PSIBLAST alignment of GI: 254780845 and protein with PDB id: 1jk0

>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer Length = 419
 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 94  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 151

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 152 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 211

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 212 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 258

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 259 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 313

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 314 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 370

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 371 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 403