PSIBLAST alignment of GI: 254780845 and protein with PDB id: 3mjo

>gi|304445906|pdb|3MJO|A Chain A, Small Subunit (R2f) Of Native Ribonucleotide Reductase From Corynebacterium Ammoniagenes Length = 296
>gi|304445907|pdb|3MJO|B Chain B, Small Subunit (R2f) Of Native Ribonucleotide Reductase From Corynebacterium Ammoniagenes Length = 296
 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/290 (18%), Positives = 108/290 (37%), Gaps = 26/290 (8%)

Query: 30  DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFF 89
           + N +   K    W+       N W+P ++P+ +D+  W   N +T  E+L   R     
Sbjct: 19  NWNVIPDEKDLEVWD---RLTGNFWLPEKIPVSNDIQSW---NKMTPQEQLATMRVFTGL 72

Query: 90  ASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG--ELFN 147
              +++      +++                AF E+VH+ ++  I  +L       E F 
Sbjct: 73  TLLDTIQGTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFR 132

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
              E  ++  KA   + Y                             + E   FY+GF  
Sbjct: 133 WSEENENLQRKAKIIMSYYNGDDPLKKKV---------------ASTLLESFLFYSGFYL 177

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
            + L    K+   A+  + I+RDES+H  +      Q   +      +E++  +  ++++
Sbjct: 178 PMYLSSRAKLTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYD 237

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
               EI Y  +      +G      ++++++ AN+  + +G E LF   E
Sbjct: 238 LYENEIEYTEDIYDD--LGWT-EDVKRFLRYNANKALNNLGYEGLFPTDE 284