS T+  +I +   ++ +   LF    
Sbjct: 147 GIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEQKQRTYLFEAID 206

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D D  F Q L  F  V EG++F   FA I  
Sbjct: 207 TIPCIRKKADWAIRWIQ------------DKDSTFAQRLVAFAAV-EGIFFSGSFASIFW 253

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +        ++ EA  
Sbjct: 254 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNHRPEPSAVEAIITEAVT 306

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 307 IEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYN-TTNPFDFMDN-ISLA 364

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 365 GKTNFFEKRVGDYQKAG 381


>gi|153940168|ref|YP_001392091.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum F str. Langeland]
 gi|170756361|ref|YP_001782419.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B1 str. Okra]
 gi|152936064|gb|ABS41562.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum F str. Langeland]
 gi|169121573|gb|ACA45409.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B1 str. Okra]
 gi|322807123|emb|CBZ04697.1| ribonucleotide reductase of class Ia (aerobic),beta subunit
           [Clostridium botulinum H04402 065]
          Length = 342

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRAIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRMGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|157803769|ref|YP_001492318.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           canadensis str. McKiel]
 gi|157785032|gb|ABV73533.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           canadensis str. McKiel]
          Length = 324

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 160/319 (50%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ + +    HW+P EVP+ DD+  WK    LT  E+ ++ +   FF  ++ +
Sbjct: 12  PFSYPWAYDAWHTQQKIHWLPEEVPLADDVKDWKY--NLTPGEKHLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E ++ + +  
Sbjct: 69  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETIHIAAYSHLLDTVGMPEVE-YSAFLKYK 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              D  ++    L VF    EG+  +  FA +L+  R
Sbjct: 127 EMKDKYDYMQQFGV------------DTKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E 
Sbjct: 175 FNKMKGMGQVIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYGACTTIVHFED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 235 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 291 GVEHTNFFENRATEYSKAA 309


>gi|172448|gb|AAA34987.1| ribonucleotide reductase subunit 2 (RNR2) [Saccharomyces
           cerevisiae]
          Length = 399

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 154/327 (47%), Gaps = 27/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +LN   +   L P+KY   W+ Y ++        E+ +  D+  W   N + ++ER  I 
Sbjct: 78  LLNEDKERTVLFPIKYHEIWQAYEASFWTAETAEEIDLSKDIHDWN--NRMNENERFFIS 135

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 136 RVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPK 195

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA WAL++ Q            DAD  F + L  F  + EG++
Sbjct: 196 ESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVAFASI-EGVF 242

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE LH +F   +         HL  K     
Sbjct: 243 FSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAI 295

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  ENPF
Sbjct: 296 VEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPF 354

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 355 DFM-ENISLAGKTNFFEKRVSDYQKAG 380


>gi|159465835|ref|XP_001691128.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
 gi|158279814|gb|EDP05574.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
          Length = 394

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/335 (28%), Positives = 159/335 (47%), Gaps = 29/335 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R  + ++ +L+   D   + P+KY   WE Y  A  + W   EV + DD+  W+    L+
Sbjct: 68  RKRMLEEPLLDENPDRFCMFPIKYPQIWEMYKKAEASFWTAEEVDLGDDMKHWEK---LS 124

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           D ER  I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  ++
Sbjct: 125 DGERHFISHVLAFFAASDGIVLENLAIRFMKEVQLPEARAFYGFQVAIENIHSEMYSLLL 184

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            S   D  E   LF+    VP I  KA WA+++               +D  F + L  F
Sbjct: 185 ESYIKDPQEKHKLFHSIETVPCIKKKAQWAMKWI-------------GSDSVFSERLVAF 231

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++F   F  I  L +   M G+    + I RDE LH +F   + + +       
Sbjct: 232 AAV-EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACMLFSMLN------ 284

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
            T+  + + + ++ EA  +E  +  E +P   +G+N+    QY+QF+A+R    +G    
Sbjct: 285 -TRIDETRVKQIIVEAVEIEQEFCTEALPVDLIGMNSRLMAQYIQFVADRLLVSLGCAKQ 343

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           +    NPF +M E+I L+ + NFFE RV +YQ+  
Sbjct: 344 YNVV-NPFEFM-EMISLQGKTNFFEKRVGDYQKNG 376


>gi|115387427|ref|XP_001211219.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
 gi|114195303|gb|EAU37003.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
          Length = 401

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 151/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L +DER  I   L FFA+S+
Sbjct: 84  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNEDERYFISHVLAFFAASD 141

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+   
Sbjct: 142 GIVNENLVERFSGEVQIPEARCFYGFQIMIENIHSETYSLLIDTYIKEPKQRTYLFDAID 201

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 202 NIPCIAKKADWAIKWIQ------------DQESTFGQRLVAFAAV-EGIFFSGSFASIFW 248

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  +Q    ++ EA  
Sbjct: 249 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQVVEDIIVEAVA 301

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    QY++F+A+R    +G    F  T NPF +M E I L 
Sbjct: 302 IEKEFLTDALPVALLGMNSKLMCQYIEFVADRLLVALGNNKYFHST-NPFDFM-ESISLA 359

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 360 GKTNFFEKRVGDYQKAG 376


>gi|114327552|ref|YP_744709.1| ribonucleotide-diphosphate reductase subunit beta [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315726|gb|ABI61786.1| ribonucleoside-diphosphate reductase beta chain [Granulibacter
           bethesdensis CGDNIH1]
          Length = 339

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 160/321 (49%), Gaps = 32/321 (9%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P +Y WA+E +L     HW+P EVP+ DD+  W     L + E+ ++ +   FF  S+  
Sbjct: 32  PFRYPWAYEAWLVQQQVHWLPEEVPLADDVKDWH--RNLNEVEQHLVTQIFRFFTQSDVE 89

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGEL--FNMYRE 151
           V NN  +  Y  +  P     ++  AF   E +H   + +++ ++G+ E E   F  Y+E
Sbjct: 90  V-NNCYMKHYSRVFKP-TEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEVEYSAFLKYKE 147

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +            Y  + S         D+ +E  + L  F    EG+  +  FA +L+ 
Sbjct: 148 MKD-------KYDYMHSFSV--------DSKREIAKTLAAFGAFTEGLQLFASFAILLNF 192

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML-----H 266
            R  K+ G+ +   + +RDE+LH    I + +    EN  +WT++ +Q+ R +      H
Sbjct: 193 PRFGKLKGMGQIVSWSVRDETLHCLSIIKLFHVFIDENREIWTEDLRQEIRQICATIVEH 252

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           E   +++A+   ++     GL+A   + Y+++IA+RR  Q+GLEPLF    NP PW+ ++
Sbjct: 253 EDAFIDLAFELGSVE----GLDAAQVKSYIRYIADRRLIQLGLEPLFHVERNPLPWIDDM 308

Query: 327 IDLKKEKNFFETRVTEYQQGA 347
           ++  +  NFFE R TEY + +
Sbjct: 309 LNAVEHANFFENRATEYSRAS 329


>gi|49899161|gb|AAH75746.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
          Length = 386

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 163/338 (48%), Gaps = 28/338 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           Q+  K+  V+++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W S
Sbjct: 56  QSKAKKGAVEEEPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDS 115

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  
Sbjct: 116 ---LKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEM 172

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  E   LFN    +P +  KA+WAL +           G K+A      
Sbjct: 173 YSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW----------IGDKNAR---YG 219

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +      
Sbjct: 220 ERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK---- 275

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
              HL +K  ++  + ++  A  +E  +  + +P   +G+N    +QY++F+A+R   ++
Sbjct: 276 ---HLISKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLEL 332

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           G + +++  ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 333 GFDKVYR-VENPFDFM-ENISLEGKTNFFEKRVGEYQR 368


>gi|6525234|gb|AAF15363.1|AF205376_1 ribonucleotide reductase R2 subunit [Plasmodium falciparum]
          Length = 320

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 160/329 (48%), Gaps = 29/329 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +R+LN  SD   L P+ Y   W+ Y  A  + W   E+ +  DL   K    L ++E+  
Sbjct: 2   RRILNKESDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDL---KDFEKLNENEKHF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+     R +   E +++   Q   E +HS T+  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVLENLASKFLREVQITEAKKFYSFQIAVENIHSETYSLLIDNYIKD 118

Query: 142 EGELFNMY---REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E  N++     +P++  KA WA ++    +S                +  V     EG
Sbjct: 119 EKERLNLFHAIENIPAVKNKALWAAKWINDTNS--------------FAERIVANACVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           + F   F  I    + NK+ G+    + I RDE LH +F   + + +  + P       +
Sbjct: 165 ILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------E 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           Q  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R    +G   +F +++N
Sbjct: 218 QMVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKN 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           PF WM ++I L+ + NFFE RV +YQ+  
Sbjct: 277 PFNWM-DLISLQGKTNFFEKRVADYQKSG 304


>gi|67459102|ref|YP_246726.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia felis
           URRWXCal2]
 gi|67004635|gb|AAY61561.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia felis
           URRWXCal2]
          Length = 327

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/319 (28%), Positives = 159/319 (49%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA+E + +    HW+P EVP+ DD+  WK    L   E+ ++ +   FF  ++ +
Sbjct: 12  PFSYPWAYEAWHTQQKIHWLPEEVPLADDVKDWKY--NLAPGEKHLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++ + +  
Sbjct: 69  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YSAFLKYK 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              D  ++    L VF    EG+  +  FA +L+  R
Sbjct: 127 EMKDKYDYMQQFGV------------DTKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E 
Sbjct: 175 FNKMKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 235 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 291 GVEHTNFFENRATEYSKAA 309


>gi|255530602|ref|YP_003090974.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
 gi|255343586|gb|ACU02912.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
          Length = 324

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 156/333 (46%), Gaps = 30/333 (9%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +++ +L    D   LLP+KY   WE Y  +  + W   E+ + DD   W   + L D ER
Sbjct: 3   EEEVLLKENKDRFVLLPIKYPEIWEMYKKSEASFWTAEEIDLSDDQKHW---DNLNDGER 59

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FF++S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I +  
Sbjct: 60  HFISHILAFFSASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLIDTYI 119

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LF+    VP +  KA WAL++    S              F + L  F  V 
Sbjct: 120 KDPDEKDRLFHAIETVPCVKKKAEWALRWIDNGS--------------FAERLVAFAAV- 164

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE  H  F   +   +K        K 
Sbjct: 165 EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGSHCEFACLLYGMLK-------NKL 217

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            Q++   ++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G   ++  T
Sbjct: 218 SQEQVHGIIRDAVEIEKEFVTDALPVALIGMNAKLMSQYIEFVADRWLQELGYSKIYNAT 277

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E+I L+ + NFFE RV +YQ+   L
Sbjct: 278 -NPFDFM-EMISLQGKTNFFEKRVGDYQKSGVL 308


>gi|156839886|ref|XP_001643629.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114248|gb|EDO15771.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 394

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 102/344 (29%), Positives = 158/344 (45%), Gaps = 35/344 (10%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           L  ++  E  +N D  R++        + P++Y   +E Y  A  + W   E+ +  DL+
Sbjct: 62  LKEMEKNEPLLNEDKNRLI--------MHPIRYPDIYEAYKKAEASFWTAEEIDLSKDLS 113

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W  K  L  +ER  I R L FFA+S+ +V  N+       +  PE R +   Q   E +
Sbjct: 114 DWNDK--LNSNERFFISRVLAFFAASDGIVNENLTENFSVEVKVPEARCFYGFQIMIENI 171

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   D  E   LFN    +P I  KA WAL++                D+
Sbjct: 172 HSETYSLLIDTYIKDPKESDFLFNAIDYIPQIKEKAEWALRWINN-------------DE 218

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 219 ALFGERLVAFASIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFASLLFS 278

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
                  HL  K        ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R 
Sbjct: 279 -------HLDNKPDPAIVEKIVTEAVEIEKRYFIDALPVALLGMNAKLMNQYVEFVADRL 331

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
               G E  +K  ENPF +M E I L  + NFFE RV++YQ+ +
Sbjct: 332 LVSFGNEKYYK-VENPFDFM-ENISLAGKTNFFEKRVSDYQKAS 373


>gi|303258316|ref|ZP_07344319.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderiales
           bacterium 1_1_47]
 gi|302858762|gb|EFL81850.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderiales
           bacterium 1_1_47]
          Length = 328

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 152/322 (47%), Gaps = 25/322 (7%)

Query: 32  NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           N   P  Y WA++ ++++   HW+ TEVPM +D+  WK  N LTD ER  + +   FF  
Sbjct: 11  NYYKPFSYPWAYDAFMASEQMHWLWTEVPMIEDIKDWK--NVLTDGERDFLTKVFRFFTQ 68

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYRE 151
            +  V++  V         PE R  L   A  EAVH   + ++I ++G+ E     +Y E
Sbjct: 69  GDIDVSSAYVNTYLPFFPTPEIRMMLSSFAAREAVHIAAYSHLIETIGMPE----TVYNE 124

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ-DLFVFYVVFEGMWFYTGFAQILS 210
                      LQY        F  G  +  QE +   +  F    EGM  ++ F  +L+
Sbjct: 125 F----------LQYEAMAEKHDFFHGLAEDQQENIAVKMAAFSAFTEGMQLFSSFVMLLN 174

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTML 265
             R   M G+ +   + + DE+LH    I +  +  IENP LWT   +++      + + 
Sbjct: 175 FTRNGTMKGMGQIIAWSINDETLHTESMIRLFREYIIENPELWTDSLKKRIYDIAEKMIE 234

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            E   +++A+    M K    L+    + Y+++I +RR   +G++ +FK   NP PW+  
Sbjct: 235 LEDAFIDLAFGVNDMSKQ--NLSPADVKAYIRWICDRRLAAMGMKEIFKVNVNPLPWVDS 292

Query: 326 VIDLKKEKNFFETRVTEYQQGA 347
           ++ +    NFFE RV +Y +GA
Sbjct: 293 MLGV-THTNFFENRVVDYAKGA 313


>gi|224055741|ref|XP_002298630.1| predicted protein [Populus trichocarpa]
 gi|222845888|gb|EEE83435.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 158/332 (47%), Gaps = 29/332 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + ++ +L    D   + P++Y   WE Y  A  + W   EV +  D+  W++   LT DE
Sbjct: 4   IPEEPLLAENPDRFCMFPIQYPSIWEMYKKAEASFWTAEEVDLSSDVGHWEN---LTPDE 60

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  I   L FFA+S+ +V  NI     + +   E R +   Q   E +HS  +  ++ + 
Sbjct: 61  KHFISHVLAFFAASDGIVLENIAGRFMKEVQVSEARAFYGFQIAIENIHSEMYSLLLETY 120

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LF+    VP +  KA WAL++              D  + F + L  F  V
Sbjct: 121 IKDSTEKNRLFHAIETVPCVAKKAEWALRWI-------------DGGESFAERLIAFACV 167

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G+    + I RDE LH +F   + + ++        K
Sbjct: 168 -EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLR-------KK 219

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ + ++ EA  +E  +  +++P   VG+N     QY++F+A+R    +G   ++  
Sbjct: 220 LSEERVKGIVKEAVDIEREFVVDSLPCALVGMNGELMSQYIEFVADRLLGALGCGKVYNV 279

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
             NPF WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 280 A-NPFDWM-ELISLQGKTNFFEKRVGEYQKAS 309


>gi|157825769|ref|YP_001493489.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia akari
           str. Hartford]
 gi|157799727|gb|ABV74981.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia akari
           str. Hartford]
          Length = 327

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/319 (28%), Positives = 159/319 (49%), Gaps = 28/319 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA+  + +    HW+P EVP+ DD+  WK    LT  E+ ++ +   FF  ++ +
Sbjct: 12  PFSYPWAYTAWHTQQKIHWLPEEVPLADDVKDWKY--NLTPGEKHLLTQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y  +  P     ++  AF   E VH   + +++ ++G+ E E ++ + +  
Sbjct: 69  EVNNCYMKHYSRVFKP-TEILMMLSAFSNMETVHIAAYSHLLDTVGMPEVE-YSAFLKYK 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  Q+              D  ++    L VF    EG+  +  FA +L+  R
Sbjct: 127 EMKDKYDYIQQFGV------------DTKEDIATTLAVFGAFTEGLQLFASFAIMLNFPR 174

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EA 268
            NKM G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E 
Sbjct: 175 FNKMKGMGQIISWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFED 234

Query: 269 TLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
             +E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++
Sbjct: 235 AFIELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLN 290

Query: 329 LKKEKNFFETRVTEYQQGA 347
             +  NFFE R TEY + A
Sbjct: 291 GVEHTNFFENRATEYSKAA 309


>gi|332876813|ref|ZP_08444570.1| ribonucleoside-diphosphate reductase, beta subunit [Capnocytophaga
           sp. oral taxon 329 str. F0087]
 gi|332685239|gb|EGJ58079.1| ribonucleoside-diphosphate reductase, beta subunit [Capnocytophaga
           sp. oral taxon 329 str. F0087]
          Length = 324

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 160/326 (49%), Gaps = 30/326 (9%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P+++   W+ Y +A  + W   EV +  DL  W++K  L D+ER  I 
Sbjct: 6   LLQDNKDRFVIFPIQHNDIWQFYKNAEASFWTAEEVDLSPDLHDWQNK--LNDNERFFIS 63

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  +I +   D  
Sbjct: 64  RVLAFFAASDGIVNENLAINFLQEVQYPEARCFYGFQIMIENIHSEMYSLLIDTYVKDPA 123

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   L      +P +T KA WAL++         T G+      F + L  F  V EG++
Sbjct: 124 EKDYLLRAIETIPCVTKKAKWALRWI--------TKGS------FAERLIAFAAV-EGIF 168

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV-INQIKIENPHLWTKEFQQ 259
           F   F  I  L +   M G+    + I RDE LH +F   + +N       HL  K  ++
Sbjct: 169 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYVN-------HLQNKLSEE 221

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
             R ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G   ++  T NP
Sbjct: 222 TIREIIVDAVAIEKEFVTDALPVKLIGMNAELMCQYIEFVADRLLVALGCNKVWNAT-NP 280

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQ 345
           F +M E+I L+ + NFFE RV EYQ+
Sbjct: 281 FDFM-ELISLQGKTNFFERRVGEYQK 305


>gi|302665732|ref|XP_003024474.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
 gi|291188529|gb|EFE43863.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
          Length = 529

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 149/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  D+  W   N L DDER  I   L FFA+S+
Sbjct: 210 LFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN--NRLNDDERFFISHVLAFFAASD 267

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE R +   Q   E +HS T+  +I +   ++ +   LF    
Sbjct: 268 GIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEQKQRTYLFEAID 327

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D D  F Q L  F  V EG++F   FA I  
Sbjct: 328 TIPCIRKKADWAIRWIQ------------DKDSTFAQRLVAFAAV-EGIFFSGSFASIFW 374

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +        ++ EA  
Sbjct: 375 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNYRPDPSAVEAIITEAVT 427

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 428 IEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYNTT-NPFDFMDN-ISLA 485

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 486 GKTNFFEKRVGDYQKAG 502


>gi|168049349|ref|XP_001777126.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671569|gb|EDQ58119.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 325

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 149/317 (47%), Gaps = 29/317 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+KY   WE Y  A  + W   EV +  DL  W++   LTD+ER  I   L FFA+S+
Sbjct: 16  MFPIKYPQVWEMYKKAEASFWTAEEVDLSADLKHWEA---LTDNERHFISHVLAFFAASD 72

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+ +   + +  PE R +   Q   E +HS  +  ++ +   D+ E   LFN   
Sbjct: 73  GIVLENLAVRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLEAYIKDQSEKHRLFNAIE 132

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +T KA WAL++              D+   F + +  F  V EG++F   F  I  
Sbjct: 133 TIPCVTRKAEWALKWI-------------DSSGSFAERILAFACV-EGIFFSGSFCSIFW 178

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +   +         K  + +   ++ EA  
Sbjct: 179 LKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLN-------NKLSEDRVHEIVCEAVD 231

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +    VG+N     +Y+ F+A+R    +G    +    NPF WM E+I L+
Sbjct: 232 IEREFVCEALSCDLVGMNKIMMSEYIDFVADRLLVSLGYNKRYN-ARNPFDWM-ELISLQ 289

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+ +
Sbjct: 290 GKTNFFEKRVGEYQKAS 306


>gi|254517517|ref|ZP_05129573.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium sp.
           7_2_43FAA]
 gi|226911266|gb|EEH96467.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium sp.
           7_2_43FAA]
          Length = 344

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 170/334 (50%), Gaps = 19/334 (5%)

Query: 22  KRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KRM+N  + ++N    +KY W  + Y  A NN W+P E+ +  DL   K  N LT+DER 
Sbjct: 20  KRMINGNTTNLNDFNNMKYTWVSDWYRQAMNNFWIPEEINLAQDL---KDYNKLTNDERT 76

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
              + L F    +S+   N+   I  +++  E    L  QAF+EAVHS ++ Y++ ++  
Sbjct: 77  AYDKILSFLIFLDSIQTANLS-NINNYITASEVNLCLTIQAFQEAVHSQSYSYMLDTICS 135

Query: 141 DE--GELFNMYREVPSITAKANWALQ-YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
            E   E+   +++   +  +  +  + Y   L +P+         QE L    +   + E
Sbjct: 136 PEKRNEILYQWKDDKILLERNKFIGELYNNFLEAPT---------QENLIKTIMANYILE 186

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++FY+GF    +L R  KM G A++ +YI RDE+ HL    +++ ++++E P ++T E 
Sbjct: 187 GIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENTHLWLFRNILKELQLEQPEIFTDEV 246

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YT 316
           + + + M+  A   EI++ +  +     G+N      Y++++ N R   IGL+ +++ + 
Sbjct: 247 KNQLKEMMKTAVEHEISWGNYVIGDNIQGINKNLINDYIKYLGNLRMKAIGLDAIYEGHD 306

Query: 317 ENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAEL 349
            NP  W+  + D    K +FFE + T Y +   L
Sbjct: 307 NNPAAWVDILSDANSVKTDFFEAKSTAYAKAGAL 340


>gi|126662515|ref|ZP_01733514.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
 gi|126625894|gb|EAZ96583.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
          Length = 325

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 163/334 (48%), Gaps = 32/334 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+K+   W W K   AC   W   E+ +  DL  W +K  L DDE+  
Sbjct: 7   ILQENKDRFVIFPIKHQDIWEWYKKQEACI--WTAEEIDLHTDLNDWNNK--LNDDEKYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +  PE + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYPEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF+     P+I  KA WAL++ ++ S              F + L  F  V EG
Sbjct: 123 EVEKNKLFHAIETFPAIKEKAQWALKWIESDS--------------FAERLIAFAAV-EG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F       + + + H+  K  +
Sbjct: 168 IFFSGSFCSIYWLKKRGLMPGLTFSNELISRDEGMHCDFA------VHLHSHHIVNKVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++G + ++  + N
Sbjct: 222 ERITEIIVDALNIERQFITESLPVSLIGMNATLMTQYLEFVTDRLLVELGCDRVYN-SSN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M ++I L+ + NFFE RV EYQ+   +  D
Sbjct: 281 PFDFM-DMISLQGKTNFFEKRVAEYQKAGVMNSD 313


>gi|330998673|ref|ZP_08322403.1| ribonucleoside-diphosphate reductase, beta subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|329576534|gb|EGG58042.1| ribonucleoside-diphosphate reductase, beta subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 327

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 152/322 (47%), Gaps = 25/322 (7%)

Query: 32  NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           N   P  Y WA++ ++++   HW+ TEVPM +D+  WK  N LTD ER  + +   FF  
Sbjct: 10  NYYKPFSYPWAYDAFMASEQMHWLWTEVPMIEDIKDWK--NVLTDGERDFLTKVFRFFTQ 67

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYRE 151
            +  V++  V         PE R  L   A  EAVH   + ++I ++G+ E     +Y E
Sbjct: 68  GDIDVSSAYVNTYLPFFPTPEIRMMLSSFAAREAVHIAAYSHLIETIGMPE----TVYNE 123

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ-DLFVFYVVFEGMWFYTGFAQILS 210
                      LQY        F  G  +  QE +   +  F    EGM  ++ F  +L+
Sbjct: 124 F----------LQYEAMAEKHDFFHGLAEDQQENIAVKMAAFSAFTEGMQLFSSFVMLLN 173

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTML 265
             R   M G+ +   + + DE+LH    I +  +  IENP LWT   +++      + + 
Sbjct: 174 FTRNGTMKGMGQIIAWSINDETLHTESMIRLFREYIIENPELWTDSLKKRIYDIAEKMIE 233

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            E   +++A+    M K    L+    + Y+++I +RR   +G++ +FK   NP PW+  
Sbjct: 234 LEDAFIDLAFGVNDMSKQ--NLSPADVKAYIRWICDRRLAAMGMKEIFKVNVNPLPWVDS 291

Query: 326 VIDLKKEKNFFETRVTEYQQGA 347
           ++ +    NFFE RV +Y +GA
Sbjct: 292 MLGV-THTNFFENRVVDYAKGA 312


>gi|302497417|ref|XP_003010709.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
 gi|291174252|gb|EFE30069.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
          Length = 408

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 149/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  D+  W   N L DDER  I   L FFA+S+
Sbjct: 89  LFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN--NRLNDDERYFISHVLAFFAASD 146

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE R +   Q   E +HS T+  +I +   ++ +   LF    
Sbjct: 147 GIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEQKQRTYLFEAID 206

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D D  F Q L  F  V EG++F   FA I  
Sbjct: 207 TIPCIRKKADWAIRWIQ------------DKDSTFAQRLVAFAAV-EGIFFSGSFASIFW 253

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +        ++ EA  
Sbjct: 254 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNYRPDPSAVEAIITEAVT 306

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L 
Sbjct: 307 IEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYNTT-NPFDFMDN-ISLA 364

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 365 GKTNFFEKRVGDYQKAG 381


>gi|124808087|ref|XP_001348226.1| ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
 gi|23497116|gb|AAN36665.1|AE014816_50 ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
          Length = 349

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 96/344 (27%), Positives = 167/344 (48%), Gaps = 33/344 (9%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
            S +Q G K +N   +++LN  SD   L P+ Y   W+ Y  A  + W   E+ +  DL 
Sbjct: 20  FSDLQKG-KEIN---EKILNKESDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDL- 74

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
             K    L ++E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +
Sbjct: 75  --KDFEKLNENEKHFIKHVLAFFAASDGIVLENLASKFLREVQITEAKKFYSFQIAVENI 132

Query: 127 HSHTFQYIITSLGLDEGELFNMY---REVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   DE E  N++     +P++  KA WA ++    +S            
Sbjct: 133 HSETYSLLIDNYIKDEKERLNLFHAIENIPAVKNKALWAAKWINDTNS------------ 180

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V     EG+ F   F  I    + NK+ G+    + I RDE LH +F   + +
Sbjct: 181 --FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYS 238

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            +  + P       +Q  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R 
Sbjct: 239 LLDNKLP-------EQMVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRL 291

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +G   +F +++NPF WM ++I L+ + NFFE RV +YQ+  
Sbjct: 292 LECLGCSKIF-HSKNPFNWM-DLISLQGKTNFFEKRVADYQKSG 333


>gi|51891459|ref|YP_074150.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855148|dbj|BAD39306.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium
           thermophilum IAM 14863]
          Length = 346

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 164/327 (50%), Gaps = 15/327 (4%)

Query: 29  SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGF 88
           +++ +L  +KY WA +       N W+P EVP+ DD    K    LT DE+    R L F
Sbjct: 30  TNIMELTNVKYEWAQKLSDIMLRNFWIPEEVPLLDDA---KQYLELTADEQWAYDRMLSF 86

Query: 89  FASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE--LF 146
               +S++  ++   I  +++ PE    L    F EA+HS ++ Y++ S+   E    ++
Sbjct: 87  VIFMDSILTVSMPNLI-NYVTAPEINMCLSIHNFHEALHSKSYGYVLESVVPAERRQYIY 145

Query: 147 NMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFA 206
           +++RE   +  +  +     Q  +           D+ F++     YV+ EG++FY+GFA
Sbjct: 146 DLWREDRQLLERNRYIANTFQLFAD-------NPTDEHFVRACMAQYVL-EGIYFYSGFA 197

Query: 207 QILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH 266
              +L R  KM G A + Q+I RDE  H+    +++N ++ E P L+T +     R M+ 
Sbjct: 198 FFYALARMGKMKGTATEIQFINRDEITHVAVFQNILNGLRQERPQLFTPQLDADLRAMIR 257

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           +A   E+A+A   +     GL+    + Y++ +A++R   +G EPL+    NP  W+   
Sbjct: 258 QAAEHEMAWAAYCVGNRIQGLSGEVLQGYVKHLADQRARALGFEPLYGNHPNPIKWVESF 317

Query: 327 IDLKKEK-NFFETRVTEYQQGAELKWD 352
            +L + K +FFETRVT Y +   +  D
Sbjct: 318 SNLNQTKADFFETRVTNYAKSTNIDLD 344


>gi|75224904|sp|Q6Y657|RIR2B_ARATH RecName: Full=Putative ribonucleoside-diphosphate reductase small
           chain B; AltName: Full=Ribonucleoside-diphosphate
           reductase R2B subunit; AltName: Full=Ribonucleotide
           reductase small subunit B
 gi|37729626|gb|AAO62422.1| ribonucleotide reductase small subunit [Arabidopsis thaliana]
          Length = 333

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 155/327 (47%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P++Y   WE Y  A  + W   EV +  D   W+  N LT+DER  IK
Sbjct: 9   ILTPTPDRFCMFPIQYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NSLTNDERHFIK 66

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   D  
Sbjct: 67  HVLAFFAASDGIVLENLSTRFMSDVQISEARAFYGFQIAIENIHSEMYSLLLDTYIKDNK 126

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     +P +T KA WA+++              +  Q F + +  F  V EG++
Sbjct: 127 ERDHLFRAIETIPCVTKKAEWAMKWI-------------NGSQSFAERIVAFACV-EGIF 172

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++       TK  + +
Sbjct: 173 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLR-------TKLDEDR 225

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  + NPF
Sbjct: 226 LKAIVCDAVEIEREFVCDALPCALVGMNRELMSQYIEFVADRLLAALGCAKVYGVS-NPF 284

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 285 DWM-ELISLQGKTNFFEKRVGEYQKAS 310


>gi|2500209|sp|Q60561|RIR2_MESAU RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|49650|emb|CAA48232.1| ribonucleotide reductase [Mesocricetus auratus]
          Length = 386

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 99/331 (29%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L  D
Sbjct: 67  SVEDEPLLRENPRRFVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQHWEA---LKPD 123

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 124 ERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDT 183

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 184 YIKDSKEREYLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 230

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 231 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +FK
Sbjct: 284 KPSEQRVQEIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFK 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 344 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 372


>gi|1710401|sp|P49730|RIR2_TOBAC RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleoside-diphosphate reductase R2
           subunit; AltName: Full=Ribonucleotide reductase small
           subunit
 gi|1044912|emb|CAA63194.1| ribonucleotide reductase R2 [Nicotiana tabacum]
          Length = 329

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 159/332 (47%), Gaps = 29/332 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + ++ +L +  D   + P++Y   WE Y  A  + W   EV +  D   W++   LT  E
Sbjct: 4   IPEEPLLASSPDRFCMFPIQYPQIWEMYKKALASFWTAEEVDLSSDTRHWET---LTPGE 60

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ S 
Sbjct: 61  RHFITHVLAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLESY 120

Query: 139 GLDEGELFNMYREV---PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   ++R V   P +  KA WAL++              D  + F + L  F  V
Sbjct: 121 IKDSDEKSRLFRAVETNPCVEKKAKWALRWI-------------DGSETFAERLVAFACV 167

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G+    + I RDE LH +F   + + ++       TK
Sbjct: 168 -EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLR-------TK 219

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ + ++ +A  +E  +  + +P   VG+N     +Y++F+A+R    +G + L+  
Sbjct: 220 LTEERVKGIVADAVEIEREFVCDALPCALVGMNGDLMSKYIEFVADRLLDALGYDKLYN- 278

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +NPF WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 279 AQNPFDWM-ELISLQGKTNFFEKRVGEYQKAS 309


>gi|319953269|ref|YP_004164536.1| ribonucleoside-diphosphate reductase [Cellulophaga algicola DSM
           14237]
 gi|319421929|gb|ADV49038.1| Ribonucleoside-diphosphate reductase [Cellulophaga algicola DSM
           14237]
          Length = 326

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 163/334 (48%), Gaps = 32/334 (9%)

Query: 24  MLNARSDVNQLLPLKYG--WAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +L    D   + P+++   W W K   AC   W   E+ + +D   W +K  L DDER  
Sbjct: 7   ILQENKDRFVIFPIQHNDLWEWYKKQEAC--IWTAEEIDLSEDANDWNNK--LNDDERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++   + SPSF            + L  F  V EG
Sbjct: 123 EKEKTVLFQAIENFPAIKKKADWALKW---IDSPSFA-----------ERLIAFAAV-EG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F       + + N H+  +  +
Sbjct: 168 IFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDFA------VHLHNKHIINQVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   +L +A  +E  +  E++P   +G+N+    QY++F+ +R   ++  + ++  T N
Sbjct: 222 ERITEILVDALNIEREFITESLPASLIGMNSKLMTQYLEFVTDRLLVELECDKVYNST-N 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M ++I ++ + NFFE RV+EYQ+   L  D
Sbjct: 281 PFDFM-DMIGMEGKTNFFEKRVSEYQKAGVLNSD 313


>gi|148380773|ref|YP_001255314.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 3502]
 gi|153932443|ref|YP_001385057.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934989|ref|YP_001388527.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. Hall]
 gi|148290257|emb|CAL84376.1| ribonucleoside-diphosphate reductase beta chain [Clostridium
           botulinum A str. ATCC 3502]
 gi|152928487|gb|ABS33987.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930903|gb|ABS36402.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. Hall]
          Length = 342

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRAIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEVTHLVLFQNIIKELKNENLHIFTEELEEEFRQMMRMGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|170761039|ref|YP_001788131.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408028|gb|ACA56439.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 342

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRAIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRMGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDGFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|168184457|ref|ZP_02619121.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Bf]
 gi|237796249|ref|YP_002863801.1| ribonucleoside-diphosphate reductase subunit beta [Clostridium
           botulinum Ba4 str. 657]
 gi|182672468|gb|EDT84429.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Bf]
 gi|229263158|gb|ACQ54191.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Ba4 str. 657]
          Length = 342

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRVIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI
Sbjct: 199 QGKMTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRIGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYLEINKHPMEWIDSFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|67515571|ref|XP_657671.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|40746089|gb|EAA65245.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|259489743|tpe|CBF90266.1| TPA: Ribonucleotide reductase [Source:UniProtKB/TrEMBL;Acc:Q9HEW8]
           [Aspergillus nidulans FGSC A4]
          Length = 406

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 153/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L +DER  I R L FFA+S+
Sbjct: 86  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNEDERYFISRVLAFFAASD 143

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE R +   Q   E +H+ T+  +I +   +  +   LF+   
Sbjct: 144 GIVNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAID 203

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 204 TIPCIRKKADWAIKWIQ------------DKESTFAQRLVAFAAV-EGIFFSGSFASIFW 250

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  
Sbjct: 251 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNWRPSKKVVEDIIVEAVA 303

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L 
Sbjct: 304 IEKEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKYFNAT-NPFDFM-ESISLA 361

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 362 GKTNFFEKRVGDYQKAG 378


>gi|18859327|ref|NP_571525.1| ribonucleoside-diphosphate reductase subunit M2 [Danio rerio]
 gi|292624782|ref|XP_002665783.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Danio rerio]
 gi|3914657|sp|P79733|RIR2_DANRE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase protein R2 class
           I; AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|1695831|gb|AAB37103.1| ribonucleotide reductase protein R2 class I [Danio rerio]
 gi|27881838|gb|AAH44355.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|56207929|emb|CAI21240.1| ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|182889152|gb|AAI64707.1| Rrm2 protein [Danio rerio]
          Length = 386

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 162/338 (47%), Gaps = 28/338 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           Q+  K+  V+++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W S
Sbjct: 56  QSKAKKGAVEEEPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDS 115

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  
Sbjct: 116 ---LKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEM 172

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  E   LFN    +P +  KA+WAL +           G K+A      
Sbjct: 173 YSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNW----------IGDKNAR---YG 219

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +      
Sbjct: 220 ERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK---- 275

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
              HL  K  ++  + ++  A  +E  +  + +P   +G+N    +QY++F+A+R   ++
Sbjct: 276 ---HLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLEL 332

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           G + +++  ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 333 GFDKVYR-VENPFDFM-ENISLEGKTNFFEKRVGEYQR 368


>gi|282849773|ref|ZP_06259157.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           parvula ATCC 17745]
 gi|282580710|gb|EFB86109.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           parvula ATCC 17745]
          Length = 342

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 160/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  ENP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKENPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|330921941|ref|XP_003299625.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
 gi|311326599|gb|EFQ92269.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
          Length = 410

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 150/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W  +  L DDER  I   L FFA+S+
Sbjct: 84  LFPIKYHDVWQMYKKAEASFWTAEEIDLSKDLHDWNKR--LNDDERFFISHVLAFFAASD 141

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E VHS T+  +I +   +  +   LFN   
Sbjct: 142 GIVNENLVERFSSEVQIPEARCFYGFQIMMENVHSETYSLLIDTYISEPRQRKYLFNAID 201

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL++              D +  F   L  F  V EG++F   FA I  
Sbjct: 202 NIPCIRKKADWALRWIS------------DKNSTFANRLVAFAAV-EGIFFSGSFASIFW 248

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F   + + +         +  ++  R ++ EA  
Sbjct: 249 LKKRGLMPGLTFSNELISRDEGMHTDFACLLFSLLN-------NRPSKESVRAIITEAVE 301

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G   ++  T NPF +M E I L 
Sbjct: 302 IEQEFLSDALPCALLGMNATLMCQYIEFVADRLLLALGNTKVYNAT-NPFDFM-ENISLA 359

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 360 GKTNFFEKRVGDYQKAG 376


>gi|222475064|ref|YP_002563479.1| ribonuceoside-diphosphate reductase beta chain (nrdB) [Anaplasma
           marginale str. Florida]
 gi|222419200|gb|ACM49223.1| ribonuceoside-diphosphate reductase beta chain (nrdB) [Anaplasma
           marginale str. Florida]
          Length = 343

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 161/321 (50%), Gaps = 18/321 (5%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L++ E+ ++ +   FF  ++ +
Sbjct: 31  PFYYPWAYDAWLCQQRIHWIPEEVPLADDVQDWKTK--LSEQEKNLLVQIFRFFTQAD-I 87

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y ++  P     ++  AF   E VH   + Y++ ++G+ E E +  + +  
Sbjct: 88  EVNNCYMKHYSNIFKP-TEICMMLSAFSNMETVHIAAYSYLLDTIGMPEVE-YQAFLKFE 145

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  ++ ++          K   +   + L VF    EG+  +  FA +L+  R
Sbjct: 146 VMKKKYDYMQRFEES---------RKGDKRHVAKTLAVFGAFTEGLQLFASFAILLNFQR 196

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM G+ +   +  RDE+LH    I + N    EN  +W +  +++          LE 
Sbjct: 197 FGKMKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDENLREELYGACRVIVSLED 256

Query: 274 AYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            +       G V GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++  + 
Sbjct: 257 EFIDLAFALGDVEGLSAAEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILNGVEH 316

Query: 333 KNFFETRVTEYQQGA-ELKWD 352
            NFFE RVTEY + A E  WD
Sbjct: 317 TNFFENRVTEYSRAATEGTWD 337


>gi|11878241|gb|AAG40862.1| ribonucleotide reductase [Emericella nidulans]
          Length = 406

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 153/317 (48%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W   N L +DER  I R L FFA+S+
Sbjct: 86  LFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNEDERYFISRVLAFFAASD 143

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE R +   Q   E +H+ T+  +I +   +  +   LF+   
Sbjct: 144 GIVNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIKEPKQRTYLFDAID 203

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q            D +  F Q L  F  V EG++F   FA I  
Sbjct: 204 TIPCIRKKADWAIKWIQ------------DKESTFAQRLVAFAAV-EGIFFSGSFASIFW 250

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  
Sbjct: 251 LKKRGLMPGLTFSNELISRDEGLHTDFACLLFS-------HLNWRPSKKVVEDIIVEAVA 303

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L 
Sbjct: 304 IEKEFLTDALPCALLGMNAKLMCQYIEFVADRLLVALGNKEYFNAT-NPFDFM-ESISLA 361

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 362 GKTNFFEKRVGDYQKAG 378


>gi|313768358|ref|YP_004062038.1| hypothetical protein MpV1_155c [Micromonas sp. RCC1109 virus MpV1]
 gi|312599054|gb|ADQ91078.1| hypothetical protein MpV1_155c [Micromonas sp. RCC1109 virus MpV1]
          Length = 388

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 158/326 (48%), Gaps = 33/326 (10%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + PLKY   WE Y  A  ++W   EV +  D+  WK+   L D+E+  IK  L FFA S+
Sbjct: 86  VFPLKYPELWELYKKAQMSNWTAEEVDLSKDMDDWKT---LNDNEQKFIKYILAFFAGSD 142

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL---GLDEGELFNMYR 150
            +V  NI       +   E R +   Q+  E VH  T+  +I      G ++ +LF   +
Sbjct: 143 GIVFENINNNFADEVQISEARSFYAYQSHNEMVHGETYSKLIDKYIKDGAEKKQLFEAIQ 202

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            VP I  KANWAL++              D  + F + LF F  V EG++F   F  I  
Sbjct: 203 TVPCIERKANWALKWF-------------DKSRPFAERLFAFACV-EGIFFSGSFCAIFW 248

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH  F +++   ++        K   +   +++ EA  
Sbjct: 249 LKKRGLMPGLCFSNELISRDEGLHQEFAVELFKLLR-------NKPSTETIHSIVKEAVE 301

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+N+    +Y++++++R   Q+G  P++  ++NPF +M E I L 
Sbjct: 302 IEKNFILDALPCNLIGMNSEKMSEYIEYVSDRLLKQVGQPPIWN-SKNPFDFM-ENISLD 359

Query: 331 KEKNFFETRVTEY----QQGAELKWD 352
            + NFFE RV +Y       AE+ +D
Sbjct: 360 GKTNFFEKRVGDYGKLDDDSAEIGFD 385


>gi|148234092|ref|NP_001079369.1| ribonucleotide reductase M2 B (TP53 inducible) [Xenopus laevis]
 gi|27371032|gb|AAH41209.1| MGC52676 protein [Xenopus laevis]
          Length = 386

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 161/341 (47%), Gaps = 28/341 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           +P     K   ++D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 53  TPKSKAPKNPRLEDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQH 112

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W+S   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +H
Sbjct: 113 WES---LKKEEKYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIH 169

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL +           G K A   
Sbjct: 170 SEMYSLLIDTYVKDPKEREYLFNAIETLPCVKKKADWALHWI----------GDKQAT-- 217

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 218 -FGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK- 275

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 HL  K  +++   ++ +A  +E  +  E +P   +G+N    +QY++F+A+R  
Sbjct: 276 ------HLIRKPSEERVVELITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLL 329

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
            ++G + +FK T NPF +M E I L+ + NFFE +V EYQ+
Sbjct: 330 LELGFKKVFKAT-NPFDFM-ENISLEGKTNFFEKKVGEYQK 368


>gi|316971821|gb|EFV55552.1| ribonucleotide reductase R2 subunit [Trichinella spiralis]
          Length = 366

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 163/343 (47%), Gaps = 28/343 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           +P++     ++  ++ +L +      LLPL+Y   W  Y  A  + W   EV ++ D   
Sbjct: 33  TPMEQDAAAIDNCEEPLLRSNPKRFVLLPLEYPDIWAMYKKAEASFWTVEEVDLRKDAND 92

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W     L  DE+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VH
Sbjct: 93  WAK---LNKDEKHFISHVLAFFAASDGIVFENLVERFSQEIQVTEARFFYGFQIAIENVH 149

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL++     SP            
Sbjct: 150 SEMYSLLIDTYIRDPVERDFLFNAIETIPCVKKKADWALRWIGDRQSP------------ 197

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + 
Sbjct: 198 FCERLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYS- 255

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 HL  K  + + R ++ EA  +E  +  + +P   +G+N     QY++++A+R  
Sbjct: 256 ------HLKKKPTEDRVRQIITEAVSIEQEFLTDALPVRLIGMNCVLMSQYIEYVADRLL 309

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
            ++G   ++  +ENPF +M E+I L+ + NFFE RV EYQ+  
Sbjct: 310 VELGCSKVYN-SENPFDFM-EMISLEGKTNFFEKRVGEYQKAG 350


>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase
           Subunit R2
          Length = 332

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 159/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
            V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +
Sbjct: 9   GVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPE 65

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 66  ERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT 125

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 126 YIKDPKEREFLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 172

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 173 AVEGIFFSGSFASIFWLKKRGPMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 225

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 226 KPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR 285

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 286 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 314


>gi|56416698|ref|YP_153772.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. St. Maries]
 gi|254994906|ref|ZP_05277096.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Mississippi]
 gi|255003042|ref|ZP_05278006.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Puerto Rico]
 gi|255004164|ref|ZP_05278965.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Virginia]
 gi|56387930|gb|AAV86517.1| ribonuceoside-diphosphate reductase beta chain [Anaplasma marginale
           str. St. Maries]
          Length = 324

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 161/321 (50%), Gaps = 18/321 (5%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L++ E+ ++ +   FF  ++ +
Sbjct: 12  PFYYPWAYDAWLCQQRIHWIPEEVPLADDVQDWKTK--LSEQEKNLLVQIFRFFTQAD-I 68

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y ++  P     ++  AF   E VH   + Y++ ++G+ E E +  + +  
Sbjct: 69  EVNNCYMKHYSNIFKP-TEICMMLSAFSNMETVHIAAYSYLLDTIGMPEVE-YQAFLKFE 126

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  ++ ++          K   +   + L VF    EG+  +  FA +L+  R
Sbjct: 127 VMKKKYDYMQRFEES---------RKGDKRHVAKTLAVFGAFTEGLQLFASFAILLNFQR 177

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM G+ +   +  RDE+LH    I + N    EN  +W +  +++          LE 
Sbjct: 178 FGKMKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDENLREELYGACRVIVSLED 237

Query: 274 AYAHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 332
            +       G V GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++  + 
Sbjct: 238 EFIDLAFALGDVEGLSAAEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILNGVEH 297

Query: 333 KNFFETRVTEYQQGA-ELKWD 352
            NFFE RVTEY + A E  WD
Sbjct: 298 TNFFENRVTEYSRAATEGTWD 318


>gi|1710398|sp|P50650|RIR2_PLAF4 RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|555613|gb|AAA50170.1| ribonucleotide reductase small subunit [Plasmodium falciparum]
          Length = 349

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 96/344 (27%), Positives = 167/344 (48%), Gaps = 33/344 (9%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
            S +Q G K +N   +++LN  SD   L P+ Y   W+ Y  A  + W   E+ +  DL 
Sbjct: 20  FSDLQKG-KEIN---EKILNKESDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDL- 74

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
             K    L ++E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +
Sbjct: 75  --KDFEKLNENEKHFIKHVLAFFAASDGIVLENLASKFLREVQITEAKKFYSFQIAVENI 132

Query: 127 HSHTFQYIITSLGLDEGELFNMY---REVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   DE E  N++     +P++  KA WA ++    +S            
Sbjct: 133 HSETYSLLIDNYIKDEKERLNLFHAIENIPAVKNKALWAAKWINDTNS------------ 180

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V     EG+ F   F  I    + NK+ G+    + I RDE LH +F   + +
Sbjct: 181 --FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYS 238

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            +  + P       +Q  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R 
Sbjct: 239 LLDNKLP-------EQIIQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRL 291

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
              +G   +F +++NPF WM ++I L+ + NFFE RV +YQ+  
Sbjct: 292 LECLGCSKIF-HSKNPFNWM-DLISLQGKTNFFEKRVADYQKSG 333


>gi|297805560|ref|XP_002870664.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297316500|gb|EFH46923.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 333

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 157/327 (48%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L    D   + P++Y   WE Y  A  + W   EV +  D   W+  N L++DER  IK
Sbjct: 9   ILTPTPDRFCMFPIQYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NSLSNDERHFIK 66

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   D  
Sbjct: 67  HVLAFFAASDGIVLENLSTRFMSDVQISEARAFYGFQIAIENIHSEMYSLLLDTYIKDNK 126

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     +P +T KA WA+++              +  Q F + +  F  V EG++
Sbjct: 127 ERDHLFRAIETIPCVTKKAEWAMKWI-------------NGSQSFAERIVAFACV-EGIF 172

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++       TK  +++
Sbjct: 173 FSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLR-------TKLDEER 225

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            ++++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  + NPF
Sbjct: 226 LKSIVCDAVEIEREFVCDALPCALVGMNRELMSQYIEFVADRLLTALGCGKVYGVS-NPF 284

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 285 DWM-ELISLQGKTNFFEKRVGEYQKAS 310


>gi|9633651|ref|NP_051729.1| ribonucleotide reductase, small subunit [Myxoma virus]
 gi|6523870|gb|AAF14903.1|AF170726_19 ribonucleotide reductase, small subunit [Myxoma virus]
 gi|301134541|gb|ADK63655.1| M015L [Myxoma virus]
          Length = 322

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 159/330 (48%), Gaps = 28/330 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++D+ +L    D   + P++Y   W  Y  A  + W P EV +  DL  W+    LT DE
Sbjct: 1   MEDEPVLKESLDRYVVFPIQYNDIWNMYKKAVASFWTPEEVDISKDLKDWRV---LTPDE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I + 
Sbjct: 58  KYFIKHILAFFAASDGIVNENLAERFYVEVQIAEARCFYGFQIAMENIHSEMYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            +D  E   LF     +  I  KA W  ++             ++ D  + + L  F  V
Sbjct: 118 IIDLQEKEKLFKAIETMDCIKQKAEWVQKW------------IRNKDATYAERLIAFASV 165

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +  KM G+    + I RDE LH +F   +   +K   P     
Sbjct: 166 -EGIFFSGSFAAIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLMFKHLK-HTPS---- 219

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++  +++ EA ++E  +  E +P   +G+N     QY++F+A+R   ++G   +F  
Sbjct: 220 --EERVASIIKEAVVIEQRFLTEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSA 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           T NPF +M E I L+ + NFFE RV++YQ+
Sbjct: 278 T-NPFDFM-ENISLEGKTNFFEKRVSDYQR 305


>gi|312216546|emb|CBX96496.1| similar to ribonucleoside-diphosphate reductase subunit M2
           [Leptosphaeria maculans]
          Length = 410

 Score =  142 bits (357), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 150/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           L P+KY   W+ Y  A  + W   E+ +  DL  W  +  L DDER  I   L FFA+S+
Sbjct: 83  LFPIKYHDVWQMYKKAEASFWTAEEIDLSKDLHDWNKR--LNDDERFFISHVLAFFAASD 140

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E VHS T+  +I +   +  +   LFN   
Sbjct: 141 GIVNENLVERFSGEVQIPEARCFYGFQIMMENVHSETYSLLIDTYISEPRQRKYLFNAID 200

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WAL++              D +  F   L  F  V EG++F   FA I  
Sbjct: 201 NIPCIRKKADWALRWIS------------DKNSTFANRLVAFAAV-EGIFFSGSFASIFW 247

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE +H +F   + + +        T+  ++  + ++ EA  
Sbjct: 248 LKKRGLMPGLTFSNELISRDEGMHTDFACLLFSLLN-------TRPSKESVQAIITEAVE 300

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  + +P   +G+NA    QY++F+A+R    +G    +  T NPF +M E I L 
Sbjct: 301 IEKEFLSDALPCALLGMNATLMCQYIEFVADRLLLSLGNTKFYNAT-NPFDFM-ENISLA 358

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV +YQ+  
Sbjct: 359 GKTNFFEKRVGDYQKAG 375


>gi|148232385|ref|NP_001085389.1| ribonucleotide reductase M2, gene 1 [Xenopus laevis]
 gi|48735122|gb|AAH72071.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 161/330 (48%), Gaps = 28/330 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W++   L  +E
Sbjct: 84  IQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWET---LKPEE 140

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 141 RYFIAYVLAFFAASDGIVNENLVERFSQEVQVTEVRCFYGFQIAMENIHSEMYSLLIDTY 200

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA W+L++     +P            + + L  F  V
Sbjct: 201 IKDPKEREFLFNAIETLPCVKKKAEWSLRWISDREAP------------YCERLVAFAAV 248

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +         H+  K
Sbjct: 249 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFK-------HVVHK 300

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + +FK 
Sbjct: 301 PSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK- 359

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +ENPF +M E I L+ + NFFE +V EYQ+
Sbjct: 360 SENPFDFM-ENISLEGKTNFFEKKVGEYQK 388


>gi|149637725|ref|XP_001508783.1| PREDICTED: similar to Ribonucleotide reductase M2 B (TP53
           inducible) [Ornithorhynchus anatinus]
          Length = 401

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 156/317 (49%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W+ Y  A  + W   EV +  DL  W   N L  +E+  I   L FFA+S+
Sbjct: 94  IFPIQYPEIWKMYKQAQASFWTAEEVDLSKDLPHW---NKLKSEEKYFISHILAFFAASD 150

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +  PE R +   Q   E VHS  +  +I +   D  +   LFN   
Sbjct: 151 GIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIKDPKKREFLFNAIE 210

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+W+L++     S   T G +           V +   EG++F   FA I  
Sbjct: 211 TMPFVKKKADWSLRWIADRQS---TFGER----------VVAFAAVEGIFFSGSFAAIFW 257

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         +L  K  + K + ++ +A  
Sbjct: 258 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ-------YLVKKPSEDKVKEIIIDAVE 310

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P G +G+N    +QY++F+A+R   ++G   +F +++NPF +M E I L+
Sbjct: 311 IEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLVELGFSKVF-HSDNPFDFM-ENISLE 368

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV+EYQ+ A
Sbjct: 369 GKTNFFEKRVSEYQRFA 385


>gi|297668213|ref|XP_002812343.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Pongo abelii]
          Length = 449

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +
Sbjct: 126 DVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPE 182

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 183 ERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT 242

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 243 YIKDPKEREFLFNAIETLPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 289

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 290 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 342

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 343 KPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR 402

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 403 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 431


>gi|327261309|ref|XP_003215473.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 1 [Anolis carolinensis]
          Length = 394

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 157/331 (47%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N  D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  D
Sbjct: 71  NAQDEPLLRDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKPD 127

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 128 EKYFISHILAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLIDT 187

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WA+++           G K A      +  V + 
Sbjct: 188 YIKDPKEREYLFNAIETLPCVKRKADWAMRWI----------GDKHAT---YGERVVAFA 234

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 235 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 287

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   ++K
Sbjct: 288 KPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK 347

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 348 -AENPFDFM-ENISLEGKTNFFEKRVGEYQR 376


>gi|242095388|ref|XP_002438184.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
 gi|241916407|gb|EER89551.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
          Length = 339

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 154/327 (47%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER  I 
Sbjct: 17  LLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVDLSSDARHWD--EALSPDERHFIS 74

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   D+ 
Sbjct: 75  HVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIRDDA 134

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     VP++  KA+WA+++              D  + F + L  F  V EG++
Sbjct: 135 EKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVAFACV-EGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   +   ++       +K  + +
Sbjct: 181 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYELLR-------SKLDEAR 233

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++  T NPF
Sbjct: 234 VREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGCKKMYNAT-NPF 292

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV +YQ+ +
Sbjct: 293 DWM-ELISLQGKTNFFEKRVGDYQKAS 318


>gi|293343290|ref|XP_002725449.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Rattus
           norvegicus]
 gi|293355176|ref|XP_002728627.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Rattus
           norvegicus]
          Length = 390

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 153/315 (48%), Gaps = 28/315 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W+ Y  A  + W   EV +  D+  W++   L  DER  I   L FFA+S+
Sbjct: 83  VFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA---LKPDERHFISHVLAFFAASD 139

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V    + +   E R +   Q   E +HS  +  +I +   D  E   LFN   
Sbjct: 140 GIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAIE 199

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +  KA+WAL++           G K+A      +  V +   EG++F   FA I  
Sbjct: 200 TMPCVKKKADWALRWI----------GDKEAT---YGERVVAFAAVEGIFFSGSFASIFW 246

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  
Sbjct: 247 LKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVKEIITNAVR 299

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E I L+
Sbjct: 300 IEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFK-VENPFDFM-ENISLE 357

Query: 331 KEKNFFETRVTEYQQ 345
            + NFFE RV EYQ+
Sbjct: 358 GKTNFFEKRVGEYQR 372


>gi|168015485|ref|XP_001760281.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688661|gb|EDQ75037.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 330

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 149/317 (47%), Gaps = 29/317 (9%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+KY   WE Y  A  + W   EV +  D   W++   LTD+ER  I   L FFA+S+
Sbjct: 19  MFPIKYPQVWEMYKKAEASFWTAEEVDLSADSKHWEA---LTDNERHFISHVLAFFAASD 75

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+ +   + +  PE R +   Q   E +HS  +  ++ +   D  E   LFN   
Sbjct: 76  GIVLENLAIRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLEAYIKDHAEKNRLFNAIE 135

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P +T KA WAL++  +  S             F + +  F  V EG++F   F  I  
Sbjct: 136 TIPCVTKKAEWALKWIHSAGS-------------FAERILAFACV-EGIFFSGSFCAIFW 181

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +   +         K  + +   ++ EA +
Sbjct: 182 LKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLN-------NKLSEDRVYEIVCEAVV 234

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +  E +    VG+N     +Y+ F+A+R    +G    +  + NPF WM E+I L+
Sbjct: 235 IEQEFVCEALSCDLVGMNKTLMSEYIDFVADRLLVSLGYPKKYN-SHNPFDWM-ELISLQ 292

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+ +
Sbjct: 293 GKTNFFEKRVGEYQKAS 309


>gi|212274629|ref|NP_001130908.1| hypothetical protein LOC100192012 [Zea mays]
 gi|195636980|gb|ACG37958.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 153/327 (46%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L   SD   + P++Y   WE Y  A  + W   EV +  D   W +   L+ DER  I 
Sbjct: 17  LLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWDA--ALSPDERHFIS 74

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL---GL 140
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +    G 
Sbjct: 75  HVLAFFAASDGIVLENLASRFMSDVQAAEARAFYGFQIAIENIHSEMYSLLLETYIRDGT 134

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           ++  LF     VP++  KA+WA+++              D  + F + L  F  V EG++
Sbjct: 135 EKDRLFRAIETVPAVRRKADWAMRWI-------------DGGERFAERLVAFACV-EGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++        K  + +
Sbjct: 181 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESR 233

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++    NPF
Sbjct: 234 VREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYN-VANPF 292

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 293 DWM-ELISLQGKTNFFEKRVGEYQKAS 318


>gi|170664480|gb|ACB28637.1| small subunit ribonucleotide reductase [Myxoma virus]
 gi|170664652|gb|ACB28808.1| small subunit ribonucleotide reductase [recombinant virus
           6918VP60-T2]
          Length = 322

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/330 (29%), Positives = 160/330 (48%), Gaps = 28/330 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++D+ +L    D   + P++Y   W  Y  A  + W P EV +  DL  W+    LT DE
Sbjct: 1   MEDEPVLKESLDRYVVFPIQYNDIWNMYKKAVASFWTPEEVDISKDLKDWRV---LTPDE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS- 137
           +  IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I + 
Sbjct: 58  KYFIKHILAFFAASDGIVNENLAERFYVEVQIAEARCFYGFQIAMENIHSEMYSLLIDTY 117

Query: 138 -LGLDEGE-LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            + L E E LF     +  I  KA W  ++             ++ D  + + L  F  V
Sbjct: 118 IINLQEKEKLFKAIETMDCIKQKAEWVQKW------------IRNKDATYAERLIAFASV 165

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +  KM G+    + I RDE LH +F   +   +K   P     
Sbjct: 166 -EGIFFSGSFAAIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLMFKHLK-HTPS---- 219

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++  +++ EA ++E  +  E +P   +G+N     QY++F+A+R   ++G   +F  
Sbjct: 220 --EERVASIIKEAVVIEQRFLTEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSA 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           T NPF +M E I L+ + NFFE RV++YQ+
Sbjct: 278 T-NPFDFM-ENISLEGKTNFFEKRVSDYQR 305


>gi|167519412|ref|XP_001744046.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778008|gb|EDQ91624.1| predicted protein [Monosiga brevicollis MX1]
          Length = 329

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 154/317 (48%), Gaps = 28/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           +LP+++   W+ Y  A  + W   EV +  DL  W   N L  DE+  IK  L FFA+S+
Sbjct: 22  ILPIQHDAIWKMYKKAEASFWTVEEVDLGRDLVDW---NKLNKDEQFFIKHVLAFFAASD 78

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N+V      +  PE R +   Q   E +HS  +  +I +   D  E   LFN   
Sbjct: 79  GIVNENLVERFMTEVQLPEARCFYGFQIAIENIHSEMYSRLIETYVNDSAEKDSLFNAIE 138

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P++  KA WA+++                D+    +  V +   EG++F   FA I  
Sbjct: 139 TLPAVRRKAEWAMRWISH-------------DKASFGERVVAFAAVEGIFFSGSFAAIFW 185

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   + + +K        +  +++   ++ +A  
Sbjct: 186 LKKRGLMPGLTFSNELISRDEGLHTDFACLMFSMLK-------KRPSKERVTGIIMDAVE 238

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  +    +P G +G+NA   +QY++F+++R    +G E +F  +ENPF +M E I ++
Sbjct: 239 IEQDFLTNALPCGLLGMNATLMKQYIEFVSDRLLVALGCEKIFN-SENPFDFM-ESISIE 296

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV EYQ+  
Sbjct: 297 GKTNFFEKRVGEYQKAG 313


>gi|146418573|ref|XP_001485252.1| hypothetical protein PGUG_02981 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390725|gb|EDK38883.1| hypothetical protein PGUG_02981 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 418

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/327 (30%), Positives = 156/327 (47%), Gaps = 29/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           M N R  V  + P+KY   W+ Y  A  + W   E+ +  D+  W   N L D+ER  I 
Sbjct: 95  MENTRRFV--MFPIKYHEIWKMYKKAEASFWTAEEIDLGKDMHDWN--NRLNDNERYFIS 150

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   D  
Sbjct: 151 RILAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPK 210

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LFN    +P I  KA+WAL++              D D  F + L  F  V EG++
Sbjct: 211 EADFLFNAIENIPCIKKKADWALRWIN------------DDDALFGERLVAFAAV-EGIF 257

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G++   + I RDE LH +F   + +       HL  +   + 
Sbjct: 258 FSGSFASIFWLKKRGLMPGLSFSNELICRDEGLHTDFACLLFS-------HLQNRPDPEI 310

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  +E  +  + +P   +G+N     QY++F+A+R    +G + ++    NPF
Sbjct: 311 VEKIITEAVDIEKEFFTDALPISLLGMNCKLMCQYVEFVADRLLVALGNKKIYNVA-NPF 369

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            +M E I L  + NFFE RV++YQ+  
Sbjct: 370 DFM-ENISLAGKTNFFEKRVSDYQKAG 395


>gi|269798663|ref|YP_003312563.1| ribonucleotide reductase [Veillonella parvula DSM 2008]
 gi|294792661|ref|ZP_06757808.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           6_1_27]
 gi|269095292|gb|ACZ25283.1| ribonucleotide reductase [Veillonella parvula DSM 2008]
 gi|294456560|gb|EFG24923.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           6_1_27]
          Length = 342

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 160/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|77748199|gb|AAI06683.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 161/330 (48%), Gaps = 28/330 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W++   L  +E
Sbjct: 84  IQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWET---LKPEE 140

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 141 RYFISYVLAFFAASDGIVNENLVERFSQEVQVTEVRCFYGFQIAMENIHSEMYSLLIDTY 200

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA W+L++     +P            + + L  F  V
Sbjct: 201 IKDPKEREFLFNAIETLPCVKKKAEWSLRWISDREAP------------YCERLVAFAAV 248

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +         H+  K
Sbjct: 249 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFK-------HVVHK 300

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + +FK 
Sbjct: 301 PSEQRVREIIIDAVKIEQEFLIEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK- 359

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
           +ENPF +M E I L+ + NFFE +V EYQ+
Sbjct: 360 SENPFDFM-ENISLEGKTNFFEKKVGEYQK 388


>gi|303228685|ref|ZP_07315510.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-134-V-Col7a]
 gi|303230495|ref|ZP_07317254.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302514861|gb|EFL56844.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302516665|gb|EFL58582.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-134-V-Col7a]
          Length = 342

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 160/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|156387377|ref|XP_001634180.1| predicted protein [Nematostella vectensis]
 gi|156221260|gb|EDO42117.1| predicted protein [Nematostella vectensis]
          Length = 341

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 159/338 (47%), Gaps = 28/338 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
            + R N +D+ +L        +LP++Y   W+ Y  A  + W   EV +  D   +    
Sbjct: 13  AKSRFNTEDEPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAK-- 70

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L DDER+ +   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  + 
Sbjct: 71  -LNDDERMFVSHVLAFFAASDGIVNENLVECFSQEVQIPEARCFYGFQIAIENIHSEMYS 129

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I SL  D+ E   LFN    +P +  KA+WAL +     +             F + +
Sbjct: 130 LLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRA------------SFGERI 177

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
             F  V EG++F   FA I  L +   M G+    + I RDE LH +F         +  
Sbjct: 178 IAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC-------LMY 229

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
            +L  K  ++  R ++ +A ++E  +    +P   +G+N     QY++F+A+R    +  
Sbjct: 230 KYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNC 289

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           + ++   ENPF +M E I L+ + NFFE RV EYQ+  
Sbjct: 290 QKVYN-VENPFDFM-ENISLEGKTNFFEKRVGEYQKSG 325


>gi|4557845|ref|NP_001025.1| ribonucleoside-diphosphate reductase subunit M2 isoform 2 [Homo
           sapiens]
 gi|400979|sp|P31350|RIR2_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|36155|emb|CAA42181.1| small subunit ribonucleotide reductase [Homo sapiens]
 gi|251637|gb|AAA09577.1| ribonucleotide reductase R2 subunit [Homo sapiens]
 gi|12804875|gb|AAH01886.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|14029165|gb|AAK51163.1| ribonucleotide reductase M2 subunit [Homo sapiens]
 gi|20988810|gb|AAH30154.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|62702173|gb|AAX93099.1| unknown [Homo sapiens]
 gi|123981920|gb|ABM82789.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|123996753|gb|ABM85978.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|189053955|dbj|BAG36462.1| unnamed protein product [Homo sapiens]
 gi|261861600|dbj|BAI47322.1| ribonucleotide reductase M2 [synthetic construct]
          Length = 389

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 159/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
            V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +
Sbjct: 66  GVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPE 122

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 123 ERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT 182

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 183 YIKDPKEREFLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 229

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 230 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 282

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 283 KPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR 342

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 343 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 371


>gi|327261311|ref|XP_003215474.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 2 [Anolis carolinensis]
          Length = 390

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 157/331 (47%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N  D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  D
Sbjct: 67  NAQDEPLLRDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKPD 123

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 124 EKYFISHILAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLIDT 183

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WA+++           G K A      +  V + 
Sbjct: 184 YIKDPKEREYLFNAIETLPCVKRKADWAMRWI----------GDKHAT---YGERVVAFA 230

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 231 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   ++K
Sbjct: 284 KPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 344 -AENPFDFM-ENISLEGKTNFFEKRVGEYQR 372


>gi|194690416|gb|ACF79292.1| unknown [Zea mays]
 gi|194704028|gb|ACF86098.1| unknown [Zea mays]
 gi|195619132|gb|ACG31396.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
 gi|223943167|gb|ACN25667.1| unknown [Zea mays]
          Length = 339

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 153/327 (46%), Gaps = 28/327 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L   SD   + P++Y   WE Y  A  + W   EV +  D   W +   L+ DER  I 
Sbjct: 17  LLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWDA--ALSPDERHFIS 74

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL---GL 140
             L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +    G 
Sbjct: 75  HVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIRDGT 134

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           ++  LF     VP++  KA+WA+++              D  + F + L  F  V EG++
Sbjct: 135 EKDRLFRAIETVPAVRRKADWAMRWI-------------DGGERFAERLVAFACV-EGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   F  I  L +   M G+    + I RDE LH +F   + + ++        K  + +
Sbjct: 181 FSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESR 233

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++    NPF
Sbjct: 234 VREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYN-VANPF 292

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGA 347
            WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 293 DWM-ELISLQGKTNFFEKRVGEYQKAS 318


>gi|68481406|ref|XP_715342.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|68481537|ref|XP_715277.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436893|gb|EAK96248.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436961|gb|EAK96315.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|238882096|gb|EEQ45734.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           albicans WO-1]
          Length = 413

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 150/317 (47%), Gaps = 27/317 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P++Y   W  Y  A  + W   E+ +  DL  W +K  L ++ER  I R L FFA+S+
Sbjct: 102 MFPIRYHEIWNFYKKAEASFWTAEEIDLSKDLDDWNNK--LNENERYFISRVLAFFAASD 159

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYR 150
            +V  N++      +  PE + +   Q   E +HS T+  +I +   D  E   LFN   
Sbjct: 160 GIVGENLIENFSTEVQLPEAKSFYGFQIMMENIHSETYSLLIETYIKDPQEADYLFNAIA 219

Query: 151 EVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILS 210
            +P I  KA+WA+++ Q              D+    +  V +   EG++F   FA I  
Sbjct: 220 NIPCIQKKADWAIKWIQD-------------DEALYGERLVAFAAVEGIFFSGSFASIFW 266

Query: 211 LGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATL 270
           L +   M G+    + I RDE LH +F   +         HL  +   +    ++ EA  
Sbjct: 267 LKKRGLMPGLTFSNELICRDEGLHTDFACLLF-------AHLQNRPSPEIVERIITEAVD 319

Query: 271 LEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLK 330
           +E  Y  + +P   +G+N     QY++F+A+R    +G + ++  T NPF +M E I L 
Sbjct: 320 VEKEYFTDALPVSLLGMNCNLMCQYIEFVADRLLLALGNKKVYNVT-NPFDFM-ENISLA 377

Query: 331 KEKNFFETRVTEYQQGA 347
            + NFFE RV++YQ+  
Sbjct: 378 GKTNFFEKRVSDYQKAG 394


>gi|168179222|ref|ZP_02613886.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum NCTC 2916]
 gi|182669722|gb|EDT81698.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum NCTC 2916]
          Length = 342

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 166/321 (51%), Gaps = 18/321 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYSWASDFYRTMLNNFWIPEEISLNEDI---KQFPYLTDGERNAFDKIISFLNFLDSVQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   I R+++  E    L  Q F+E +H+ ++ YI+ ++   +   ++++ +RE   
Sbjct: 89  SENLP-NISRYITAAEVSSLLNIQTFQEEIHAQSYSYILDTVTNPITRDKIYDQWREDEH 147

Query: 155 ITAKANW-ALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
           +  +  + A  Y +    P            FL+ +   Y++ EG++FY+GF+   +L R
Sbjct: 148 LLERNKFIAGIYEKFNKEPEI--------HNFLRVIMANYIL-EGIYFYSGFSFFYTLAR 198

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             K+   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI
Sbjct: 199 QGKLTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRIGVEHEI 258

Query: 274 AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKE 332
            +         +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   
Sbjct: 259 QWGQYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNST 318

Query: 333 K-NFFETRVTEYQQGAELKWD 352
           K +FFE +VT Y + A   +D
Sbjct: 319 KTDFFEAKVTNYTKAAAFDFD 339


>gi|238018468|ref|ZP_04598894.1| hypothetical protein VEIDISOL_00295 [Veillonella dispar ATCC 17748]
 gi|237864939|gb|EEP66229.1| hypothetical protein VEIDISOL_00295 [Veillonella dispar ATCC 17748]
          Length = 342

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 160/320 (50%), Gaps = 16/320 (5%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +KY WA + Y +  NN W+P E+ + +D+   K    LTD ER    + + F    +S+ 
Sbjct: 32  IKYDWANQMYRTMLNNFWIPEEISLNEDV---KQFPYLTDYERRAFDKIIAFLNFLDSIQ 88

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG--LDEGELFNMYREVPS 154
           + N+   + R+++  E    L  QAF+E +H+ ++ YI+ ++   +   ++++ +R   +
Sbjct: 89  SENLP-NLSRYITASEVASLLNIQAFQEEIHAQSYSYILDTVTNPITRDKIYDEWRTDKT 147

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  +  +     Q  S         D  +  L    +   + EG++FY+GF+   +L R 
Sbjct: 148 LLERNRFIADAYQRFSD--------DPSEANLIHTIIANYILEGIYFYSGFSFFYTLARQ 199

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            KM   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA
Sbjct: 200 GKMTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIA 259

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK 333
           +         +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K
Sbjct: 260 WGQYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTK 319

Query: 334 -NFFETRVTEYQQGAELKWD 352
            +FFE +VT Y + A   +D
Sbjct: 320 TDFFEAKVTNYTKAAAFDFD 339


>gi|269958883|ref|YP_003328672.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           centrale str. Israel]
 gi|269848714|gb|ACZ49358.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           centrale str. Israel]
          Length = 332

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 162/325 (49%), Gaps = 26/325 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P  Y WA++ +L     HW+P EVP+ DD+  WK+K  L++ E+ ++ +   FF  ++ +
Sbjct: 20  PFYYPWAYDAWLCQQRIHWIPEEVPLADDVQDWKTK--LSEQEKNLLVQIFRFFTQAD-I 76

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFE--EAVHSHTFQYIITSLGLDEGELFNMYREVP 153
             NN  +  Y ++  P     ++  AF   E VH   + Y++ ++G+ E E +  + +  
Sbjct: 77  EVNNCYMKHYSNIFKP-TEICMMLSAFSNMETVHIAAYSYLLDTIGMPEVE-YQAFLKFE 134

Query: 154 SITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGR 213
            +  K ++  ++ ++          K   +   + L VF    EG+  +  FA +L+  R
Sbjct: 135 VMKKKYDYMQRFEES---------RKGDKRHVAKTLAVFGAFTEGLQLFASFAILLNFQR 185

Query: 214 ANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 273
             KM G+ +   +  RDE+LH    I + N    EN  +W        R  L+ A  + +
Sbjct: 186 FGKMKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDANL----RAELYGACRVIV 241

Query: 274 AYAHETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID 328
           +   E +   F      GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++
Sbjct: 242 SLEDEFIDLAFALGDVEGLSASEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILN 301

Query: 329 LKKEKNFFETRVTEYQQGA-ELKWD 352
             +  NFFE RVTEY + A E  WD
Sbjct: 302 GVEHTNFFENRVTEYSRAATEGTWD 326


>gi|119621373|gb|EAX00968.1| hCG23833, isoform CRA_b [Homo sapiens]
 gi|119621374|gb|EAX00969.1| hCG23833, isoform CRA_b [Homo sapiens]
          Length = 449

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 159/331 (48%), Gaps = 28/331 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
            V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +
Sbjct: 126 GVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPE 182

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 183 ERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT 242

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WAL++           G K+A      +  V + 
Sbjct: 243 YIKDPKEREFLFNAIETMPCVKKKADWALRWI----------GDKEAT---YGERVVAFA 289

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +         HL  
Sbjct: 290 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK-------HLVH 342

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+
Sbjct: 343 KPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR 402

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 345
             ENPF +M E I L+ + NFFE RV EYQ+
Sbjct: 403 -VENPFDFM-ENISLEGKTNFFEKRVGEYQR 431


>gi|327298815|ref|XP_003234101.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
 gi|326464279|gb|EGD89732.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
          Length = 408

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 149/317 (47%),