BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate
reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62]
         (352 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|288941383|ref|YP_003443623.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
 gi|288896755|gb|ADC62591.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
          Length = 458

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 232/349 (66%), Positives = 283/349 (81%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  +  G  RV VDDKR++N R+D+NQL+P KY WAW+KYL AC NHWMP E+ M  
Sbjct: 110 ATGLESLAMGASRVRVDDKRIINCRADLNQLVPFKYDWAWQKYLDACANHWMPQEISMNA 169

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DLALWK  +GLT+DERL++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 170 DLALWKDPHGLTEDERLIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 229

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QY++ SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ
Sbjct: 230 EALHTHAYQYVVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPHFQTGTPENDQ 289

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYI+RDES+H+NFGIDVIN
Sbjct: 290 KLLRELVAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYILRDESMHMNFGIDVIN 349

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+Q+   M+ EA  LE  YAH+TMP+G +GLNA   E Y+ FIANRR
Sbjct: 350 QIKIENPHLWTPEFRQELVGMIREAVELEARYAHDTMPRGVLGLNAQMFEDYLHFIANRR 409

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 410 CAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALNWD 458


>gi|53804295|ref|YP_114081.1| ribonucleotide-diphosphate reductase subunit beta [Methylococcus
           capsulatus str. Bath]
 gi|53758056|gb|AAU92347.1| ribonucleoside-diphosphate reductase, beta subunit [Methylococcus
           capsulatus str. Bath]
          Length = 403

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 229/349 (65%), Positives = 286/349 (81%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  I+ G +R+ VDDKR++N R+D+NQL+P KY WAW+KYL AC NHWMP E+ M  
Sbjct: 55  ATGLENIEMGARRIQVDDKRIINCRADLNQLVPFKYQWAWQKYLDACANHWMPQEINMNA 114

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWKS +GLT DER++IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 115 DIALWKSADGLTPDERIIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 174

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QY++ SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ
Sbjct: 175 EALHTHAYQYVVESLGLDEGEVFNMYREVPAVARKAEWALPFTQYLADPYFKTGTPENDQ 234

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVIN
Sbjct: 235 KLLRELIAFYVIFEGIFFYVGFTQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVIN 294

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENPHLWT  F+ +   M+ EA  +E  YA++TMP+G +GLNAP  ++Y+QFIANRR
Sbjct: 295 QIKVENPHLWTDGFKVEMVQMIREAVDIETQYAYDTMPRGILGLNAPMFKEYLQFIANRR 354

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 355 CAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGTLSWD 403


>gi|300113307|ref|YP_003759882.1| ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
 gi|299539244|gb|ADJ27561.1| Ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
          Length = 412

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 231/347 (66%), Positives = 284/347 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYLS C NHWMP E+ M  D+
Sbjct: 66  GVEDIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLSGCANHWMPQEINMNADI 125

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 126 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 185

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 186 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPQFHTGTAENDQKL 245

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 246 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 305

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW+  F+Q++  M+ EA  LE  YAH+TMP+G +GLNAP  E+Y++FIANRRC 
Sbjct: 306 KLENPHLWSDSFKQETLRMIQEAVSLETQYAHDTMPRGVLGLNAPMFEEYLKFIANRRCA 365

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 366 QIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|312795100|ref|YP_004028022.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           rhizoxinica HKI 454]
 gi|312166875|emb|CBW73878.1| Ribonucleoside-diphosphate reductase beta chain (EC 1.17.4.1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 416

 Score =  352 bits (903), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 220/351 (62%), Positives = 269/351 (76%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
              +  SP  A E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M
Sbjct: 66  DQQSNASPAPAPEARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINM 125

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK  NGLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 126 SRDIALWKDPNGLTDDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 185

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ PSF TGT +A
Sbjct: 186 FEEAIHTHAYQYIVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPSFKTGTLEA 245

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ+ L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+
Sbjct: 246 DQKLLKSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDL 305

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK+ENPHLWT  F+++   +   A  LE  YA +TMP+G +GLNA   + Y++FI N
Sbjct: 306 INQIKLENPHLWTPAFREEICGLFKHAVELEYRYAEDTMPRGVLGLNAGMFKSYLRFICN 365

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 366 RRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 416


>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040522|gb|ACT57318.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040641|gb|ACT57437.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 352

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 352/352 (100%), Positives = 352/352 (100%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP
Sbjct: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ
Sbjct: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD
Sbjct: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID
Sbjct: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA
Sbjct: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD
Sbjct: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352


>gi|220935777|ref|YP_002514676.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997087|gb|ACL73689.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 408

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 226/349 (64%), Positives = 287/349 (82%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           NTGL  I+ G +R+ VDDK+++N R+D+NQL+P KY WAW+KYL  C NHWMP E+ M  
Sbjct: 60  NTGLEDIELGAERIRVDDKKIINCRADLNQLVPFKYQWAWQKYLDGCANHWMPQEINMNA 119

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT+DER ++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 120 DIALWKDPNGLTEDERTIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 179

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +T+ L+ P F TGT + DQ
Sbjct: 180 EALHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTRYLADPDFHTGTPENDQ 239

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L++L  FYV+FEG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVIN
Sbjct: 240 KLLRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGVAEQFQYILRDESMHMNFGIDVIN 299

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENPHLWT  F+++ RTM+ +A  LE  YA +TMP+G +G+NA   E+Y+ FIANRR
Sbjct: 300 QIKVENPHLWTAAFKEEMRTMIRDAVELEAQYARDTMPRGVLGMNAAMFEEYLHFIANRR 359

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL  ++   ENPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 360 CAQIGLAEIYPGAENPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 408


>gi|77165986|ref|YP_344511.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosococcus
           oceani ATCC 19707]
 gi|254436303|ref|ZP_05049809.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
 gi|76884300|gb|ABA58981.1| Ribonucleoside-diphosphate reductase [Nitrosococcus oceani ATCC
           19707]
 gi|207087993|gb|EDZ65266.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
          Length = 412

 Score =  350 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 231/347 (66%), Positives = 284/347 (81%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYLS C NHWMP E+ M  D+
Sbjct: 66  GVEDIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLSGCANHWMPQEINMNADI 125

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 126 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 185

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 186 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQHLADPQFHTGTAENDQKL 245

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 246 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 305

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           K+ENPHLW+  F+Q++  M+ EA  LE  YAH+TMP+G +GLNAP  E+Y++FIANRRC 
Sbjct: 306 KLENPHLWSDSFKQETLRMIQEAVSLETQYAHDTMPRGVLGLNAPMFEEYLKFIANRRCA 365

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 366 QIGLPEQYPGASNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|307731037|ref|YP_003908261.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
 gi|307585572|gb|ADN58970.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
          Length = 411

 Score =  349 bits (894), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 218/358 (60%), Positives = 270/358 (75%), Gaps = 7/358 (1%)

Query: 2   ANNTGLSPIQAGEK-------RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHW 54
           AN+  ++P+  G         RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHW
Sbjct: 54  ANDIAVAPVARGAGTAAVSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHW 113

Query: 55  MPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECR 114
           MP EV M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECR
Sbjct: 114 MPQEVNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECR 173

Query: 115 QYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSF 174
           Q+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P F
Sbjct: 174 QFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYINVLTDPGF 233

Query: 175 TTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLH 234
            TGT + DQ  L+ L VF  V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H
Sbjct: 234 KTGTLETDQTLLRSLIVFACVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMH 293

Query: 235 LNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQ 294
            NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + 
Sbjct: 294 CNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKS 353

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 354 YLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 411


>gi|148546452|ref|YP_001266554.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida F1]
 gi|148510510|gb|ABQ77370.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida F1]
          Length = 415

 Score =  348 bits (893), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|292490774|ref|YP_003526213.1| ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
 gi|291579369|gb|ADE13826.1| Ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  348 bits (893), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 230/347 (66%), Positives = 285/347 (82%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           G+  I+ G  R+ VDDKR++N R+D+NQL+P KY WAWEKYL+ C NHWMP E+ M  D+
Sbjct: 69  GIENIEMGAARIQVDDKRIINCRADLNQLVPFKYHWAWEKYLNGCANHWMPQEINMNADI 128

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALWKS +GLT+DER +IKRNLGFF +++SLVANN+VLA+YRH++NPECRQYLLRQAFEEA
Sbjct: 129 ALWKSADGLTEDERTIIKRNLGFFVTADSLVANNLVLAVYRHITNPECRQYLLRQAFEEA 188

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+H +QY + SLGLDEGE+FNMYREVP++  KA WAL +TQ L+ P F TGT + DQ+ 
Sbjct: 189 VHTHAYQYCVESLGLDEGEIFNMYREVPAVARKAEWALPFTQYLADPQFHTGTDENDQKL 248

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L++L  FYV+FEG++FY GF QILS+GR NKM G AEQ+QYIMRDES+H+NFGIDVINQI
Sbjct: 249 LRELIAFYVIFEGIFFYVGFVQILSMGRRNKMTGTAEQFQYIMRDESMHMNFGIDVINQI 308

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLWT  F+Q++  M+ EA  LE  YA++TMP+G +GLNAP  ++Y++FIANRRC 
Sbjct: 309 KIENPHLWTDSFKQETIQMIREAVSLETQYAYDTMPRGVLGLNAPMFDEYLKFIANRRCA 368

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           QIGL   +    NPFPWMSE++DLKKEKNFFETRVTEYQ G  LKWD
Sbjct: 369 QIGLPEQYPGASNPFPWMSEILDLKKEKNFFETRVTEYQTGGALKWD 415


>gi|226945386|ref|YP_002800459.1| ribonucleotide-diphosphate reductase subunit beta [Azotobacter
           vinelandii DJ]
 gi|226720313|gb|ACO79484.1| Ribonucleoside-diphosphate reductase beta subunit [Azotobacter
           vinelandii DJ]
          Length = 416

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP E+ 
Sbjct: 65  LDIREGLEDLEGAAARVRVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEIN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GLT+DER +IKRNLGFF++++SLVANN+ LAIYR ++NPECRQY+LRQ
Sbjct: 125 MNADIALWKSADGLTEDERRIIKRNLGFFSTADSLVANNLALAIYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFDTGTPE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++ L++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDRQLLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 MINQIKIENPHLWDAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNATMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLSQLGLPEQYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|91785256|ref|YP_560462.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           xenovorans LB400]
 gi|91689210|gb|ABE32410.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans
           LB400]
          Length = 411

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 264/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 73  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 132

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 133 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 192

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF 
Sbjct: 193 IVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFA 252

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 253 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 312

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 313 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 372

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 373 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 411


>gi|330811278|ref|YP_004355740.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379386|gb|AEA70736.1| Ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 415

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 216/352 (61%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTPD 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium
           sp. BNC1]
 gi|110286020|gb|ABG64079.1| ribonucleotide reductase [Chelativorans sp. BNC1]
          Length = 369

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 273/351 (77%), Positives = 304/351 (86%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + TGL  I+ G  RV+VDDKRM+NAR+DVNQLLPLKY WAWEKYLS CNNHWMPTEV M
Sbjct: 19  TDATGLGTIERGAGRVSVDDKRMINARADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSM 78

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS++GLT+DER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 79  QADIALWKSRDGLTEDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 138

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL+YT+ L  P+F TGT +A
Sbjct: 139 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALEYTRHLDDPNFRTGTPEA 198

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 199 DQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 258

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK ENPHLWT EFQ++ R ML +A  LE AY  +TMP+GF+GLNA  CEQYM FIAN
Sbjct: 259 INQIKHENPHLWTPEFQEELRRMLKDAAELEAAYGRDTMPRGFLGLNAGQCEQYMHFIAN 318

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 319 RRCAQLGLPPVFPETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWD 369


>gi|293609145|ref|ZP_06691448.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
 gi|292829718|gb|EFF88080.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
          Length = 427

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|209885874|ref|YP_002289731.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874070|gb|ACI93866.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
          Length = 377

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 273/351 (77%), Positives = 299/351 (85%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A  TGL  I     RV+VD+KRM+N R+DVNQLLPLKY WAWEKYLS CNNHWMPTEV M
Sbjct: 27  AEQTGLGEIDRTGGRVSVDEKRMINCRADVNQLLPLKYKWAWEKYLSGCNNHWMPTEVSM 86

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 87  QADIALWKSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 146

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +A
Sbjct: 147 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTKNLDDPDFKTGTLEA 206

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 207 DQAFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 266

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK+ENPHLWTK FQ + R M+ EA  LE AY  +TMP+GF+GLNA  CEQYM FIAN
Sbjct: 267 INQIKLENPHLWTKAFQDEVRGMISEAAGLEAAYGRDTMPRGFLGLNAALCEQYMHFIAN 326

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 327 RRCAQIGLAPVFAETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWD 377


>gi|296160506|ref|ZP_06843322.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
 gi|295889255|gb|EFG69057.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
          Length = 415

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 264/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 77  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 136

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 137 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 196

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF 
Sbjct: 197 IVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFA 256

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 257 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 316

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 317 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 376

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 377 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 415


>gi|192360823|ref|YP_001982048.1| ribonucleotide-diphosphate reductase subunit beta [Cellvibrio
           japonicus Ueda107]
 gi|190686988|gb|ACE84666.1| ribonucleoside reductase, beta subunit [Cellvibrio japonicus
           Ueda107]
          Length = 429

 Score =  346 bits (888), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 222/352 (63%), Positives = 285/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 78  LDPAPGLEELEMGAARIQVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 137

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKSK+GLT+DER ++ R+LG+F++++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 138 MTADIALWKSKDGLTEDERRIVMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYILRQ 197

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           +FEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W+L +T +L +P+FTTGT +
Sbjct: 198 SFEEAIHTHAYQYCIESLGMDEGEVFNMYRELPSVANKAAWSLHHTHSLGNPTFTTGTPE 257

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FYVV EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 258 TDQELLRNLVAFYVVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 317

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT EFQQ+   M+ E T LEI YA ++MP+G +G+NA   E+Y+ FIA
Sbjct: 318 VINQIKLENPHLWTAEFQQEVLQMILEGTELEIQYARDSMPRGVLGMNAAMMEEYLHFIA 377

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC Q+GL+  F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 378 NRRCAQLGLKEQFPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 429


>gi|70731866|ref|YP_261608.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf-5]
 gi|68346165|gb|AAY93771.1| ribonucleoside-diphosphate reductase, beta subunit, putative
           [Pseudomonas fluorescens Pf-5]
          Length = 415

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 216/352 (61%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDIAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVD 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|161525957|ref|YP_001580969.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|160343386|gb|ABX16472.1| Ribonucleoside-diphosphate reductase [Burkholderia multivorans ATCC
           17616]
          Length = 396

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 53  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 112

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 113 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 172

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 173 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 232

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 233 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 292

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 293 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 352

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 353 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 396


>gi|88812072|ref|ZP_01127324.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790576|gb|EAR21691.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
          Length = 370

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 220/348 (63%), Positives = 278/348 (79%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL   + G  R+ VDDKR++N R+D+NQL+P KY WAWEKYL    NHWMP E+PM  D
Sbjct: 23  TGLDAPERGAARIRVDDKRIINCRADLNQLVPFKYHWAWEKYLQGSANHWMPQEIPMGRD 82

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           + LWK ++GLT+DER ++KR+LGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 83  IELWKRRDGLTEDERTIVKRSLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 142

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY+I SL +DEGE+FNMYREVPS+  KA WAL +T++L  P F TGT  ADQ 
Sbjct: 143 ALHTHAYQYVIESLAMDEGEVFNMYREVPSVARKAEWALPFTESLGDPDFRTGTPAADQR 202

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYV FEG++FYTGFAQ+L++GR NKM G AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 203 LLRDLIAFYVCFEGIFFYTGFAQVLAMGRRNKMTGTAEQFQYILRDESIHLNFGIDVINQ 262

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK ENPHLWT EFQ  ++  + E+  LE+ YA +T+P+G +GLNA   E+Y++FI NRR 
Sbjct: 263 IKQENPHLWTAEFQATAQRTILESMALEVDYARDTLPRGVLGLNAAMIEEYLRFITNRRL 322

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   F   ENP PWMSE++DLKKEKNFFETRVTEY+ G  L W+
Sbjct: 323 AQIGLTEAFPGAENPLPWMSELVDLKKEKNFFETRVTEYRTGGALSWE 370


>gi|82703584|ref|YP_413150.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosospira
           multiformis ATCC 25196]
 gi|82411649|gb|ABB75758.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 408

 Score =  345 bits (885), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 217/339 (64%), Positives = 272/339 (80%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV+V+DKR++N ++DVNQL+P KY WAWEKYL+AC NHWMP E+ M  D+ALWK  NG
Sbjct: 70  HRRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLAACANHWMPQEINMSRDIALWKDPNG 129

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QY
Sbjct: 130 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHVTNPECRQYLLRQAFEEAIHTHAYQY 189

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI  K  + + +  TL+ PSF TGT +ADQ+ L+ L VF 
Sbjct: 190 IVESLGLDEGEIFNAYHEVRSIREKDEFLIPFIDTLTDPSFRTGTLEADQKLLKSLIVFA 249

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDV+NQIK+ENPHLW
Sbjct: 250 CIMEGLFFYVGFIQILALGRQNKMTGSAEQYQYILRDESMHCNFGIDVVNQIKMENPHLW 309

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           TKEF+ +   ++ +A  LE  YA +TMP+G +GLNAP  ++Y+++IANRRC QIGL+ L+
Sbjct: 310 TKEFRSEISALMQKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRYIANRRCQQIGLDILY 369

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 370 PGASNPFPWMSEMIDLKKEKNFFETRVTEYQTGGVLNWD 408


>gi|88705571|ref|ZP_01103281.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
 gi|88700084|gb|EAQ97193.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
          Length = 469

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 216/352 (61%), Positives = 279/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  RV++D+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV 
Sbjct: 118 LDVAPGLEELEMGASRVSIDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVN 177

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK+  GLTDDER ++ R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 178 MTADVATWKNPEGLTDDERRIVLRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQ 237

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +T  LS P+F TGT +
Sbjct: 238 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSISHTHELSDPNFRTGTLE 297

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           +DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 298 SDQTLLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 357

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENP LWT+EF+Q++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIA
Sbjct: 358 VINQIKLENPQLWTEEFKQEAIQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFIA 417

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 418 NRRLSQIGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 469


>gi|110833571|ref|YP_692430.1| ribonucleotide-diphosphate reductase subunit beta [Alcanivorax
           borkumensis SK2]
 gi|110646682|emb|CAL16158.1| ribonucleoside reductase, beta subunit [Alcanivorax borkumensis
           SK2]
          Length = 430

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 221/352 (62%), Positives = 279/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    G++ ++    RV VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 79  MDIEDGVAELEGAAGRVEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 138

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  DLALWK  +GLTDDER ++KRNLGFFA+++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 139 MNADLALWKKADGLTDDERRIVKRNLGFFATADSLVANNLVLAIYRLITNPECRQYILRQ 198

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           +FEEA+H+H +QY I SLG+DEGE+FNMY+E+PS+  KA W +QYT+ LS P FTTGT +
Sbjct: 199 SFEEAIHTHAYQYCIESLGMDEGEIFNMYQEIPSVAKKAQWGIQYTRDLSDPEFTTGTPE 258

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGID
Sbjct: 259 TDKALLENLIAFYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHVNFGID 318

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLW  + + K+  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIA
Sbjct: 319 VINQIKLENPHLWDAQMRDKATQMILEGTELEIQYARDTMPRGVLGMNAAMMEEYLQFIA 378

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   FK   NPFPWMSE++DL+KEKNFFETRVTEYQ G  L W+
Sbjct: 379 NRRLAQLGLPEQFKGVNNPFPWMSEIMDLRKEKNFFETRVTEYQVGGALSWE 430


>gi|187925407|ref|YP_001897049.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phytofirmans PsJN]
 gi|187716601|gb|ACD17825.1| Ribonucleoside-diphosphate reductase [Burkholderia phytofirmans
           PsJN]
          Length = 415

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 264/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 77  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 136

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 137 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 196

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF 
Sbjct: 197 IVESLGLDEGEIFNAYHEVSSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFA 256

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 257 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 316

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 317 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 376

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 377 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 415


>gi|256377255|ref|YP_003100915.1| ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
 gi|255921558|gb|ACU37069.1| Ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
          Length = 358

 Score =  345 bits (884), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 265/347 (76%), Positives = 296/347 (85%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
           GL  I+ G  RV+VDDK M+NAR+DVNQLLPLKY WAWEKYL+ C NHWMPTEV MQ D+
Sbjct: 12  GLGEIERGAGRVHVDDKAMINARADVNQLLPLKYHWAWEKYLAGCANHWMPTEVSMQADI 71

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
           ALW+S NGLT DER  IKRNLGFFA+SESLVANN+VLA+YR+++NPECRQYLLRQAFEEA
Sbjct: 72  ALWRSPNGLTADERHAIKRNLGFFATSESLVANNVVLAVYRNITNPECRQYLLRQAFEEA 131

Query: 126 VHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
           VH+HTF+YI +SLGLDEGELFNMYREVPSIT KA WAL+YT++L  P F TGT +ADQ F
Sbjct: 132 VHTHTFEYICSSLGLDEGELFNMYREVPSITDKAAWALKYTKSLEDPEFRTGTPEADQAF 191

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
           L+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID INQI
Sbjct: 192 LRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDAINQI 251

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
           KIENPHLW + FQ + RTML EA  LEIAY  +TMP G +GLNA  CEQYM+FI NRRC 
Sbjct: 252 KIENPHLWGEAFQAEVRTMLAEACELEIAYGRDTMPNGLLGLNAELCEQYMRFITNRRCA 311

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q+GLEP+F  TENPFPWMSE +DLKKEKNFFETRVTEY  G  L WD
Sbjct: 312 QLGLEPVFAATENPFPWMSEAVDLKKEKNFFETRVTEYASGGTLDWD 358


>gi|262376783|ref|ZP_06070011.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
 gi|262308493|gb|EEY89628.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
          Length = 427

 Score =  344 bits (883), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 282/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFKTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQILLRNLIAFYCVLEGIFFYCGFSQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENP LWT EFQ++   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FIA
Sbjct: 317 MINQIKIENPGLWTTEFQEEIIQMILEGTMLEIEYARDTMPRGVLGMNAGMMEEYLKFIA 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLAQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|170699976|ref|ZP_02891003.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
 gi|170135124|gb|EDT03425.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
          Length = 403

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAAGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|115350552|ref|YP_772391.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria AMMD]
 gi|172059584|ref|YP_001807236.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria MC40-6]
 gi|115280540|gb|ABI86057.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria AMMD]
 gi|171992101|gb|ACB63020.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           MC40-6]
          Length = 403

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAAGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida
           fusca YX]
 gi|71917133|gb|AAZ57035.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
          Length = 354

 Score =  344 bits (883), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 274/350 (78%), Positives = 309/350 (88%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           N TGL  IQ+G  RV+V+DKRM+N+R+DVNQLLPLKY WAWEKYL+ACNNHWMPTEV MQ
Sbjct: 5   NTTGLGEIQSGAARVDVEDKRMINSRADVNQLLPLKYRWAWEKYLAACNNHWMPTEVSMQ 64

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWKSK+GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YRHL+NPECRQYLLRQAF
Sbjct: 65  ADIALWKSKDGLTEDERLMVKRNLGFFATAESLVANNIVLAVYRHLTNPECRQYLLRQAF 124

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI  SLGLDEGELFNMYREVPSITAK  WAL+YT+ L +P+FTTGT +AD
Sbjct: 125 EEAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALRYTRNLENPNFTTGTPEAD 184

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL+DL  FYVV EGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 185 QAFLRDLVAFYVVLEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVI 244

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENPHLWT+EFQ + RTML EA  LE AY  ETMP+G +GLNA  CEQYM+FI +R
Sbjct: 245 NQIKIENPHLWTEEFQDEVRTMLIEACELEAAYGRETMPRGILGLNAKLCEQYMRFITDR 304

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           R  Q+GL P+F  TENPFPWMSE++DLKKEKNFFETRV EYQ G+ L WD
Sbjct: 305 RAEQLGLAPIFGETENPFPWMSEMMDLKKEKNFFETRVIEYQTGSGLSWD 354


>gi|169797064|ref|YP_001714857.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AYE]
 gi|213156529|ref|YP_002318190.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|215484526|ref|YP_002326761.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|239501302|ref|ZP_04660612.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB900]
 gi|260555643|ref|ZP_05827863.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|301345633|ref|ZP_07226374.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB056]
 gi|301512780|ref|ZP_07238017.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB058]
 gi|301596291|ref|ZP_07241299.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB059]
 gi|169149991|emb|CAM87885.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AYE]
 gi|193076530|gb|ABO11186.2| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055689|gb|ACJ40591.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|213987168|gb|ACJ57467.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|260410554|gb|EEX03852.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
          Length = 427

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|260551040|ref|ZP_05825245.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
 gi|260405988|gb|EEW99475.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
          Length = 427

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|325272776|ref|ZP_08139120.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
 gi|324102083|gb|EGB99585.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
          Length = 416

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|77460516|ref|YP_350023.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf0-1]
 gi|77384519|gb|ABA76032.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens Pf0-1]
          Length = 416

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 276/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAEMKEEASQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|50083944|ref|YP_045454.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. ADP1]
 gi|49529920|emb|CAG67632.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           sp. ADP1]
          Length = 427

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 221/351 (62%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  I+ G  RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDITAGLQEIETGAARVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER+++KRNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERVIVKRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YTQ+LS P F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVARKAAWGLKYTQSLSDPKFETGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L++L  FY V EG++FY GF QILS+GR NKM G++EQ+QYI+RDES+H+NFGID
Sbjct: 257 TDQQLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVSEQFQYILRDESMHVNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E TLLEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMIVEGTLLEIEYARDTMPRGVLGMNAAMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   ++   NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLAQLGLPEQYRGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|289208615|ref|YP_003460681.1| ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
 gi|288944246|gb|ADC71945.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
          Length = 412

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 225/350 (64%), Positives = 288/350 (82%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
             TGL  ++ G +R+ VDDK+++N  +D+NQL+P KY WAW+KYL  C NHWMP E+ M 
Sbjct: 63  TGTGLEDLEMGAERIRVDDKKIINCHADLNQLVPFKYKWAWQKYLDGCANHWMPQEINMN 122

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWK  NGLT+DER ++KRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAF
Sbjct: 123 ADIALWKDPNGLTEDERTIVKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAF 182

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEA+H+H +QY + SLGLDEGE+FNMYREVPS+  KA WAL +T+ L+ P+F TGT +AD
Sbjct: 183 EEALHTHAYQYCVESLGLDEGEIFNMYREVPSVATKAEWALPFTKHLADPNFRTGTPEAD 242

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q+ L++L  FYVVFEG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGIDVI
Sbjct: 243 QKLLRELIAFYVVFEGIFFYVGFVQILSMGRRNKMTGVAEQFQYILRDESMHMNFGIDVI 302

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIK+ENPHLWT+EF+ + RT++ +A  LE  YA +TMP+G +G+NA   E+Y+ FIANR
Sbjct: 303 NQIKVENPHLWTEEFKNEMRTLISDAVELEAQYARDTMPRGVLGMNAQMFEEYLHFIANR 362

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC QIGL  ++   +NPFPWMSEV+DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 363 RCAQIGLAEMYPGADNPFPWMSEVLDLKKEKNFFETRVTEYQTGGALSWD 412


>gi|184157022|ref|YP_001845361.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ACICU]
 gi|183208616|gb|ACC56014.1| Ribonucleotide reductase, beta subunit [Acinetobacter baumannii
           ACICU]
          Length = 427

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|297538242|ref|YP_003674011.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
 gi|297257589|gb|ADI29434.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
          Length = 376

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 212/352 (60%), Positives = 270/352 (76%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + + T  +   +   RVN  DKRM+N ++DVNQL+P KY WAW+KYL+ C NHWMP EV 
Sbjct: 25  IKSATAAANQPSHSGRVNASDKRMINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEVS 84

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK    L+DDERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQ
Sbjct: 85  MSRDIAQWKDSTALSDDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQ 144

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
            FEEA+H+H +QYI+ SLGLDE E+FN Y+E+PSI AK ++ + +  TL+ P+F TGT +
Sbjct: 145 GFEEAIHTHAYQYIVESLGLDESEVFNAYQEIPSIKAKDDFLIPFINTLTDPAFKTGTAE 204

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQE L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID
Sbjct: 205 ADQELLRSLIVFACIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGID 264

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VIN IK+ENPHLWT EF+++ +T++ +   LE  YA  TMP+G +GLNA   ++Y++FIA
Sbjct: 265 VINTIKLENPHLWTAEFREEIKTLMQKGVELEYQYAEATMPRGVLGLNATMFKEYLRFIA 324

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+ L+    NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 325 NRRCTQIGLDVLYPGATNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 376


>gi|78065156|ref|YP_367925.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           383]
 gi|77965901|gb|ABB07281.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383]
          Length = 403

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|254253304|ref|ZP_04946622.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
 gi|124895913|gb|EAY69793.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
          Length = 403

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 300 NPHLWTPEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|253997287|ref|YP_003049351.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
 gi|253983966|gb|ACT48824.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
          Length = 377

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 209/339 (61%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
             RVN  DKRM+N ++DVNQL+P KY WAW+KYL+ C NHWMP EV M  D+A WK    
Sbjct: 39  SGRVNASDKRMINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEVSMSRDIAQWKDSTA 98

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTDDERL++KRNLGFF +++SL ANNIVL  YRH++ PE RQYLLRQ FEEA+H+H +QY
Sbjct: 99  LTDDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPEARQYLLRQGFEEAIHTHAYQY 158

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y+EV SI  K ++ + +  TL++P F TGT +ADQ+ L+ L VF 
Sbjct: 159 IVESLGLDESEVFNAYQEVASIKDKDDFLIPFINTLTNPEFKTGTAEADQQLLRSLIVFA 218

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVIN IK+ENPHLW
Sbjct: 219 CIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDVINTIKLENPHLW 278

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + + ++     LE  YA  TMP+G +GLNA   ++Y++FIANRRC QIGL+ L+
Sbjct: 279 TAEFRDEIKGLIQHGVELEYRYAEATMPRGVLGLNATMFKEYLRFIANRRCQQIGLDVLY 338

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +   NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 339 QGATNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 377


>gi|254282900|ref|ZP_04957868.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
 gi|219679103|gb|EED35452.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
          Length = 421

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 279/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV 
Sbjct: 70  LDVAPGLEELEMGAQRVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVN 129

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WKS +GLT+DER ++ R+LG+F++++SLVANN+VL IYR ++NPECRQYLLRQ
Sbjct: 130 MTADVATWKSSDGLTEDERRIVLRSLGYFSTADSLVANNLVLGIYRLITNPECRQYLLRQ 189

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEG +FNMYREVPS+  KA W+L +T +LS P+F TGT +
Sbjct: 190 AFEEAIHTHAYQYCIESLGMDEGAVFNMYREVPSVARKATWSLSHTHSLSDPNFKTGTVE 249

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+ L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 250 TDQQLLRNLVGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 309

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT EFQ++   M+ E T LEI YA +TMP+G +G+NA   E+Y+QFI 
Sbjct: 310 VINQIKLENPHLWTAEFQEEVVQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFIC 369

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR +Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 370 NRRLNQLGLSEQYPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 421


>gi|312960686|ref|ZP_07775192.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
 gi|311285212|gb|EFQ63787.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
          Length = 416

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 216/352 (61%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGASARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 185 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVD 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|209521089|ref|ZP_03269819.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
 gi|209498472|gb|EDZ98597.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
          Length = 411

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 216/337 (64%), Positives = 265/337 (78%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 75  RVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNGLT 134

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 135 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 194

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF  V
Sbjct: 195 ESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFACV 254

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT 
Sbjct: 255 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTA 314

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+  
Sbjct: 315 EFRAEIRAIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPN 374

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 375 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 411


>gi|28868867|ref|NP_791486.1| ribonucleoside-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213969520|ref|ZP_03397656.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301385974|ref|ZP_07234392.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058701|ref|ZP_07250242.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato K40]
 gi|302134408|ref|ZP_07260398.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28852106|gb|AAO55181.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213925616|gb|EEB59175.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|330960626|gb|EGH60886.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. maculicola str. ES4326]
 gi|331016758|gb|EGH96814.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 415

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 275/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK   GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKDPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVD 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|226953559|ref|ZP_03824023.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|294649451|ref|ZP_06726876.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226835696|gb|EEH68079.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|292824656|gb|EFF83434.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 427

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 223/351 (63%), Positives = 280/351 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER +I R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIIMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQILLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT  FQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTATFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLAQLGLPEQFAGVTNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|295677726|ref|YP_003606250.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
 gi|295437569|gb|ADG16739.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
          Length = 411

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 216/337 (64%), Positives = 265/337 (78%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 75  RVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNGLT 134

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 135 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 194

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF  V
Sbjct: 195 ESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFACV 254

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT 
Sbjct: 255 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTA 314

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+  
Sbjct: 315 EFRAEIRAIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPN 374

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 375 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 411


>gi|170720377|ref|YP_001748065.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida W619]
 gi|169758380|gb|ACA71696.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida W619]
          Length = 416

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDIAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|169634186|ref|YP_001707922.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii SDF]
 gi|169152978|emb|CAP02026.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii]
          Length = 427

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|262373382|ref|ZP_06066661.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
 gi|262313407|gb|EEY94492.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
          Length = 427

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 282/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA+W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKASWGLKYTQSLSDPTFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|171318520|ref|ZP_02907672.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
 gi|171096306|gb|EDT41212.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
          Length = 403

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|94312018|ref|YP_585228.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           metallidurans CH34]
 gi|93355870|gb|ABF09959.1| Ribonucleoside-diphosphate reductase beta subunit [Cupriavidus
           metallidurans CH34]
          Length = 395

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 211/339 (62%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 57  TRRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 116

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QY
Sbjct: 117 LTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQY 176

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF 
Sbjct: 177 IVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFA 236

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLW
Sbjct: 237 CIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLW 296

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF
Sbjct: 297 TAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDQLF 356

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 357 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 395


>gi|327480258|gb|AEA83568.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri DSM 4166]
          Length = 415

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 218/352 (61%), Positives = 282/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVREGLNELEGEAARVRVDEKRMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKSK+GL++DER ++KRNLGFF++++SLVANN+VLA YR ++NPECRQY+LRQ
Sbjct: 124 MNADIALWKSKDGLSEDERRIVKRNLGFFSTADSLVANNLVLATYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY EVPS+  KA+W L+YT+++S P+F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEVPSVAKKASWGLKYTRSISDPTFQTGTPE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++FL++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKQFLKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 MINQIKIENPHLWNAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|262369327|ref|ZP_06062655.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
 gi|262315395|gb|EEY96434.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
          Length = 427

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 221/351 (62%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFQTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQILLRNLIAFYCVLEGIFFYCGFSQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENP LWT EFQ++   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPSLWTAEFQEEIIQMILEGTMLEIEYARDTMPRGVLGMNAAMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLAQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|66046950|ref|YP_236791.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae B728a]
 gi|237798938|ref|ZP_04587399.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|237806191|ref|ZP_04592895.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|63257657|gb|AAY38753.1| Ribonucleoside-diphosphate reductase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330980156|gb|EGH78342.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aptata str. DSM 50252]
 gi|331021792|gb|EGI01849.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331027304|gb|EGI07359.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 415

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 276/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVD 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|134294683|ref|YP_001118418.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           vietnamiensis G4]
 gi|134137840|gb|ABO53583.1| Ribonucleoside-diphosphate reductase [Burkholderia vietnamiensis
           G4]
          Length = 403

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 268/344 (77%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVASIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKHAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|26987912|ref|NP_743337.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida KT2440]
 gi|167035231|ref|YP_001670462.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida GB-1]
 gi|24982621|gb|AAN66801.1|AE016309_3 ribonucleoside reductase, beta subunit [Pseudomonas putida KT2440]
 gi|166861719|gb|ABZ00127.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida GB-1]
 gi|313497534|gb|ADR58900.1| NrdB [Pseudomonas putida BIRD-1]
          Length = 416

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS++GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKSQDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|92112799|ref|YP_572727.1| ribonucleotide-diphosphate reductase subunit beta [Chromohalobacter
           salexigens DSM 3043]
 gi|91795889|gb|ABE58028.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens
           DSM 3043]
          Length = 420

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 220/352 (62%), Positives = 285/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ VDDK+M+NAR+D+NQL+P KY WAW+KYL    NHWMP EV 
Sbjct: 69  LDVAAGLEELEMGAARIEVDDKQMINARADLNQLVPFKYEWAWQKYLDGSANHWMPQEVN 128

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GLT+DER +++R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 129 MNADIALWKSNDGLTEDERRIVERSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQ 188

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY + SLG+DEGE+FNMYREVPS+ AK+ W+L++TQ+L+ P F TGT +
Sbjct: 189 AFEEAIHTHAYQYCVESLGMDEGEVFNMYREVPSVAAKSAWSLKHTQSLARPDFHTGTPE 248

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D
Sbjct: 249 TDQELLRNLIAFYCVTEGIFFYCGFSQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVD 308

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQ +   M+ E T LEIAYA ++MP+G +G+NA   E+Y+ FI 
Sbjct: 309 MINQIKIENPHLWTPEFQDEVTQMIIEGTELEIAYARDSMPRGVLGMNAAIMEEYLHFIC 368

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +   ENPFPWMSE+IDL+KEKNFFETRVTEYQ G  L WD
Sbjct: 369 NRRLAQIGLKEQYPGAENPFPWMSEIIDLRKEKNFFETRVTEYQVGGALSWD 420


>gi|262280153|ref|ZP_06057938.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260504|gb|EEY79237.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
          Length = 427

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 221/351 (62%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNLDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLW+ EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWSAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|189349324|ref|YP_001944952.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|221213238|ref|ZP_03586213.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
 gi|189333346|dbj|BAG42416.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           multivorans ATCC 17616]
 gi|221166690|gb|EED99161.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
          Length = 403

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|170695324|ref|ZP_02886470.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
 gi|170139724|gb|EDT07906.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
          Length = 414

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 263/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 76  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 135

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 136 LTEDERRVVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 195

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P F TGT + DQ  L+ L VF 
Sbjct: 196 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYINVLTDPGFKTGTLETDQTLLRSLIVFA 255

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 256 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 315

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 316 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 375

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 376 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 414


>gi|330880140|gb|EGH14289.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330966559|gb|EGH66819.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 415

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 275/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK   GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKDPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT D
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVD 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|332852155|ref|ZP_08433982.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013150]
 gi|332867554|ref|ZP_08437707.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013113]
 gi|332729527|gb|EGJ60866.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013150]
 gi|332733971|gb|EGJ65116.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6013113]
          Length = 440

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 90  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 149

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 150 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 209

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 210 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 269

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 270 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 329

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 330 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 389

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 390 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 440


>gi|113869188|ref|YP_727677.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha H16]
 gi|113527964|emb|CAJ94309.1| Ribonucleoside-diphosphate reductase beta subunit [Ralstonia
           eutropha H16]
          Length = 395

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 211/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 58  RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 117

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 118 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 177

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 178 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 237

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 238 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 297

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 298 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFP 357

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 358 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 395


>gi|104780527|ref|YP_607025.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           entomophila L48]
 gi|95109514|emb|CAK14215.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           entomophila L48]
          Length = 415

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 276/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDIAEGLAELEGSSARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GLT+DER ++ RNLGFF++++SLVANN+ LA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKSMDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA W L+YT+ +S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTRAISDPEFNTGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW    ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|90022104|ref|YP_527931.1| ribonucleotide-diphosphate reductase subunit beta [Saccharophagus
           degradans 2-40]
 gi|89951704|gb|ABD81719.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 423

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 221/352 (62%), Positives = 285/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    GL  ++ G +R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 72  MDPTLGLEELEIGAERIEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 131

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WKS +GL++DER +I R+LG+F++++SLVANN+VLAIYRH++NPE RQYLLRQ
Sbjct: 132 MTADVATWKSPDGLSEDERRIIMRSLGYFSTADSLVANNLVLAIYRHITNPEARQYLLRQ 191

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P+F TGT +
Sbjct: 192 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSIAHTQGMSDPTFKTGTPE 251

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQE L++L  FYV+ EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 252 ADQELLRNLIGFYVITEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 311

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT+EFQ +++ M+ E T LEIAYA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 312 VINQIKLENPHLWTEEFQAETKQMILEGTELEIAYARDTMPRGVLGMNAAMMEEYLHFIA 371

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 372 NRRMAQLGLAEAYPGAKNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWE 423


>gi|229590245|ref|YP_002872364.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229362111|emb|CAY49013.1| putative ribonucleoside-diphosphate reductase beta chain
           [Pseudomonas fluorescens SBW25]
          Length = 416

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|229592166|ref|YP_002874285.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229364032|emb|CAY51597.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens SBW25]
          Length = 416

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDVAEGLAELEGSAARVAVDEKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 125 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDKELLRNLVAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|332872596|ref|ZP_08440564.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6014059]
 gi|332739125|gb|EGJ69984.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii 6014059]
          Length = 440

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 90  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 149

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 150 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 209

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 210 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 269

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 270 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 329

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 330 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 389

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 390 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 440


>gi|302525965|ref|ZP_07278307.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
 gi|302434860|gb|EFL06676.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
          Length = 357

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 260/351 (74%), Positives = 297/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + TGL  I+ G  R+NVDDKRM+NAR+DVNQLLP+KY WAW+KYL+ACNNHWMPTEV M
Sbjct: 7   TDATGLGEIEVGAARINVDDKRMINARADVNQLLPMKYRWAWDKYLAACNNHWMPTEVAM 66

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS +GLT+DER M+KRNLGFFA++ESLVANNIVLA+YR ++NPECRQYLLRQA
Sbjct: 67  QADIALWKSPDGLTEDERQMLKRNLGFFATAESLVANNIVLAVYRQITNPECRQYLLRQA 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI  SLGL EGELFNMYREVPSI+ K  WAL+YTQ L +P F TGT +A
Sbjct: 127 FEEAVHTHTFQYICESLGLVEGELFNMYREVPSISDKDAWALKYTQNLENPDFETGTPEA 186

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID 
Sbjct: 187 DQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDC 246

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLWT+EFQ + R ML EA  LE+ YA +TMP+G +GL+A  CEQYM FI +
Sbjct: 247 INQIKIENPHLWTEEFQAEVRGMLQEACELEVKYARDTMPRGMLGLSADLCEQYMHFITD 306

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  QIGL P++   ENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 307 RRAQQIGLPPIYGENENPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 357


>gi|71737432|ref|YP_275887.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485935|ref|ZP_05639976.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289628680|ref|ZP_06461634.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648392|ref|ZP_06479735.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298487941|ref|ZP_07005980.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302184861|ref|ZP_07261534.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae 642]
 gi|71557985|gb|AAZ37196.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157492|gb|EFH98573.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330866023|gb|EGH00732.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330896997|gb|EGH28545.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330986742|gb|EGH84845.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331010341|gb|EGH90397.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 415

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 276/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|332530699|ref|ZP_08406630.1| ribonucleotide-diphosphate reductase subunit beta [Hylemonella
           gracilis ATCC 19624]
 gi|332039867|gb|EGI76262.1| ribonucleotide-diphosphate reductase subunit beta [Hylemonella
           gracilis ATCC 19624]
          Length = 399

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 206/340 (60%), Positives = 257/340 (75%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  R+   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  N
Sbjct: 60  GTHRIKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMNRDIALWKDPN 119

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GL++DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +Q
Sbjct: 120 GLSEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQ 179

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDE E+F+ Y EV SI  K  + L +   +  P+F TGT + DQ  L+ L VF
Sbjct: 180 YIVESLGLDESEIFSAYLEVQSIRDKDEFLLPFINAIMDPNFHTGTLETDQTLLKSLIVF 239

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP L
Sbjct: 240 ACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQL 299

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EF+ + R +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE L
Sbjct: 300 WTPEFKAEIRGLFEKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEAL 359

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 360 FPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 399


>gi|254516739|ref|ZP_05128798.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
 gi|219675162|gb|EED31529.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
          Length = 441

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 219/352 (62%), Positives = 280/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  RV++D+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV 
Sbjct: 90  LDVAAGLEELEMGAARVSIDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVN 149

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK+  GLTDDER +I R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 150 MTADVATWKNPEGLTDDERRIILRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQ 209

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W+L +T  LS P+F TGT +
Sbjct: 210 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSLSHTHELSDPNFNTGTME 269

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           +DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 270 SDQTLLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 329

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT+EF+Q++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIA
Sbjct: 330 VINQIKLENPHLWTEEFKQEAIQMILEGTQLEIEYARDTMPRGVLGMNAAMMEEYLQFIA 389

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 390 NRRLSQIGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 441


>gi|323527395|ref|YP_004229548.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
 gi|323384397|gb|ADX56488.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
          Length = 414

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 216/339 (63%), Positives = 265/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 76  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIALWKDPNG 135

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 136 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 195

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + Y   L+ P+F TGT +ADQ  L+ L VF 
Sbjct: 196 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPYIHVLTDPAFKTGTLEADQTLLRSLIVFA 255

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW
Sbjct: 256 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLW 315

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+
Sbjct: 316 TAEFRAEIREIFQQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLY 375

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 376 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALTWE 414


>gi|325519933|gb|EGC99191.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           TJI49]
          Length = 403

 Score =  342 bits (876), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 218/351 (62%), Positives = 271/351 (77%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A      P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M
Sbjct: 53  APQASAVPAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINM 112

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 113 SRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 172

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +A
Sbjct: 173 FEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEA 232

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+
Sbjct: 233 DQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDL 292

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK+ENPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+N
Sbjct: 293 INQIKLENPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISN 352

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 353 RRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|221202418|ref|ZP_03575450.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
 gi|221208122|ref|ZP_03581127.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221172025|gb|EEE04467.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221177695|gb|EEE10110.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
          Length = 372

 Score =  342 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 217/344 (63%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 29  PAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 88

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 89  KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 148

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 149 HAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 208

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 209 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 268

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG
Sbjct: 269 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIG 328

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 329 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 372


>gi|332526550|ref|ZP_08402662.1| ribonucleotide-diphosphate reductase subunit beta [Rubrivivax
           benzoatilyticus JA2]
 gi|332110818|gb|EGJ10995.1| ribonucleotide-diphosphate reductase subunit beta [Rubrivivax
           benzoatilyticus JA2]
          Length = 385

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 210/354 (59%), Positives = 264/354 (74%), Gaps = 5/354 (1%)

Query: 4   NTGLSPIQAG-----EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTE 58
            T  SP+         +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E
Sbjct: 32  ATNASPVSRPAATAHTRRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQE 91

Query: 59  VPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLL 118
           V M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LL
Sbjct: 92  VNMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLL 151

Query: 119 RQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
           RQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV +I  K  + + +   +  P+F+TGT
Sbjct: 152 RQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVAAIRDKDEFLIPFIDAIMDPAFSTGT 211

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            +ADQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFG
Sbjct: 212 PEADQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFG 271

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
           ID+INQIK+ENP LWT  F+ + R +   A  LE  YA +TMP+G +G+NA   + Y+++
Sbjct: 272 IDLINQIKLENPQLWTPAFKAEIRALFERAVELEYRYAEDTMPRGVLGMNASMFKGYLRY 331

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFFETRV +YQ G  L WD
Sbjct: 332 IANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFFETRVIDYQSGGALSWD 385


>gi|170731918|ref|YP_001763865.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia MC0-3]
 gi|169815160|gb|ACA89743.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           MC0-3]
          Length = 403

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|299771426|ref|YP_003733452.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
 gi|298701514|gb|ADI92079.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
          Length = 427

 Score =  341 bits (875), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 221/351 (62%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNLDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLW+ EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWSAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|107021673|ref|YP_620000.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia AU 1054]
 gi|116688619|ref|YP_834242.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia HI2424]
 gi|105891862|gb|ABF75027.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia AU
           1054]
 gi|116646708|gb|ABK07349.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           HI2424]
          Length = 382

 Score =  341 bits (875), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 215/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 39  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 98

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 99  KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 158

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 159 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 218

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 219 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 278

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 279 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 338

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PL+   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 339 LDPLYPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 382


>gi|207744360|ref|YP_002260752.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595765|emb|CAQ62692.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
          Length = 410

 Score =  341 bits (875), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 213/338 (63%), Positives = 261/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 73  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 132

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 133 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 192

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 193 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 252

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 253 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 312

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF 
Sbjct: 313 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFP 372

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 373 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 410


>gi|206561765|ref|YP_002232530.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia J2315]
 gi|254246390|ref|ZP_04939711.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|124871166|gb|EAY62882.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|198037807|emb|CAR53751.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           cenocepacia J2315]
          Length = 403

 Score =  341 bits (875), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 216/344 (62%), Positives = 269/344 (78%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P    E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALW
Sbjct: 60  PAGGTEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALW 119

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 120 KDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 179

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ 
Sbjct: 180 HAYQYIVESLGLDEGEIFNAYHEVTSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKS 239

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+E
Sbjct: 240 LIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLE 299

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIG
Sbjct: 300 NPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIG 359

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 LDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|300703002|ref|YP_003744604.1| ribonucleoside diphosphate reductase 1 subunit beta, ferritin-like
           [Ralstonia solanacearum CFBP2957]
 gi|299070665|emb|CBJ41960.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CFBP2957]
          Length = 402

 Score =  341 bits (875), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 214/338 (63%), Positives = 261/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLDEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 402


>gi|83746810|ref|ZP_00943858.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|207721465|ref|YP_002251905.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
 gi|83726579|gb|EAP73709.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|206586625|emb|CAQ17211.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
          Length = 402

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 213/338 (63%), Positives = 261/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 402


>gi|73542624|ref|YP_297144.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha JMP134]
 gi|72120037|gb|AAZ62300.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134]
          Length = 394

 Score =  341 bits (875), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 210/338 (62%), Positives = 259/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+A WK  NGL
Sbjct: 57  RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIATWKDPNGL 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 117 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 176

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 177 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 236

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 237 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 296

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 297 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFP 356

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 357 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 394


>gi|324998522|ref|ZP_08119634.1| ribonucleoside-diphosphate reductase beta chain [Pseudonocardia sp.
           P1]
          Length = 358

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 254/350 (72%), Positives = 298/350 (85%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I  G   ++ DDKRM+NAR+DVNQLLPLKY WAW+KYL+ C+NHWMPTEV MQ
Sbjct: 9   DTTGLGEIDRGAAPIDADDKRMINARADVNQLLPLKYHWAWDKYLAGCSNHWMPTEVAMQ 68

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW+S++GLTDDERLM+ RNLGFFA++ESLVANN+VLA+YRHL+NPECRQYLLRQ+F
Sbjct: 69  ADIALWRSRDGLTDDERLMLTRNLGFFATAESLVANNVVLAVYRHLTNPECRQYLLRQSF 128

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQY+  SLGLDEGELFN YR+VPSIT K  WAL+YTQ LS P F TGT + D
Sbjct: 129 EEAVHTHTFQYVCESLGLDEGELFNAYRQVPSITDKDAWALRYTQALSDPDFCTGTPEND 188

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           + FL+DL  FYVVFEGMWFYTGFAQIL+LGR NKMVG+AEQYQYI+RDES+HLNFGID I
Sbjct: 189 RAFLRDLVAFYVVFEGMWFYTGFAQILALGRRNKMVGVAEQYQYILRDESIHLNFGIDCI 248

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENPHLWT+EF  + R MLHEA  LE+AYA +TMP+G +GL A SCEQY++FI +R
Sbjct: 249 NQIKIENPHLWTEEFAAEIRAMLHEACELEVAYARDTMPRGMLGLTAESCEQYLRFITDR 308

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           R  QIGL PLF   +NPFPWMSE +DL+KEKNFFETRVTEY+ G  L+WD
Sbjct: 309 RAEQIGLAPLFGQADNPFPWMSEAMDLRKEKNFFETRVTEYRTGGSLEWD 358


>gi|300784783|ref|YP_003765074.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
 gi|299794297|gb|ADJ44672.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
          Length = 357

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 261/351 (74%), Positives = 297/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + TGL  I+ G  R+NVDDKRM+NAR+DVNQLLP+KY WAWEKYL+ CNNHWMPTEV M
Sbjct: 7   TDATGLGEIEVGAARINVDDKRMINARADVNQLLPMKYKWAWEKYLAGCNNHWMPTEVAM 66

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS +GLT+DER M+KRNLGFFA++ESLVANNIVLA+YR ++NPECRQYLLRQA
Sbjct: 67  QADIALWKSPDGLTEDERQMLKRNLGFFATAESLVANNIVLAVYRQITNPECRQYLLRQA 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI  SLGL EGELFNMYREVPSI+ K  WAL+YTQ L +P F TGT +A
Sbjct: 127 FEEAVHTHTFQYICESLGLVEGELFNMYREVPSISDKDAWALKYTQNLENPDFETGTPEA 186

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID 
Sbjct: 187 DQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDC 246

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLWT+EFQ + R ML EA  LE+ YA +TMP+G +GL+A  CEQYM F+ +
Sbjct: 247 INQIKIENPHLWTEEFQAEVRGMLKEACELEVKYARDTMPRGMLGLSAQLCEQYMHFVTD 306

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 307 RRAQQIGLAPIFGETENPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 357


>gi|320323423|gb|EFW79511.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327620|gb|EFW83632.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330876273|gb|EGH10422.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 415

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C+NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCSNHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|255318309|ref|ZP_05359544.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262379054|ref|ZP_06072210.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
 gi|255304621|gb|EET83803.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262298511|gb|EEY86424.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
          Length = 427

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 223/351 (63%), Positives = 282/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 77  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 136

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 137 MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 196

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 197 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLSDPTFKTGTPE 256

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 257 NDQILLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 316

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 317 MINQIKIENPHLWTAEFQQEIIQMILEGTMLEIEYARDTMPRGVLGMNAAMMEEYLKFIC 376

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR +Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 377 NRRLNQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFFETRVTDYQTGGALSW 427


>gi|226227154|ref|YP_002761260.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
 gi|226090345|dbj|BAH38790.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
          Length = 371

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 269/349 (77%), Positives = 297/349 (85%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  I     RV VDDK M+N R+DVNQLLPLKY WAWEKYLS CNNHWMPTEV MQ 
Sbjct: 23  ATGLGEIDRHGGRVRVDDKAMINCRADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSMQA 82

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DLA+W+S++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAFE
Sbjct: 83  DLAIWRSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAFE 142

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+HTFQYI  SLGLDEGELFNMYREVPSITAKA WAL+YTQ L+ P F+TGT + DQ
Sbjct: 143 EAIHTHTFQYICESLGLDEGELFNMYREVPSITAKAAWALKYTQHLADPGFSTGTPETDQ 202

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVIN
Sbjct: 203 AFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVIN 262

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIK+ENPHLW+  FQ++ R ML EA  LE+AY  +TMP+GF+GLNA  CE YM FI NRR
Sbjct: 263 QIKVENPHLWSAAFQEEVRQMLAEACELEVAYGRDTMPRGFLGLNAALCETYMHFITNRR 322

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C Q+GL P+F  T+NPFPWMSE IDLKKEKNFFETRV EYQ G  LKWD
Sbjct: 323 CAQLGLAPVFPETDNPFPWMSEAIDLKKEKNFFETRVIEYQNGGALKWD 371


>gi|121598515|ref|YP_991780.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei SAVP1]
 gi|124385654|ref|YP_001027273.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10229]
 gi|126439848|ref|YP_001060484.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 668]
 gi|126451145|ref|YP_001082790.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10247]
 gi|126453692|ref|YP_001067748.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1106a]
 gi|134280207|ref|ZP_01766918.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|166998593|ref|ZP_02264451.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|167721297|ref|ZP_02404533.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei DM98]
 gi|167740266|ref|ZP_02413040.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 14]
 gi|167817486|ref|ZP_02449166.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 91]
 gi|167847373|ref|ZP_02472881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei B7210]
 gi|167895962|ref|ZP_02483364.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 7894]
 gi|167904346|ref|ZP_02491551.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei NCTC 13177]
 gi|167912606|ref|ZP_02499697.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 112]
 gi|217420440|ref|ZP_03451945.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|226196790|ref|ZP_03792369.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813879|ref|YP_002898330.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238561262|ref|ZP_00442338.2| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242316188|ref|ZP_04815204.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|254178822|ref|ZP_04885476.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|254199038|ref|ZP_04905453.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|254202774|ref|ZP_04909137.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|254259655|ref|ZP_04950709.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
 gi|254299327|ref|ZP_04966777.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|121227325|gb|ABM49843.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei SAVP1]
 gi|124293674|gb|ABN02943.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10229]
 gi|126219341|gb|ABN82847.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 668]
 gi|126227334|gb|ABN90874.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106a]
 gi|126244015|gb|ABO07108.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10247]
 gi|134248214|gb|EBA48297.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|147747021|gb|EDK54098.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|157808756|gb|EDO85926.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|160694736|gb|EDP84744.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|169656868|gb|EDS88265.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|217395852|gb|EEC35869.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|225931050|gb|EEH27058.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506031|gb|ACQ98349.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238524965|gb|EEP88395.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242139427|gb|EES25829.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|243065276|gb|EES47462.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|254218344|gb|EET07728.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
          Length = 403

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 217/339 (64%), Positives = 269/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 65  EARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 124

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 125 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 184

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+ L VF 
Sbjct: 185 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFA 244

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 245 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 304

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 305 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 364

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 365 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|83719302|ref|YP_441701.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
 gi|83653127|gb|ABC37190.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           thailandensis E264]
          Length = 377

 Score =  340 bits (873), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 216/339 (63%), Positives = 268/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 39  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 98

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 99  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 158

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ L VF 
Sbjct: 159 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFA 218

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 219 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 278

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 279 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 338

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 339 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 377


>gi|33593916|ref|NP_881560.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           pertussis Tohama I]
 gi|33598411|ref|NP_886054.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           parapertussis 12822]
 gi|33603351|ref|NP_890911.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           bronchiseptica RB50]
 gi|33563990|emb|CAE43255.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           pertussis Tohama I]
 gi|33574540|emb|CAE39187.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           parapertussis]
 gi|33577475|emb|CAE34740.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           bronchiseptica RB50]
 gi|332383335|gb|AEE68182.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           pertussis CS]
          Length = 398

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 212/349 (60%), Positives = 267/349 (76%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
              L    A   RV V DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  
Sbjct: 50  AASLGASDATAGRVKVADKRIINGETDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSR 109

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFE
Sbjct: 110 DIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFE 169

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ
Sbjct: 170 EAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFHTGTPEADQ 229

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
           + L+ L VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN
Sbjct: 230 KLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLIN 289

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            IK+ENPHLWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRR
Sbjct: 290 TIKLENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRR 349

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIG+EPLF   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 350 CQQIGIEPLFPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 398


>gi|76808925|ref|YP_334881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1710b]
 gi|254208116|ref|ZP_04914466.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
 gi|76578378|gb|ABA47853.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei 1710b]
 gi|147752010|gb|EDK59077.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
          Length = 376

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 217/339 (64%), Positives = 269/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 38  EARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 97

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 98  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 157

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+ L VF 
Sbjct: 158 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFA 217

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 218 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 277

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 278 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 337

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 338 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 376


>gi|192291019|ref|YP_001991624.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris TIE-1]
 gi|192284768|gb|ACF01149.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           TIE-1]
          Length = 373

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 264/350 (75%), Positives = 290/350 (82%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I  G  RV VDDKRM+NAR+DVNQLLPLKY WAWEKYL+ACNNHWMPTEV MQ
Sbjct: 24  DTTGLGTIDRGAARVRVDDKRMINARADVNQLLPLKYHWAWEKYLAACNNHWMPTEVSMQ 83

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWKS++GLT+DER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAF
Sbjct: 84  ADIALWKSRDGLTEDERHMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAF 143

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL YT+ L  P F TGT   D
Sbjct: 144 EEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALDYTKHLDDPHFETGTPATD 203

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL DL  FYVVFEGMWFYTGFAQILSLGR  KM GIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 204 QAFLLDLIAFYVVFEGMWFYTGFAQILSLGRRQKMTGIAEQYQYILRDESIHLNFGIDVI 263

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIK+EN  +WT  FQ   R M+H+A  LE AY  +TMP G +GLNA  CE YM FIANR
Sbjct: 264 NQIKLENAAVWTASFQDDIRGMIHDAAELEAAYGRDTMPHGLLGLNAALCESYMHFIANR 323

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL P+F  T+NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 324 RCVQLGLRPVFAETDNPFPWMSETMDLKKEKNFFETRVIEYQNGGALDWD 373


>gi|146282010|ref|YP_001172163.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri A1501]
 gi|145570215|gb|ABP79321.1| ribonucleoside reductase, small chain [Pseudomonas stutzeri A1501]
          Length = 415

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 217/352 (61%), Positives = 282/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+KRM+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDIREGLNELEGEAARVRVDEKRMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKSK+GL++DER ++KRNLGFF++++SLVANN+VLA YR ++NPECRQY+LRQ
Sbjct: 124 MNADIALWKSKDGLSEDERRIVKRNLGFFSTADSLVANNLVLATYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFQTGTPE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++FL++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKQFLKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLW  E + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 MINQIKIENPHLWDAEMKDEATQMILQGTQLEIEYARDTMPRGVLGMNASMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|299134880|ref|ZP_07028072.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
 gi|298590690|gb|EFI50893.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
          Length = 373

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 269/350 (76%), Positives = 300/350 (85%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
             TGL  I     RV+VD+KRM+N R+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV MQ
Sbjct: 24  EQTGLGAIDRSGGRVSVDEKRMINCRADVNQLLPLKYKWAWEKYLAGCNNHWMPTEVSMQ 83

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWKS++GLTDDER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAF
Sbjct: 84  ADIALWKSRDGLTDDERRAIKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQAF 143

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++TQ L +P F+TGT++AD
Sbjct: 144 EEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTQNLDNPDFSTGTQEAD 203

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 204 QSFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVI 263

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIK+EN HLWTK FQ+  R M+ +A  LE AY  +TMP+GF+GLNA  CEQYM FIANR
Sbjct: 264 NQIKLENQHLWTKAFQEDVRGMIRDAAELEAAYGRDTMPRGFLGLNAALCEQYMHFIANR 323

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC QIGL P+F  TENPFPWMSE +DLKKEKNFFETRV EYQ G  L W+
Sbjct: 324 RCAQIGLTPVFPETENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWE 373


>gi|238026167|ref|YP_002910398.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           glumae BGR1]
 gi|237875361|gb|ACR27694.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           glumae BGR1]
          Length = 407

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 212/339 (62%), Positives = 268/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           ++RVN+ DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 69  QERVNIADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 128

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +++RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 129 LTEDERRIVRRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 188

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI  K  + + +  TL+ P+F TGT+DADQ+ L+ L VF 
Sbjct: 189 IVESLGLDEGEIFNAYHEVSSIRDKDEFLIPFIHTLTDPAFVTGTQDADQKLLKSLIVFA 248

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 249 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 308

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FIANRRC QIGL+PL+
Sbjct: 309 TPEFRAEIRELFKRAVELEYRYAEDTMPRGVLGLNAAMFKSYLRFIANRRCQQIGLDPLY 368

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 369 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|254483523|ref|ZP_05096750.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
 gi|214036244|gb|EEB76924.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
          Length = 425

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 219/352 (62%), Positives = 283/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    GL  ++ G  RV+VD+K M+N R+D+NQL+PLKY WAW+KYL  C NHWMP E+ 
Sbjct: 74  MDVAAGLEELEMGASRVSVDEKAMINCRADLNQLVPLKYDWAWQKYLDGCANHWMPQEIN 133

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WKS +GL+DDER ++ R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 134 MTADVATWKSADGLSDDERRIVMRSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQ 193

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+ AKA+W+L +T +LS P+F TGT++
Sbjct: 194 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAAKASWSLSHTHSLSDPTFNTGTQE 253

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 254 TDQELLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 313

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENP+LWT+ FQQ+   M+ E T +EI YA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 314 VINQIKLENPNLWTETFQQEVIQMILEGTEIEIQYARDTMPRGVLGMNAAIMEEYLHFIA 373

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 374 NRRLSQLGLPEQFAGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 425


>gi|92119123|ref|YP_578852.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           hamburgensis X14]
 gi|91802017|gb|ABE64392.1| Ribonucleoside-diphosphate reductase [Nitrobacter hamburgensis X14]
          Length = 416

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 270/351 (76%), Positives = 297/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + TGL  I     RV VDDKRM+NAR+DVNQLLPLKYGWAWEKYLS CNNHWMPTEV M
Sbjct: 66  TDATGLGAIDRSGGRVRVDDKRMINARADVNQLLPLKYGWAWEKYLSGCNNHWMPTEVSM 125

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKSK+GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 126 QADIALWKSKDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 185

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREV SIT KA WAL++T+ L  P F TGT +A
Sbjct: 186 FEEAVHTHTFQYIVESLGLDEGELFNMYREVSSITDKAAWALKHTRHLDDPGFKTGTPEA 245

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGF QILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 246 DQAFLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 305

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLW+K FQ++ R ML  A  LE AY  +TMP+GF+GLNA  CEQYM  IAN
Sbjct: 306 INQIKIENPHLWSKPFQEEVRAMLKNAAELEAAYGRDTMPRGFLGLNAALCEQYMHVIAN 365

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+F   +NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 366 RRCAQLGLAPVFAEADNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 416


>gi|146308172|ref|YP_001188637.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina ymp]
 gi|145576373|gb|ABP85905.1| Ribonucleoside-diphosphate reductase [Pseudomonas mendocina ymp]
          Length = 416

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 279/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDIQEGLDDLEGAAARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 125 MNADIALWKSTDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P+F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPTFNTGTPE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++FL++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDRQFLKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|54294662|ref|YP_127077.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Lens]
 gi|53754494|emb|CAH15978.1| hypothetical protein lpl1739 [Legionella pneumophila str. Lens]
          Length = 367

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 225/349 (64%), Positives = 282/349 (80%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  
Sbjct: 17  ATGLEALEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSA 76

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 77  DVALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 136

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ
Sbjct: 137 EALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQ 196

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 197 RLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVIN 256

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR
Sbjct: 257 QIKIENPHLWTPEFKNEIIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRR 316

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 317 LNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|119504228|ref|ZP_01626308.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119459736|gb|EAW40831.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 419

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 221/352 (62%), Positives = 280/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP EV 
Sbjct: 68  IDIAPGLEELEMGAARVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEVN 127

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK  +GL+DDER +I R+LG+F++++SLVANN+VLAIYR ++NPECRQYLLRQ
Sbjct: 128 MTADVATWKDPDGLSDDERRIIMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYLLRQ 187

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+ AKA W+L  T +LS P+F TGT +
Sbjct: 188 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAAKATWSLGKTHSLSDPNFRTGTLE 247

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 248 TDQELLRNLIGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 307

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENP LWT EFQQ++  M+ E T LEIAYA +TMP+G +G+NA   E+Y+QFI 
Sbjct: 308 VINQIKLENPLLWTPEFQQEAIQMILEGTELEIAYARDTMPRGVLGMNAAMMEEYLQFIC 367

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR +Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 368 NRRLNQVGLPEQFPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 419


>gi|330815478|ref|YP_004359183.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
 gi|327367871|gb|AEA59227.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
          Length = 407

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 210/339 (61%), Positives = 266/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           ++RVN+ DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 69  QERVNIADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 128

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 129 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 188

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y E+ SI  K  + + +  TL+ P+F TGT +ADQ+ L+ L VF 
Sbjct: 189 IVESLGLDEGEMFNAYHEITSIRDKDEFLIPFIHTLTDPAFVTGTPEADQKLLKSLIVFA 248

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 249 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 308

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FIANRRC QIGL+ L+
Sbjct: 309 TPEFRAEIRELFKHAVELEYRYAEDTMPRGVLGLNASMFKSYLRFIANRRCQQIGLDALY 368

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 369 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|124268397|ref|YP_001022401.1| ribonucleotide-diphosphate reductase subunit beta [Methylibium
           petroleiphilum PM1]
 gi|124261172|gb|ABM96166.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum
           PM1]
          Length = 403

 Score =  339 bits (869), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 208/341 (60%), Positives = 260/341 (76%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           AG +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK  
Sbjct: 63  AGTRRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMSRDIATWKDP 122

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGL++DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +
Sbjct: 123 NGLSEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAY 182

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLGLDE E+FN Y EV SI  K  + + +   +  P+F TGT + D+  L+ L V
Sbjct: 183 QYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIGAIMDPNFHTGTLENDRTLLKSLIV 242

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP 
Sbjct: 243 FACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQ 302

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE 
Sbjct: 303 LWTAEFKAEIKALFMKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEE 362

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 363 LFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 403


>gi|186477386|ref|YP_001858856.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phymatum STM815]
 gi|184193845|gb|ACC71810.1| Ribonucleoside-diphosphate reductase [Burkholderia phymatum STM815]
          Length = 407

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 265/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYLS C NHWMP E+ M  D+ALWK  NG
Sbjct: 69  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLSGCANHWMPQEINMSRDIALWKDPNG 128

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 129 LTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 188

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI  K  + + +  TL+ P+F TGT +ADQ+ L+ L VF 
Sbjct: 189 IVESLGLDEGEIFNAYHEVQSIRDKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFA 248

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 249 CVMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 308

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIG++PL+
Sbjct: 309 TPEFRAEIREIFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGIDPLY 368

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 369 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 407


>gi|158341282|ref|YP_001522354.1| ribonucleotide-diphosphate reductase subunit beta [Acaryochloris
           marina MBIC11017]
 gi|158311523|gb|ABW33134.1| ribonucleoside-diphosphate reductase, beta subunit [Acaryochloris
           marina MBIC11017]
          Length = 384

 Score =  339 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 206/344 (59%), Positives = 264/344 (76%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P     +R+NV DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+ALW
Sbjct: 41  PETQPPRRINVADKRIINGQTDVNQLVPFKYQWAWDKYLAGCANHWMPQEINMSRDIALW 100

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K+ +GLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+
Sbjct: 101 KTTDGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHT 160

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI+ SLGLDEGE+FN YREV  I  K  + + + +TL+ P+F TGT + DQ+ L+ 
Sbjct: 161 HAYQYIVESLGLDEGEIFNAYREVDCIREKDEFLIPFVETLTDPTFETGTPENDQKLLKS 220

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID++N IK E
Sbjct: 221 LIAFSCLMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLVNAIKQE 280

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NPHLWT EF ++ R +   A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIG
Sbjct: 281 NPHLWTPEFCEEIRDLFKRAVELEYRYAEDTMPRGVLGLNASMFKSYLRYIANRRSQQIG 340

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L+P+F   ENPFPWMSE++DLKKE+NFFETRV EYQ G  L WD
Sbjct: 341 LDPIFASEENPFPWMSEMVDLKKERNFFETRVLEYQTGGALSWD 384


>gi|89902117|ref|YP_524588.1| ribonucleotide-diphosphate reductase subunit beta [Rhodoferax
           ferrireducens T118]
 gi|89346854|gb|ABD71057.1| Ribonucleoside-diphosphate reductase [Rhodoferax ferrireducens
           T118]
          Length = 400

 Score =  339 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 209/345 (60%), Positives = 264/345 (76%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           + +    +RVN  DKR++N ++DVNQL+P KY WAWEKYLS+C NHWMP EV M  D+AL
Sbjct: 56  AAVSISPRRVNAADKRIINGKTDVNQLVPFKYKWAWEKYLSSCANHWMPQEVNMTRDIAL 115

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 116 WKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 175

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT +ADQ  L+
Sbjct: 176 THAYQYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPAFKTGTHEADQTLLK 235

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GFAQIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+
Sbjct: 236 SLIVFACLMEGLFFYVGFAQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKL 295

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENP LWT EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QI
Sbjct: 296 ENPQLWTSEFKAEIKALFEQAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQI 355

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GLE LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 356 GLETLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 400


>gi|325121074|gb|ADY80597.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 370

 Score =  339 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 20  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 79

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 80  MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 139

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W L+YTQ+L+ P+F TGT +
Sbjct: 140 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVARKAAWGLKYTQSLTDPNFHTGTPE 199

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 200 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 259

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 260 MINQIKIENPHLWTAEFQQEVVQMIVEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 319

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 320 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 370


>gi|54297688|ref|YP_124057.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Paris]
 gi|53751473|emb|CAH12891.1| hypothetical protein lpp1739 [Legionella pneumophila str. Paris]
          Length = 367

 Score =  339 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 225/349 (64%), Positives = 282/349 (80%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  
Sbjct: 17  ATGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSA 76

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 77  DVALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 136

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ
Sbjct: 137 EALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQ 196

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 197 RLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVIN 256

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR
Sbjct: 257 QIKIENPHLWTPEFKNEIIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRR 316

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 317 LNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|167825888|ref|ZP_02457359.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 9]
 gi|167924622|ref|ZP_02511713.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei BCC215]
 gi|254180586|ref|ZP_04887184.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
 gi|254190977|ref|ZP_04897483.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938651|gb|EDO94321.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|184211125|gb|EDU08168.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
          Length = 372

 Score =  339 bits (868), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 217/339 (64%), Positives = 269/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 34  EARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 93

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 94  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 153

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+ L VF 
Sbjct: 154 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFA 213

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 214 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 273

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 274 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 333

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 334 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 372


>gi|330504346|ref|YP_004381215.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
 gi|328918632|gb|AEB59463.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
          Length = 416

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 278/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 65  LDIQEGLDDLEGASARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 124

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 125 MNADIALWKSTDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 184

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P F TGT +
Sbjct: 185 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPQFQTGTPE 244

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++FL++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 245 TDRQFLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 304

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 305 VINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 364

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 365 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 416


>gi|134097869|ref|YP_001103530.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007412|ref|ZP_06565385.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133910492|emb|CAM00605.1| ribonucleoside-diphosphate reductase, beta subunit
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 360

 Score =  338 bits (867), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 261/349 (74%), Positives = 300/349 (85%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           ++GL  I     RV+V +K M+N+R+DVNQLLPLKYGWAWEKYL+ CNNHWMPTEV MQ 
Sbjct: 12  SSGLGEIDRDGGRVDVAEKAMINSRADVNQLLPLKYGWAWEKYLAGCNNHWMPTEVSMQA 71

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWKS++GLTDDER+M+KRNLGFFA++ESLVANNIVLA+YRH++NPECRQYLLRQAFE
Sbjct: 72  DIALWKSRDGLTDDERMMLKRNLGFFATAESLVANNIVLAVYRHITNPECRQYLLRQAFE 131

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EAVH+HTFQYI  SLGLDEGELFNMYRE+PSI+ K  WAL+YTQ L +P F  GT +ADQ
Sbjct: 132 EAVHTHTFQYICESLGLDEGELFNMYREIPSISDKDAWALRYTQNLENPDFEIGTPEADQ 191

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGID IN
Sbjct: 192 AFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDCIN 251

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EFQ++ RTML EA  LE+AY  +TMP+G +GLNA  CE+YM+FI NRR
Sbjct: 252 QIKIENPHLWTPEFQEEVRTMLTEACELEVAYGRDTMPRGILGLNAGLCEEYMRFITNRR 311

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C Q+GLEP+F  T NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 312 CAQLGLEPVFPETANPFPWMSEAMDLKKEKNFFETRVIEYQSGGALDWD 360


>gi|187479453|ref|YP_787478.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella avium
           197N]
 gi|115424040|emb|CAJ50593.1| ribonucleoside-diphosphate reductase beta chain [Bordetella avium
           197N]
          Length = 394

 Score =  338 bits (867), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 209/345 (60%), Positives = 268/345 (77%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           + +    +RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+AL
Sbjct: 50  ADLGNTAQRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIAL 109

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H
Sbjct: 110 WKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIH 169

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+
Sbjct: 170 THAYQYIVESLDLDESEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEADQTLLK 229

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN IK+
Sbjct: 230 SLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKL 289

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QI
Sbjct: 290 ENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQI 349

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           G+EPL+   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 350 GIEPLYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 394


>gi|254784923|ref|YP_003072351.1| ribonucleotide-diphosphate reductase subunit beta [Teredinibacter
           turnerae T7901]
 gi|237687536|gb|ACR14800.1| ribonucleoside-diphosphate reductase [Teredinibacter turnerae
           T7901]
          Length = 453

 Score =  338 bits (867), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 218/351 (62%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 103 LDVAPGLEELEMGAARIEVDDKRMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 162

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A+WKS+ GL+ DER ++ R+LG+F++++SLVANN+VLAIYRH++NPE RQYLLRQ
Sbjct: 163 MTADVAIWKSEEGLSADERKIVMRSLGYFSTADSLVANNLVLAIYRHITNPEARQYLLRQ 222

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P F TGT +
Sbjct: 223 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREVPSVAKKAAWSITHTQGISDPQFHTGTPE 282

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQE L++L  FYV+ EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 283 ADQELLRNLIGFYVITEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 342

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT+ FQQ+ + M+ E T LEI YA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 343 VINQIKLENPHLWTESFQQEVKQMVLEGTELEIGYARDTMPRGVLGMNAAIMEEYLHFIA 402

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL+  +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W
Sbjct: 403 NRRLAQLGLKEAYPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSW 453


>gi|330892405|gb|EGH25066.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 415

 Score =  338 bits (867), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 212/352 (60%), Positives = 275/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
              D+ALWK+  GLTDDER ++ RNLGFF++++SLVA+N+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 KTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVAHNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|241664219|ref|YP_002982579.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12D]
 gi|309783064|ref|ZP_07677783.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|240866246|gb|ACS63907.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|308918172|gb|EFP63850.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 402

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 210/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|163854887|ref|YP_001629185.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           petrii DSM 12804]
 gi|163258615|emb|CAP40914.1| ribonucleoside-diphosphate reductase beta chain [Bordetella petrii]
          Length = 396

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 209/342 (61%), Positives = 268/342 (78%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
            A   RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+
Sbjct: 55  DAAAHRVKVADKRIINGKTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKN 114

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H 
Sbjct: 115 PNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHA 174

Query: 131 FQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +QYI+ SL LDE E+FN Y EVPSI AK  + + + + ++ P+F TGT ++DQ+ L+ L 
Sbjct: 175 YQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIEAIADPTFHTGTPESDQKLLKSLI 234

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN IK+ENP
Sbjct: 235 VFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKLENP 294

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           HLWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+E
Sbjct: 295 HLWTPEFREEIRGLFQKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIE 354

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PL+   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 355 PLYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 396


>gi|307546480|ref|YP_003898959.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
 gi|307218504|emb|CBV43774.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
          Length = 415

 Score =  338 bits (866), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 219/352 (62%), Positives = 284/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ VDDK+M+NAR+D+NQL+P KY WAW+KYL    NHWMP EV 
Sbjct: 64  LDVAAGLEELEMGAARIEVDDKQMINARADLNQLVPFKYEWAWQKYLDGSANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GLTDDER +++R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 124 MNADIALWKSADGLTDDERRIVERSLGYFSTADSLVANNLVLALYRLITNPECRQYLLRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY + SL +DEGE+FNMYRE+PS+ AK+ W+L++TQ+L+ P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCVESLAMDEGEVFNMYREIPSVAAKSAWSLKHTQSLARPDFHTGTPE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF+QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D
Sbjct: 244 TDQELLRNLVAFYCVTEGIFFYCGFSQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVD 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQ +   M+ E T LEIAYA ++MP+G +G+NA   E+Y+ FI 
Sbjct: 304 MINQIKIENPHLWTPEFQDECTQMILEGTELEIAYARDSMPRGVLGMNAAIMEEYLHFIC 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  F   +NPFPWMSE+IDL+KEKNFFETRVTEYQ G  L WD
Sbjct: 364 NRRLAQIGLKEQFPGAQNPFPWMSEIIDLRKEKNFFETRVTEYQVGGALSWD 415


>gi|17547523|ref|NP_520925.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           solanacearum GMI1000]
 gi|17429827|emb|CAD16511.1| putative transmembrane ribonucleoside reductase (small chain)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 400

 Score =  338 bits (866), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 210/339 (61%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 62  SRRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 121

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QY
Sbjct: 122 LTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQY 181

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF 
Sbjct: 182 IVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFA 241

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLW
Sbjct: 242 CIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLW 301

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF
Sbjct: 302 TAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALF 361

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              +NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 362 PNEDNPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 400


>gi|256822964|ref|YP_003146927.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
 gi|256796503|gb|ACV27159.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
          Length = 421

 Score =  338 bits (866), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 218/352 (61%), Positives = 281/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ VDDK+M+N R+D+NQL+P KY WAW+KYL  C+NHWMP E+ 
Sbjct: 70  LDVAPGLEELEMGAARIEVDDKKMINCRADLNQLVPFKYDWAWQKYLDGCSNHWMPQEIN 129

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WK  NGLTDDER ++ R+LG+F++++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 130 MTKDVATWKDPNGLTDDERKIVMRSLGYFSTADSLVANNLVLAIYRLITNPECRQYILRQ 189

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY + SLG+DE E+FNMYREVPSI  KA W++++TQ +S+P+F TGT +
Sbjct: 190 AFEEAIHTHAYQYCVESLGMDEAEVFNMYREVPSIAKKAAWSIKHTQGISNPTFKTGTDE 249

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           ADQE L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFG+D
Sbjct: 250 ADQELLRNLIGFYCVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGVD 309

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT EF+Q+   M+ E T LEI YA +TMP+G +G+NA   E+Y+QFI 
Sbjct: 310 IINQIKLENPHLWTAEFKQEVLQMILEGTQLEIEYARDTMPRGVLGMNAGMMEEYLQFIC 369

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   FK   NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 370 NRRLAQLGLPEQFKNVSNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 421


>gi|15596352|ref|NP_249846.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAO1]
 gi|107100605|ref|ZP_01364523.1| hypothetical protein PaerPA_01001630 [Pseudomonas aeruginosa PACS2]
 gi|116049087|ref|YP_792111.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152988648|ref|YP_001349579.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PA7]
 gi|218892881|ref|YP_002441750.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa LESB58]
 gi|254239525|ref|ZP_04932847.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|296390475|ref|ZP_06879950.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAb1]
 gi|313106126|ref|ZP_07792381.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
 gi|9947077|gb|AAG04544.1|AE004545_7 NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa PAO1]
 gi|115584308|gb|ABJ10323.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126192903|gb|EAZ56966.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|150963806|gb|ABR85831.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa PA7]
 gi|187939552|gb|ACD38699.1| ribonucleoside reductase small chain [Pseudomonas aeruginosa]
 gi|218773109|emb|CAW28921.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa LESB58]
 gi|310878883|gb|EFQ37477.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
          Length = 415

 Score =  338 bits (866), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 215/352 (61%), Positives = 279/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++    RV V DK+M+NAR+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDIQEGLDDLEGSAARVQVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKSK+GL++DER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MNADIALWKSKDGLSEDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMY E+PS+  KA+W L+YT+++S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPMFQTGTPE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D++FL++L  +Y V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDRQFLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLW  + + ++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIA
Sbjct: 304 VINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIA 363

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 364 NRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 415


>gi|226940720|ref|YP_002795794.1| ribonucleotide-diphosphate reductase subunit beta [Laribacter
           hongkongensis HLHK9]
 gi|226715647|gb|ACO74785.1| Ribonucleoside-diphosphate reductase beta chain [Laribacter
           hongkongensis HLHK9]
          Length = 357

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 214/338 (63%), Positives = 262/338 (77%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
            RVN  DKR++N  +DVNQL+P KY WAW+KYL+ C NHWMP EV MQ D+ LWK  NGL
Sbjct: 20  GRVNAVDKRIINGDTDVNQLVPFKYHWAWDKYLATCANHWMPQEVNMQRDIELWKRPNGL 79

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER ++ RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 80  TDDERRIVIRNLGFFTTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 139

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y E+ SI AK  + + +  TL  P+F TGT ++DQ  L+ L VF  
Sbjct: 140 VESLGLDEGEVFNAYHEIASIRAKDEFLIPFIDTLCDPAFKTGTPESDQLLLKSLIVFAC 199

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK ENPHLWT
Sbjct: 200 IMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINSIKQENPHLWT 259

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EFQ++   +  +A  LE AYA +TMP+G +GLNA   ++Y+ FIANRR  QIGLEPLF 
Sbjct: 260 VEFQEELYGLFRKAIDLEYAYAEDTMPRGVLGLNAAMFKEYLDFIANRRMQQIGLEPLFT 319

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           + +NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 320 HVDNPFPWMSEMIDLKKEKNFFETRVTEYQSGGALDWD 357


>gi|299065648|emb|CBJ36820.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CMR15]
          Length = 398

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 210/339 (61%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 60  SRRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QY
Sbjct: 120 LTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQY 179

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF 
Sbjct: 180 IVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFA 239

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLW
Sbjct: 240 CIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLW 299

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF
Sbjct: 300 TAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALF 359

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              +NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 360 PNEDNPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 398


>gi|313200886|ref|YP_004039544.1| ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
 gi|312440202|gb|ADQ84308.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
          Length = 381

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 203/340 (59%), Positives = 262/340 (77%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
              RV   DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+A WK  +
Sbjct: 42  ATGRVQAVDKRVINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEISMSRDIAQWKDSS 101

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT+DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +Q
Sbjct: 102 ALTEDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQ 161

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDE E+FN Y+EV SI  K ++ + +  TL+ P F TGT  ADQ+ L+ L VF
Sbjct: 162 YIVESLGLDESEIFNAYQEVSSIRDKDDFLIPFINTLTDPEFKTGTTQADQQLLRSLIVF 221

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K+ENPHL
Sbjct: 222 ACIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHL 281

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EF+++ + ++ +A  LE  YA +TMP+G +GLNA   ++Y++FIANRR  QIG++ L
Sbjct: 282 WTPEFREEIKRLMQQAVELEYRYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDAL 341

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +    NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 342 YPGASNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 381


>gi|167564160|ref|ZP_02357076.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis EO147]
          Length = 369

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 267/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 31  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 90

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 91  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 150

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ L VF 
Sbjct: 151 IVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFA 210

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 211 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 270

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 271 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 330

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 331 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 369


>gi|148359319|ref|YP_001250526.1| ribonucleoside-diphosphate reductase subunit beta [Legionella
           pneumophila str. Corby]
 gi|296107366|ref|YP_003619066.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281092|gb|ABQ55180.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila str. Corby]
 gi|295649267|gb|ADG25114.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610475|emb|CBX00047.1| hypothetical protein LPW_18021 [Legionella pneumophila 130b]
          Length = 367

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 225/349 (64%), Positives = 282/349 (80%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  
Sbjct: 17  ATGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSA 76

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 77  DVALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 136

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ
Sbjct: 137 EALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQ 196

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 197 RLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVIN 256

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR
Sbjct: 257 QIKIENPHLWTPEFKNEMIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRR 316

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 317 LNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 365


>gi|75677068|ref|YP_319489.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           winogradskyi Nb-255]
 gi|74421938|gb|ABA06137.1| ribonucleotide reductase [Nitrobacter winogradskyi Nb-255]
          Length = 391

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 268/351 (76%), Positives = 296/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            +  GL  I  G  RV VDDKRM+NAR+DVNQLLPLKY WAWEKYLS CNNHWMPTEV M
Sbjct: 41  TDAAGLGDIDRGGARVRVDDKRMINARADVNQLLPLKYRWAWEKYLSGCNNHWMPTEVSM 100

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKSK+GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 101 QADIALWKSKDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 160

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +A
Sbjct: 161 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTRHLDDPGFKTGTPEA 220

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGF QILSLGR NKMVGIAEQYQYI+RDES+HLNFGID+
Sbjct: 221 DQAFLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDI 280

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLW+K FQ++ R ML  A  LE AY  +TMP+GF+GLNA  CE YM  IAN
Sbjct: 281 INQIKIENPHLWSKPFQEEVRAMLKNAADLEAAYGRDTMPRGFLGLNATLCETYMHVIAN 340

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+F   +NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 341 RRCAQLGLAPVFPDADNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 391


>gi|329893650|ref|ZP_08269784.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
 gi|328923577|gb|EGG30889.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
          Length = 432

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 277/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    GL  ++ G  RV+VD+K M+N R+D+NQL+P KY WAW+KY+  C NHWMP E+ 
Sbjct: 81  MDLAPGLEELELGAARVSVDEKAMINCRADLNQLVPFKYDWAWQKYIDGCANHWMPQEIN 140

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+A WKS + L+DDER ++ R+LG+F++++SLVANN+VL IYR ++NPECRQYLLRQ
Sbjct: 141 MTADVATWKSADVLSDDERRIVMRSLGYFSTADSLVANNLVLGIYRLITNPECRQYLLRQ 200

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W+L +T +LS P+F TGT +
Sbjct: 201 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVAKKATWSLSHTHSLSDPNFKTGTTE 260

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 261 NDQTLLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 320

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLWT++FQ++   ML E T +EI YA +TMP+G +G+NA   E+Y+QFI 
Sbjct: 321 VINQIKLENPHLWTEDFQKEVIQMLLEGTQIEIEYARDTMPRGVLGMNAAMMEEYLQFIC 380

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   F   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 381 NRRLAQLGLPEQFPGVQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALSWD 432


>gi|253998799|ref|YP_003050862.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
 gi|253985478|gb|ACT50335.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
          Length = 383

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 203/339 (59%), Positives = 262/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
             RV   DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ M  D+A WK  + 
Sbjct: 45  TGRVQAVDKRVINGQTDVNQLVPFKYHWAWDKYLAGCANHWMPQEISMSRDIAQWKDSSA 104

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QY
Sbjct: 105 LTEDERLIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQY 164

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y+EV SI  K ++ + +  TL+ P F TGT  ADQ+ L+ L VF 
Sbjct: 165 IVESLGLDESEIFNAYQEVSSIRDKDDFLIPFINTLTDPEFKTGTTQADQQLLRSLIVFA 224

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K+ENPHLW
Sbjct: 225 CIMEGLFFYVGFVQILALGRQNKMQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHLW 284

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+++ + ++ +A  LE  YA +TMP+G +GLNA   ++Y++FIANRR  QIG++ L+
Sbjct: 285 TPEFREEIKRLMQQAVELEYRYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDALY 344

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 345 PGASNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 383


>gi|160871658|ref|ZP_02061790.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
 gi|159120457|gb|EDP45795.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
          Length = 362

 Score =  337 bits (864), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 216/348 (62%), Positives = 277/348 (79%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TGL  ++ G  RV+VDDK+++N R+D+NQL+P KY WAWEKYL+AC NHWMP E+ M  D
Sbjct: 14  TGLETLEVGAARVHVDDKKIINCRADLNQLVPFKYKWAWEKYLAACANHWMPQEINMSAD 73

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +ALW+   GL +DERL+++R+LGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFEE
Sbjct: 74  IALWRDAKGLREDERLIVERSLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFEE 133

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QY+I SLG+DE  +FNMYRE+P++  K  WAL +TQ+L+ P+F TGT + DQ 
Sbjct: 134 ALHTHAYQYVIESLGMDEARIFNMYRELPTVAKKTEWALPFTQSLADPNFRTGTPETDQR 193

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+DL  FYVVFEG++FY GF+QILS+GR NKM G AEQ+QYI+RDES+HLNFGIDVINQ
Sbjct: 194 LLRDLIAFYVVFEGIFFYVGFSQILSMGRQNKMTGTAEQFQYILRDESMHLNFGIDVINQ 253

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           IK+ENPHLWT EF++    ++ E   LE  YA +T+P+G +GLNA     Y++FI NRR 
Sbjct: 254 IKLENPHLWTPEFKRYVINLIKEGVDLEYQYALDTLPRGILGLNANLMWDYLRFIGNRRF 313

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL   +    NP PWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 314 TQIGLAEQYPGVSNPLPWMSEIIDLKKEKNFFETRVTEYQTGGSLNWD 361


>gi|167574685|ref|ZP_02367559.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis C6786]
          Length = 369

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 266/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 31  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 90

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 91  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 150

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT  ADQ+ L+ L VF 
Sbjct: 151 IVESLGLDEGEIFNAYHEVSSIRAKDEFLIPFIHTLTDPAFKTGTLVADQKLLKSLIVFA 210

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 211 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 270

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 271 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 330

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 331 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 369


>gi|52842002|ref|YP_095801.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629113|gb|AAU27854.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 381

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 225/349 (64%), Positives = 282/349 (80%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R++VDDK+++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ M  
Sbjct: 31  ATGLETLEMGAARIHVDDKQIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEISMSA 90

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK   GLT+DERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 91  DVALWKDPYGLTEDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 150

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+PS++ KA WAL +TQ+L   +F TGT + DQ
Sbjct: 151 EALHTHAYQYIIESLGLDEAEVFNMYREIPSVSRKAVWALPFTQSLGDETFHTGTPENDQ 210

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 211 RLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVIN 270

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+ +   ++ E   LE  YA +TMP G +G+NA   E+Y+ FIANRR
Sbjct: 271 QIKIENPHLWTPEFKNEMIQLIREGVELEYQYARDTMPHGILGMNAEMFEEYLHFIANRR 330

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 331 LNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFFETRVIEYQAGGTLSWD 379


>gi|90425007|ref|YP_533377.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris BisB18]
 gi|90107021|gb|ABD89058.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 386

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 265/350 (75%), Positives = 297/350 (84%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           + TGL  I     RV++DDK M+N R+DVNQLLPLK+ WAWEKYL+ACNNHWMPTEV MQ
Sbjct: 37  DATGLGAIDRSGARVSIDDKAMINCRADVNQLLPLKHRWAWEKYLAACNNHWMPTEVSMQ 96

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW S++GLT+DER  IKRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQAF
Sbjct: 97  ADIALWTSRDGLTEDERRAIKRNLGFFATSESLVANNIVLAIYRHLTNPECRQYLLRQAF 156

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++TQ L  P+F TGT +AD
Sbjct: 157 EEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTQHLDDPTFATGTVEAD 216

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           + FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVI
Sbjct: 217 RAFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVI 276

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENP LWT  FQ++ R ML EA  LE AY+ +TMP+GF+GLNA  CEQYM FI NR
Sbjct: 277 NQIKIENPKLWTAGFQEELRGMLQEAAELEAAYSRDTMPRGFLGLNAALCEQYMHFITNR 336

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL P+F   ENPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 337 RCAQLGLAPIFAEVENPFPWMSETMDLKKEKNFFETRVIEYQNGGALTWD 386


>gi|254496936|ref|ZP_05109775.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
 gi|254353845|gb|EET12541.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
          Length = 369

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 227/349 (65%), Positives = 282/349 (80%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TG   I+ G  R++VDDKR++N R+D+NQL+P KY WAW+KYLSAC NHWMP E+ M  
Sbjct: 16  ATGYESIEMGAARIHVDDKRIINCRADLNQLVPFKYTWAWDKYLSACANHWMPNEISMSA 75

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLTDDERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQAFE
Sbjct: 76  DVALWKDPNGLTDDERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQAFE 135

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QY+I SLGLDE E+FNMYRE+PS+  KA WAL YTQ+L   SF TGT + DQ
Sbjct: 136 EALHTHAYQYVIESLGLDEAEVFNMYREIPSVATKAAWALPYTQSLGDESFHTGTIENDQ 195

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYV+FEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 196 RLLRDLIAFYVIFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGIDVIN 255

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLWT EF+++   ++ +   +E  YA +TMP G +G+NA   E+Y+ FIANRR
Sbjct: 256 QIKIENPHLWTPEFKEEIIQLIKDGVAMEYQYAKDTMPHGILGMNAEMFEEYLHFIANRR 315

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +QIGL   +   ENPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 316 LNQIGLPEQYPGAENPFPWMSEMMDLKKEKNFFETRVIEYQAGGTLSWD 364


>gi|270156779|ref|ZP_06185436.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|289164772|ref|YP_003454910.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           longbeachae NSW150]
 gi|269988804|gb|EEZ95058.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|288857945|emb|CBJ11805.1| putative ribonucleoside-diphosphate reductase, beta subunit
           [Legionella longbeachae NSW150]
          Length = 366

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 223/352 (63%), Positives = 282/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +   TG   ++ G  R++VDDKR++N R+D+NQL+P KY WAW+KYL+AC NHWMP E+ 
Sbjct: 13  LTGATGYESLEMGAARIHVDDKRIINCRADLNQLVPFKYKWAWDKYLTACANHWMPNEIS 72

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGLT+ ERL+IKRNLGFF++++SLVANN+VLA+YRH++NPECRQYLLRQ
Sbjct: 73  MSADVALWKDPNGLTEAERLIIKRNLGFFSTADSLVANNLVLAVYRHITNPECRQYLLRQ 132

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY+I SLGLDE E+FNMYRE+PS+  KA WAL YTQ+L+  +F TGT +
Sbjct: 133 AFEEALHTHAYQYVIESLGLDEAEVFNMYREIPSVATKAAWALPYTQSLADETFHTGTVE 192

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L+DL  FYVVFEG++FY GF QILS+GR NKMVG +EQ+QYI+RDES+H+NFGID
Sbjct: 193 NDQRLLRDLIAFYVVFEGIFFYVGFTQILSMGRRNKMVGTSEQFQYILRDESMHMNFGID 252

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIKIENPHLWT EF+++   ++ +   LE  YA +TMP+G +G+NA   E+Y+ FIA
Sbjct: 253 VINQIKIENPHLWTSEFKEEIIQLIRQGVDLEYQYAKDTMPQGILGMNAEMFEEYLHFIA 312

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGL   +    NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 313 NRRLTQIGLAEQYPGAVNPFPWMSEMMDLKKEKNFFETRVIEYQAGGTLSWD 364


>gi|224825450|ref|ZP_03698555.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
 gi|224602371|gb|EEG08549.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
          Length = 360

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 204/340 (60%), Positives = 257/340 (75%), Gaps = 1/340 (0%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV MQ D+  WK+  
Sbjct: 22  GTGRVNASDKRVINGQTDVNQLVPFKYKWAWEKYLAQCANHWMPQEVNMQRDIEQWKT-G 80

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++DE  ++KRNLGFF +++SL ANNIVL  YR ++ PECRQ+LLRQAF+EA+H+H +Q
Sbjct: 81  QLSEDEMRLVKRNLGFFVTADSLAANNIVLGTYRQITAPECRQFLLRQAFDEAIHTHAYQ 140

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y E+ SI  K  + + +  TL +P F TGT + DQ+ L+ L VF
Sbjct: 141 YIVESLGLDEGEVFNAYHEIKSIRDKDEFLIPFIDTLCNPEFKTGTTETDQQLLKSLIVF 200

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN +K ENP L
Sbjct: 201 ACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTVKQENPQL 260

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT+EF+ +   +   A  LE AYA +TMP+G +GLNA   ++Y++FIANRR  QIGLEP+
Sbjct: 261 WTEEFKAEITGLFKHAVELEYAYAEDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGLEPM 320

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F    NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 321 FPGVTNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 360


>gi|212212091|ref|YP_002303027.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuG_Q212]
 gi|212010501|gb|ACJ17882.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuG_Q212]
          Length = 401

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 222/349 (63%), Positives = 279/349 (79%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  
Sbjct: 52  ATGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTA 111

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFE
Sbjct: 112 DIALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFE 171

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+
Sbjct: 172 EALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDR 231

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 232 RLLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVIN 291

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRR
Sbjct: 292 QIKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRR 351

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 352 CAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|29654845|ref|NP_820537.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 493]
 gi|154705923|ref|YP_001423853.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii Dugway 5J108-111]
 gi|161831080|ref|YP_001597389.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 331]
 gi|29542113|gb|AAO91051.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           RSA 493]
 gi|154355209|gb|ABS76671.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           Dugway 5J108-111]
 gi|161762947|gb|ABX78589.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 331]
          Length = 401

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 222/349 (63%), Positives = 279/349 (79%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  
Sbjct: 52  ATGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTA 111

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFE
Sbjct: 112 DIALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFE 171

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+
Sbjct: 172 EALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDR 231

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 232 RLLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVIN 291

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRR
Sbjct: 292 QIKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRR 351

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 352 CAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|297563527|ref|YP_003682501.1| ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296847975|gb|ADH69995.1| Ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 360

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 266/349 (76%), Positives = 301/349 (86%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            +GL  I+   +RVNVDDK M+NAR+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV MQ 
Sbjct: 12  TSGLGEIERDAERVNVDDKAMINARADVNQLLPLKYTWAWEKYLAGCNNHWMPTEVAMQA 71

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWKS++GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YR L+NPECRQYLLRQAFE
Sbjct: 72  DIALWKSRDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLTNPECRQYLLRQAFE 131

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EAVH+HTFQYI  SLGLDEGELFNMYREVPSITAK  WAL+YTQ L +P F TGT +ADQ
Sbjct: 132 EAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALKYTQNLENPEFRTGTPEADQ 191

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            FL+DL  FYV+FEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDVIN
Sbjct: 192 AFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVIN 251

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLW++EFQ + R ML EA  LE+AY  ETMP+G +GLNA  CE+YM FI +RR
Sbjct: 252 QIKIENPHLWSEEFQAEVRQMLTEACELEVAYGRETMPRGVLGLNAELCEKYMHFITDRR 311

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             QIGL P+F  TENPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 312 AEQIGLAPIFGETENPFPWMSEMMDLQKEKNFFETRVIEYQTGGGLDWD 360


>gi|119478322|ref|ZP_01618353.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119448662|gb|EAW29907.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 422

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 213/352 (60%), Positives = 282/352 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G  R+ V+DK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 71  LDVTAGLEELELGAARLTVEDKAMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 130

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK  NGL+DDER ++ R+LG+F++++SLVANN++LAIYRH++NPECRQYLLRQ
Sbjct: 131 MTADVALWKDPNGLSDDERRIVMRSLGYFSTADSLVANNLILAIYRHITNPECRQYLLRQ 190

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY + SL +DEGE+FNMYRE+PSI  KA W+L++T +LS P+F TGT +
Sbjct: 191 AFEEAIHTHAYQYCVESLAMDEGEVFNMYRELPSIAKKAAWSLRHTHSLSDPNFKTGTPE 250

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 251 TDQELLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 310

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENP LW+++FQQ+   M+ E T LEI YA ++MP+G +G+NA   E+Y+QFI+
Sbjct: 311 VINQIKLENPQLWSEKFQQEIIQMILEGTQLEIEYARDSMPRGVLGMNAAMMEEYLQFIS 370

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR +Q+GL   ++  +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 371 NRRLNQLGLPEQYQGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALNWE 422


>gi|153208286|ref|ZP_01946665.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165919229|ref|ZP_02219315.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212219268|ref|YP_002306055.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuK_Q154]
 gi|120576070|gb|EAX32694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917090|gb|EDR35694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212013530|gb|ACJ20910.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuK_Q154]
          Length = 401

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 222/349 (63%), Positives = 279/349 (79%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  ++ G  R+ VDDK+++N  +D+NQL+P KY WAW+KYLS C NHWMP E+ M  
Sbjct: 52  ATGLEQLEMGAARIRVDDKKIINCHADLNQLVPFKYTWAWQKYLSGCANHWMPNEINMTA 111

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+ALWK  NGLT DER ++KR+LGFF++++SLVANN+VLAIYRH++NPECRQYLLRQAFE
Sbjct: 112 DIALWKDPNGLTADERTIVKRSLGFFSTADSLVANNLVLAIYRHITNPECRQYLLRQAFE 171

Query: 124 EAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           EA+H+H +QYII SLGLDE E+FNMYRE+P+++ KA WAL YTQ+L+ P+F TGT + D+
Sbjct: 172 EALHTHAYQYIIESLGLDEAEVFNMYRELPAVSKKAVWALPYTQSLADPNFKTGTPEDDR 231

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
             L+DL  FYVVFEG++FY GF QIL++GR  KM G +EQ+QYI+RDES+H+NFGIDVIN
Sbjct: 232 RLLRDLIAFYVVFEGLFFYVGFTQILAMGRRGKMTGTSEQFQYILRDESMHVNFGIDVIN 291

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           QIKIENPHLW K FQ++   M+ E   LE  YA +TMP+G +GLNA   + Y+Q+IANRR
Sbjct: 292 QIKIENPHLWNKNFQKEVIEMILEGVELEYQYAKDTMPRGILGLNANMFKDYLQYIANRR 351

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           C QIGL   F   +N FPWMSE++DLKKEKNFFETRV EYQ G  LKWD
Sbjct: 352 CAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFFETRVIEYQAGGTLKWD 400


>gi|187930114|ref|YP_001900601.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12J]
 gi|187727004|gb|ACD28169.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12J]
          Length = 402

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 209/338 (61%), Positives = 259/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+A WK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIATWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|300690381|ref|YP_003751376.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
 gi|299077441|emb|CBJ50067.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
          Length = 402

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 210/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 65  RRVNAADKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 125 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 185 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 245 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 305 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 402


>gi|326315613|ref|YP_004233285.1| ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372449|gb|ADX44718.1| Ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 387

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 206/339 (60%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 49  HRRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNG 108

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 109 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 168

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y EV SI  K  + + + + +  P F TGT + DQ  L+ L VF 
Sbjct: 169 IVESLGLDESEIFNAYNEVDSIRNKDEFLIPFIEAIMDPDFKTGTPETDQTLLKSLIVFA 228

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLW
Sbjct: 229 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLW 288

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+++ + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF
Sbjct: 289 TAEFKEEIKGLFMKAVELEYQYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALF 348

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 349 PNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|121595925|ref|YP_987821.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax sp.
           JS42]
 gi|222112113|ref|YP_002554377.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           ebreus TPSY]
 gi|120608005|gb|ABM43745.1| Ribonucleoside-diphosphate reductase [Acidovorax sp. JS42]
 gi|221731557|gb|ACM34377.1| Ribonucleoside-diphosphate reductase [Acidovorax ebreus TPSY]
          Length = 396

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 207/339 (61%), Positives = 262/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV+  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 58  HRRVSAVDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNG 117

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 118 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 177

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI  K  + + + + +  P FTTGT ++DQ  L+ L VF 
Sbjct: 178 IVESLGLDEGEIFNAYNEVQSIRDKDEFLIPFIEAIMDPRFTTGTPESDQTLLKSLIVFA 237

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLW
Sbjct: 238 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLW 297

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF
Sbjct: 298 TAEFKDEIKALFIKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALF 357

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 358 PNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 396


>gi|291615085|ref|YP_003525242.1| ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585197|gb|ADE12855.1| Ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
          Length = 382

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 211/342 (61%), Positives = 268/342 (78%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
                R+ V+DKR++N+ +DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK+
Sbjct: 41  STSTGRIRVEDKRIINSSADVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSADIALWKN 100

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            NGLTDDER ++KRNLGFF +++SL ANNI L  YRH++NPECRQ+LLRQAFEEA+H+H 
Sbjct: 101 PNGLTDDERRLVKRNLGFFTTADSLAANNIALGTYRHITNPECRQFLLRQAFEEAIHTHA 160

Query: 131 FQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +QYI+ SLGLDEGE+FNMY EV SI  K  + L +   L++P F TGT + DQ+ L+ L 
Sbjct: 161 YQYIVESLGLDEGEVFNMYHEVQSIRDKDEFLLPFIDVLTNPDFKTGTPENDQKLLRSLI 220

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+HLNFG+DVINQIK+ENP
Sbjct: 221 VFACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHLNFGVDVINQIKLENP 280

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           HLWT  F+++ R ++ +   LE  YA +TMP+G +GLNA   ++Y++FIANRRC QIG++
Sbjct: 281 HLWTPAFREEVRGLIQKGVELEYRYAEDTMPRGVLGLNAGMFKEYLRFIANRRCQQIGVD 340

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            L++   NPFPWM+E+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 341 MLYQGATNPFPWMAEMIDLKKEKNFFETRVTEYQTGGALSWD 382


>gi|126640804|ref|YP_001083788.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ATCC 17978]
 gi|322506921|gb|ADX02375.1| nrdB [Acinetobacter baumannii 1656-2]
 gi|323516789|gb|ADX91170.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 361

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 222/351 (63%), Positives = 281/351 (80%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL  ++ G +RV VDDK M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 11  LDVAPGLEELEMGAQRVQVDDKAMINCRADLNQLVPFKYEWAWQKYLDGCANHWMPQEVN 70

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS+NGLT+DER ++ R+LGFF++++SLVANN+VLAIYRH++NPECRQY+LRQ
Sbjct: 71  MNHDIALWKSENGLTEDERTIVMRSLGFFSTADSLVANNLVLAIYRHITNPECRQYILRQ 130

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYRE+PS+  KA W L+YTQ+LS P+F TGT +
Sbjct: 131 AFEEAIHTHAYQYCIESLGMDEGEVFNMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPE 190

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 191 NDQRLLRNLIAFYCVLEGIFFYCGFTQILSMGRRNKMNGVAEQFQYILRDESMHLNFGID 250

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT EFQQ+   M+ E T+LEI YA +TMP+G +G+NA   E+Y++FI 
Sbjct: 251 MINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFIC 310

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           NRR  Q+GL   F    NPF WMSE++DL+KEKNFFETRVT+YQ G  L W
Sbjct: 311 NRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFFETRVTDYQTGGALSW 361


>gi|254429337|ref|ZP_05043044.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
 gi|196195506|gb|EDX90465.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
          Length = 355

 Score =  335 bits (860), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 219/352 (62%), Positives = 278/352 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M    G++ ++    RV VDDKRM+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 4   MDIEEGVAELEGASGRVEVDDKRMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 63

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  DLALWK  +GLTDDER ++KRNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 64  MNADLALWKKADGLTDDERRIVKRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQ 123

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           +FEEA+H+H +QY I SLG+DEGE+FNMY+E+PS+  KA W +QYT+ LS P FTTGT +
Sbjct: 124 SFEEAIHTHAYQYCIESLGMDEGEIFNMYQEIPSVAKKAQWGIQYTRDLSDPEFTTGTVE 183

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+  L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+H+NFGID
Sbjct: 184 TDKALLENLIAFYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHVNFGID 243

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           VINQIK+ENPHLW  + + K+  M+ E   LEI YA +TMP+G +G+NA   E+Y+QFIA
Sbjct: 244 VINQIKLENPHLWDAQMRDKATQMILEGAELEIQYARDTMPRGVLGMNAAMMEEYLQFIA 303

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   FK   NPFPWMSE++DL+KEKNFFETRVTEYQ G  L W+
Sbjct: 304 NRRLAQLGLPEQFKGVNNPFPWMSEIMDLRKEKNFFETRVTEYQVGGALSWE 355


>gi|332286774|ref|YP_004418685.1| ribonucleoside-diphosphate reductase beta chain [Pusillimonas sp.
           T7-7]
 gi|330430727|gb|AEC22061.1| ribonucleoside-diphosphate reductase beta chain [Pusillimonas sp.
           T7-7]
          Length = 387

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 209/340 (61%), Positives = 263/340 (77%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D++LWK+ N
Sbjct: 48  GSGRVRAADKRIINGKTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDISLWKNPN 107

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +Q
Sbjct: 108 GLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQ 167

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P F TGT +ADQ  L+ L VF
Sbjct: 168 YIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPHFQTGTPEADQTLLKSLIVF 227

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN IK+ENPHL
Sbjct: 228 ACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHL 287

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT EF+++ R +  +A  LE AYA +TMP+G +GLNA   + Y++FIANRRC QIGLEPL
Sbjct: 288 WTAEFREELRELFKKAVDLEYAYAEDTMPRGVLGLNASMFKSYLRFIANRRCQQIGLEPL 347

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 348 FGQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGALSWE 387


>gi|85714830|ref|ZP_01045816.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
 gi|85698316|gb|EAQ36187.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
          Length = 389

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 270/351 (76%), Positives = 297/351 (84%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A+ TGL  I  G  RV VDDKRM+NAR+DVNQLLP KY WAWEKYLS CNNHWMPTEV M
Sbjct: 39  ADATGLGDIDRGAARVRVDDKRMINARADVNQLLPFKYRWAWEKYLSGCNNHWMPTEVSM 98

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKS++GLTDDER M+KRNLGFFA+SESLVANNIVLAIYRHL+NPECRQYLLRQA
Sbjct: 99  QADIALWKSRDGLTDDERRMVKRNLGFFAASESLVANNIVLAIYRHLTNPECRQYLLRQA 158

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL++T+ L  P F TGT +A
Sbjct: 159 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALKHTRHLDDPGFKTGTPEA 218

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGF QILSLGR NKM+GIAEQYQYI+RDES+HLNFGIDV
Sbjct: 219 DQAFLRDLVAFYVVFEGMWFYTGFVQILSLGRRNKMIGIAEQYQYILRDESIHLNFGIDV 278

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIKIENPHLWTK FQ + R ML  A  LE AY  +TMP+GF+GLNA  CE YM  IAN
Sbjct: 279 INQIKIENPHLWTKTFQDEVRAMLKNAAELEAAYGRDTMPRGFLGLNAALCETYMHVIAN 338

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+F  T+NPFPWMSE +DLKKEKNFFETRV EYQ G  L WD
Sbjct: 339 RRCAQLGLAPVFAETDNPFPWMSEAMDLKKEKNFFETRVIEYQNGGALAWD 389


>gi|121606275|ref|YP_983604.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas
           naphthalenivorans CJ2]
 gi|120595244|gb|ABM38683.1| Ribonucleoside-diphosphate reductase [Polaromonas naphthalenivorans
           CJ2]
          Length = 387

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 209/344 (60%), Positives = 260/344 (75%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
            I A  KRV   DKR++N ++DVNQL+P KY WAWEKYL++C NHWMP EV M  D+ALW
Sbjct: 44  EIPAKAKRVKASDKRIINGQTDVNQLVPFKYKWAWEKYLASCANHWMPQEVNMTRDIALW 103

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           K  NGL+DDER ++ RNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+
Sbjct: 104 KDPNGLSDDERRLVMRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHT 163

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H +QYI  SLGLDEGE+FN Y EV SI  K  + + + + +S P F TGT ++DQ  L+ 
Sbjct: 164 HAYQYITESLGLDEGEIFNAYNEVQSIKDKDQFLIPFIEAISDPGFKTGTLESDQTLLKS 223

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+E
Sbjct: 224 LIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLE 283

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP LWT EF+ +   +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIG
Sbjct: 284 NPQLWTAEFKAEINALFMKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIG 343

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           LE LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 344 LETLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|149927167|ref|ZP_01915424.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
 gi|149824106|gb|EDM83327.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
          Length = 399

 Score =  335 bits (859), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 204/341 (59%), Positives = 257/341 (75%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   RVN  DKR++N  +DVNQL+P KY WAWEKYLS C NHWMP E+ M  D+ALWK  
Sbjct: 59  AKAGRVNAADKRVINGTTDVNQLVPFKYKWAWEKYLSQCANHWMPQEINMDRDIALWKDP 118

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           NGLT+DERL++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAF+EA+H+H +
Sbjct: 119 NGLTEDERLIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFDEAIHTHAY 178

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           QYI+ SLG+ E E FN Y E+  I AK ++ L +   L+ PSF TGT +ADQ  L+ L  
Sbjct: 179 QYIVESLGIPEAETFNAYNEISCIKAKDDFLLPFIDVLTDPSFKTGTLEADQTLLKSLIA 238

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  + EGM+FY GF QIL+LGR NKM+G AEQ+QYI+RDES H  FGID+IN +K+ENPH
Sbjct: 239 FACIMEGMFFYVGFVQILALGRQNKMIGAAEQFQYILRDESAHCTFGIDLINTVKLENPH 298

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EF+++ + M  +A  LE AYA +TMP+G +GLN+    +YM+FI NRR +QIGL  
Sbjct: 299 LWTPEFKEEIKAMFRKAVELEHAYAVDTMPRGVLGLNSAQFMEYMKFICNRRSNQIGLGT 358

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L++   NPFPWMSE++DLKKE NFFE RVTEYQ G  L WD
Sbjct: 359 LYEGATNPFPWMSEMMDLKKETNFFERRVTEYQTGGALSWD 399


>gi|194290770|ref|YP_002006677.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224605|emb|CAQ70616.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Cupriavidus taiwanensis LMG 19424]
          Length = 396

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 211/338 (62%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVN  DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGL
Sbjct: 59  RRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGL 118

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER +IKRNLGFF +++SL ANNIVL  YR ++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 119 TEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYI 178

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 179 VESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFAC 238

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT
Sbjct: 239 IMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWT 298

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ +   +  +A  LE  YA +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF 
Sbjct: 299 AEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFP 358

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 359 NEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 396


>gi|329902475|ref|ZP_08273120.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548767|gb|EGF33404.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 416

 Score =  335 bits (858), Expect = 7e-90,   Method: Composition-based stats.
 Identities = 212/345 (61%), Positives = 263/345 (76%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
            P     +R+N  DKR++N  +DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D+ L
Sbjct: 72  EPKADPARRMNAADKRIINGNTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRDIEL 131

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           WKS NGLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H
Sbjct: 132 WKSPNGLTDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIH 191

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +H +QYI  SLGLDE E+FN Y EV SI  K  + + +   L+ P FTTGT   DQ+ L+
Sbjct: 192 THAYQYITESLGLDEAEIFNAYHEVKSIRDKDEFLIPFIDALTDPLFTTGTTINDQKLLK 251

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L VF  + EG++FY GFAQIL+LGR NKMVG AEQYQYI+RDES+H NFGID++N IK+
Sbjct: 252 SLIVFSCLMEGLFFYVGFAQILALGRQNKMVGAAEQYQYILRDESMHCNFGIDLVNTIKM 311

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           ENPHLWT EF+ + + +   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR  QI
Sbjct: 312 ENPHLWTPEFRDEIKALFLTAVELEYRYAEDTMPRGVLGLNAPMFKGYLRFIANRRAQQI 371

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           GLEP+F+  ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 372 GLEPMFENEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 416


>gi|53720599|ref|YP_109585.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei K96243]
 gi|53726102|ref|YP_104055.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei ATCC 23344]
 gi|52211013|emb|CAH37001.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei K96243]
 gi|52429525|gb|AAU50118.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 23344]
          Length = 350

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 217/339 (64%), Positives = 269/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 12  EARVNVADKRIINGKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 71

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 72  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 131

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+FTTGT +ADQ+ L+ L VF 
Sbjct: 132 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFTTGTLEADQKLLKSLIVFA 191

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 192 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 251

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 252 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 311

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 312 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 350


>gi|167580513|ref|ZP_02373387.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis TXDOH]
 gi|167618621|ref|ZP_02387252.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis Bt4]
 gi|257137870|ref|ZP_05586132.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
          Length = 350

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 216/339 (63%), Positives = 268/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 12  EARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNG 71

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 72  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 131

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EVPSI AK  + + +  TL+ P+F TGT +ADQ+ L+ L VF 
Sbjct: 132 IVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFA 191

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLW
Sbjct: 192 CIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLW 251

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + R +   A  LE  YA +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF
Sbjct: 252 TAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLF 311

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 312 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 350


>gi|319791701|ref|YP_004153341.1| ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
 gi|315594164|gb|ADU35230.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
          Length = 411

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 206/338 (60%), Positives = 256/338 (75%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGL
Sbjct: 74  QRVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGL 133

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 134 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 193

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + L +   +S P F TGT + DQ  L+ L VF  
Sbjct: 194 VESLGLDESEIFNAYNEVQSIREKDQFLLPFIDAISDPHFKTGTHETDQTLLKSLIVFAC 253

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT
Sbjct: 254 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWT 313

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            EF+ + + +   A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF 
Sbjct: 314 PEFKAEIKDLFMRAVELEYKYAEDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFP 373

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 374 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 411


>gi|331006663|ref|ZP_08329944.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
 gi|330419531|gb|EGG93916.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
          Length = 444

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 280/352 (79%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    G+  ++ G  RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 93  IDPTPGIEELEMGAARVGVDEKAMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 152

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D++LWK  +GL+DDER +I R+LG+F++++SLVANN+VLA+YR ++NPECRQYLLRQ
Sbjct: 153 MTADISLWKDPDGLSDDERRIIMRSLGYFSTADSLVANNLVLAVYRLITNPECRQYLLRQ 212

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SLG+DEGE+FNMYREVPS+  KA W++ +TQ +S P+F TGT +
Sbjct: 213 AFEEAIHTHAYQYCIESLGMDEGEIFNMYREVPSVANKAAWSIAHTQGISDPTFNTGTTE 272

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQE L++L  FY V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 273 TDQELLRNLIGFYAVTEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 332

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLWT+EF+ +   M+ E T LEIAYA +TMP+G +G+NA   E+Y+QFI+
Sbjct: 333 IINQIKLENPHLWTEEFKAEVTQMVLEGTELEIAYARDTMPRGVLGMNAAMMEEYLQFIS 392

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  Q+GL   +   +NPFPWMSE++DL+KEKNFFETRV EYQ G  L W+
Sbjct: 393 NRRLAQLGLTEQYPGAQNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWE 444


>gi|74317993|ref|YP_315733.1| ribonucleotide-diphosphate reductase subunit beta [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057488|gb|AAZ97928.1| ribonucleoside-diphosphate reductase beta chain [Thiobacillus
           denitrificans ATCC 25259]
          Length = 376

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 204/339 (60%), Positives = 258/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
             RV   DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK    
Sbjct: 38  TTRVRASDKRVINGATDVNQLVPFKYKWAWEKYLAGCANHWMPQEVNMSRDIAQWKDPTA 97

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QY
Sbjct: 98  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQY 157

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y E+ SI  K ++ + +  TL++P F TGT + DQ+ L+ L VF 
Sbjct: 158 IVESLGLDEAEIFNAYHEIESIRDKDDFLIPFIDTLTNPEFKTGTPENDQKLLKSLIVFA 217

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK ENPHLW
Sbjct: 218 CIMEGIFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTIKQENPHLW 277

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + RT++ +   LE  YA +TMP+G +GLN+   ++Y++FI+NRRC QIGL+ +F
Sbjct: 278 TSEFKAEIRTLIQKGVELEFRYAEDTMPRGVLGLNSAQFKEYLRFISNRRCQQIGLDEMF 337

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               NPFPWM+E+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 338 PGVSNPFPWMAEMIDLKKEKNFFETRVTEYQTGGALSWD 376


>gi|325983070|ref|YP_004295472.1| ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
 gi|325532589|gb|ADZ27310.1| Ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
          Length = 381

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 208/338 (61%), Positives = 267/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +R+ V+DK+++N  +DVNQL+P KY WAW+KYL AC NHWMP E+ M  D+ALW+  NGL
Sbjct: 44  RRIAVEDKQIINCNADVNQLVPFKYKWAWDKYLGACANHWMPQEISMSRDIALWRDPNGL 103

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QYI
Sbjct: 104 TEDERRLVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQYI 163

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDEGE+FN Y EV SI  K  + + +  TL++P F TGT + DQ+ L+ L VF  
Sbjct: 164 VESLGLDEGEIFNAYHEVSSIRDKDEFLIPFIDTLTNPHFKTGTLETDQQLLRSLIVFAC 223

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVINQIK+ENP LWT
Sbjct: 224 IMEGLFFYVGFTQILALGRQNKMTGSAEQYQYILRDESMHCNFGIDVINQIKMENPQLWT 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K F+++   ++ +A  LE  YA +TMP+G +G+NAP  ++Y+++IANRRC QIGL+ L+ 
Sbjct: 284 KAFREEIAALMQKAVALEYRYAEDTMPRGVLGMNAPMFKEYLRYIANRRCQQIGLDTLYP 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 344 NANNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 381


>gi|319764328|ref|YP_004128265.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|330826374|ref|YP_004389677.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
 gi|317118889|gb|ADV01378.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|329311746|gb|AEB86161.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
          Length = 396

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 203/339 (59%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV+  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NG
Sbjct: 58  HRRVSAVDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMTRDIALWKDPNG 117

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 118 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 177

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDEGE+FN Y EV SI AK  + + + + +  P+F TGT + DQ  L+ L VF 
Sbjct: 178 IVESLGLDEGEIFNAYNEVESIRAKDEFLIPFIEAIMDPAFKTGTPENDQTLLKSLIVFA 237

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LW
Sbjct: 238 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLW 297

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T  F+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGL+ LF
Sbjct: 298 TPAFKDEIKGLFLKAVDLEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLDALF 357

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 358 PNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 396


>gi|239813962|ref|YP_002942872.1| ribonucleotide-diphosphate reductase subunit beta [Variovorax
           paradoxus S110]
 gi|239800539|gb|ACS17606.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus S110]
          Length = 391

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 206/337 (61%), Positives = 258/337 (76%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 55  RVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLT 114

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 115 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 174

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y EVPSI  K  + + +   +S P+F TGT + DQ  L+ L VF  +
Sbjct: 175 ESLGLDESEIFNAYNEVPSIREKDQFLIPFIDAISDPNFKTGTHETDQTLLKSLIVFACL 234

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT 
Sbjct: 235 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWTP 294

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF  
Sbjct: 295 EFKAEIKALFLKAVELEYKYAEDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFPN 354

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 355 EENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 391


>gi|330983931|gb|EGH82034.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 388

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 216/353 (61%), Positives = 283/353 (80%), Gaps = 1/353 (0%)

Query: 1   MANNTGLSPIQAG-EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           M    G   ++ G + RV V  K+M+NAR+DVNQL+P KY WAW+KYL  C+NHWMP EV
Sbjct: 36  MDIGAGERELEEGRQNRVQVGQKQMINARADVNQLVPFKYEWAWQKYLDGCSNHWMPQEV 95

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            M  D+ALWK  NGLTDDERL++KRNLG+F++++SLVANN+VLA+YR ++NPECRQY+LR
Sbjct: 96  NMSADIALWKDPNGLTDDERLILKRNLGYFSTADSLVANNLVLAVYRLITNPECRQYILR 155

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           QAFEEA+H+H +QY + SLGLD+GE+FNMY+EVPS+  KA W++++   ++ P+F TGT 
Sbjct: 156 QAFEEAIHTHAYQYCVESLGLDDGEIFNMYQEVPSVARKAAWSIKHMDAITDPAFQTGTV 215

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +AD  FL++L  +Y V EG++FY GF Q LS+GR NK+VG+AEQ+QYI+RDES+HLNFGI
Sbjct: 216 EADTTFLKNLIAYYCVTEGIFFYCGFTQTLSMGRRNKLVGVAEQFQYILRDESMHLNFGI 275

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           D+INQIKIENPHLWT E ++++  M+ + T LEIAYA +TMP+G +G+NA   E+Y+QFI
Sbjct: 276 DMINQIKIENPHLWTDELKREATVMIIQGTQLEIAYARDTMPRGVLGMNAAMMEEYLQFI 335

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           ANRR  QIGL  ++   +NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 336 ANRRLTQIGLPEVYAGAKNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 388


>gi|119713586|gb|ABL97637.1| ribonucleotide-diphosphate reductase beta subunit [uncultured
           marine bacterium EB0_39H12]
          Length = 412

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 214/352 (60%), Positives = 274/352 (77%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    G   ++    RV VDDK M+N R+D+NQL+P KY WAW+KYL    NHWMP EV 
Sbjct: 61  LDAKAGEEELEGLAGRVQVDDKAMINCRADLNQLVPFKYDWAWQKYLDGSANHWMPQEVN 120

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWKS +GLT+DER ++ RNLGFF++++SLVANN+VLAIYR ++NPECRQY+LRQ
Sbjct: 121 MTADIALWKSNDGLTEDERTIVMRNLGFFSTADSLVANNLVLAIYRLITNPECRQYILRQ 180

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
            FEEA+H+H +QY I SLG+DEG +FNMYRE+PS+  KA+W L+YT+ +S P FTTGT +
Sbjct: 181 GFEEAIHTHAYQYCIESLGMDEGAIFNMYREIPSVAKKASWGLKYTKEISDPGFTTGTDE 240

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+  L++L  FY V EG++FY GF QILS+GR NKM G AEQ+QYI+RDES+HLNFGID
Sbjct: 241 TDKLLLKNLIAFYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGID 300

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIK+ENPHLW ++ + ++  M+ E T LEI YA +TMP+G +G+NA   E+Y+QFIA
Sbjct: 301 MINQIKLENPHLWDEQMRHEAAQMILEGTELEIQYARDTMPRGILGMNAGMMEEYLQFIA 360

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRR  QIGLE  F+   NPFPWMSE++DL+KEKNFFETRV EYQ G  L WD
Sbjct: 361 NRRLVQIGLEEEFEGASNPFPWMSEIMDLRKEKNFFETRVIEYQTGGALTWD 412


>gi|134095932|ref|YP_001101007.1| ribonucleotide-diphosphate reductase subunit beta [Herminiimonas
           arsenicoxydans]
 gi|133739835|emb|CAL62886.1| Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide
           reductase small subunit) [Herminiimonas arsenicoxydans]
          Length = 395

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 208/340 (61%), Positives = 266/340 (78%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
             +R++  DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D+ LWK+ N
Sbjct: 56  PTRRMDAADKRIINGKTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRDIELWKNPN 115

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +Q
Sbjct: 116 GLTDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQ 175

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y E+ SI  K  + + +   L+ P+FTTGT + DQ  L+ L VF
Sbjct: 176 YIVESLGLDEGEIFNAYNEIESIRDKDQFLIPFIDVLTDPNFTTGTTENDQTLLRSLIVF 235

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GFAQIL+LGR NKM+G AEQYQYI+RDES+H NFGID+IN IK+ENPHL
Sbjct: 236 ACLMEGLFFYVGFAQILALGRQNKMMGAAEQYQYILRDESMHCNFGIDLINTIKLENPHL 295

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT +F+ + + +   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+
Sbjct: 296 WTPQFRDEIKALFLRAVELEYRYAEDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPM 355

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F+  ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 356 FEQEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALNWE 395


>gi|34497739|ref|NP_901954.1| ribonucleotide-diphosphate reductase subunit beta [Chromobacterium
           violaceum ATCC 12472]
 gi|34103595|gb|AAQ59956.1| ribonucleoside-diphosphate reductase system [Chromobacterium
           violaceum ATCC 12472]
          Length = 360

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 204/340 (60%), Positives = 257/340 (75%), Gaps = 1/340 (0%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           G  RVNV DK+++N  +DVNQL+P K+ WAWEKYL+ C NHWMP EV MQ D+  WK+  
Sbjct: 22  GTGRVNVVDKKVINGTTDVNQLVPFKHKWAWEKYLAQCANHWMPQEVNMQRDIEQWKT-G 80

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            LT+DE  ++KRNLGFF +++SL ANNIVL  YR +++PECRQ+LLRQAF+EA+H+H +Q
Sbjct: 81  QLTEDEMRIVKRNLGFFVTADSLAANNIVLGTYRQITSPECRQFLLRQAFDEAIHTHAYQ 140

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y EV SI  K  + + +   L +P F TGT + DQ+ L+ L VF
Sbjct: 141 YIVESLGLDEGEVFNAYHEVKSIRDKDEFLIPFIDVLCNPEFKTGTVENDQKLLKSLIVF 200

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK+ENP L
Sbjct: 201 ACIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINTIKLENPLL 260

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT  F+ +   +  +A  LE AYA +TMP+G +GLNA   ++Y++FIANRR  QIGL+PL
Sbjct: 261 WTDSFKAEIVDLFKQAVELEYAYAEDTMPRGVLGLNASMFKEYLRFIANRRMQQIGLDPL 320

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F    NPFPWMSE+IDLKKEKNFFETRVTEYQ G  L WD
Sbjct: 321 FPGVNNPFPWMSEMIDLKKEKNFFETRVTEYQTGGALSWD 360


>gi|317402620|gb|EFV83180.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans C54]
          Length = 399

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 210/350 (60%), Positives = 268/350 (76%), Gaps = 1/350 (0%)

Query: 4   NTGLSPIQAGEK-RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
             GL+        RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M 
Sbjct: 50  AAGLTASGNATSQRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMS 109

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAF
Sbjct: 110 RDIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAF 169

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEA+H+H +QYI+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +AD
Sbjct: 170 EEAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEAD 229

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+I
Sbjct: 230 QTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLI 289

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           N +K+ENPHLWT EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANR
Sbjct: 290 NTVKLENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANR 349

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC QIG+EPL+   ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 350 RCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 399


>gi|91787004|ref|YP_547956.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas sp.
           JS666]
 gi|91696229|gb|ABE43058.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666]
          Length = 406

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 208/337 (61%), Positives = 258/337 (76%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT
Sbjct: 70  RVKASDKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLT 129

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI 
Sbjct: 130 EDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIT 189

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDE E+FN Y EV SI  K  + + + + +S P F TGT +ADQ  L+ L VF  +
Sbjct: 190 ESLGLDEAEIFNAYNEVQSIKDKDQFLIPFIEVISDPHFKTGTTEADQTLLKSLIVFACL 249

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT 
Sbjct: 250 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTA 309

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE LF  
Sbjct: 310 EFKAEIKALFLKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLETLFPN 369

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 370 EENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 406


>gi|167586060|ref|ZP_02378448.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ubonensis Bu]
          Length = 403

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 213/337 (63%), Positives = 266/337 (78%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGLT
Sbjct: 67  RVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGLT 126

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 127 EDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIV 186

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FN Y EV SI AK  + + +  TL+ P+F TGT +ADQ+ L+ L VF  +
Sbjct: 187 ESLGLDEGEIFNAYHEVASIRAKDEFLIPFIHTLTDPAFKTGTLEADQKLLKSLIVFACI 246

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT 
Sbjct: 247 MEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTA 306

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
           EF+ + R +  +A  LE  YA +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+  
Sbjct: 307 EFRAEIRELFKQAVDLEYRYAEDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPN 366

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 367 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 403


>gi|255019430|ref|ZP_05291537.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254971128|gb|EET28583.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 345

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 210/340 (61%), Positives = 272/340 (80%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
              RV V+DKR++N R+DVNQL+P KY WAW+KYL+AC NHWMP EV M  D+ALWK   
Sbjct: 5   ATARVRVEDKRIINGRADVNQLVPFKYQWAWDKYLAACANHWMPQEVQMARDIALWKDPK 64

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +Q
Sbjct: 65  GLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQ 124

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FNMY EVPS+ AK  + + + +TL+ P F TGT++ DQ+ L+ L VF
Sbjct: 125 YIVESLGLDEGEIFNMYHEVPSVRAKDEFLIPFIETLADPDFQTGTRENDQKLLRSLIVF 184

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+INQIK+ENP L
Sbjct: 185 ATIMEGLFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDLINQIKLENPQL 244

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT+ FQQ+   ++ +   LE AYA +TMP+G +GLNAP  ++Y+++I NRR  QIGL+P 
Sbjct: 245 WTEGFQQEIVGLIRQGVELECAYADDTMPRGILGLNAPMFKEYVRYIGNRRLSQIGLKPQ 304

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           ++  +NPFPWMSE++DLKKEKNFFE+RVT+YQ G  L WD
Sbjct: 305 WENVQNPFPWMSEMMDLKKEKNFFESRVTDYQTGGALSWD 344


>gi|171057074|ref|YP_001789423.1| ribonucleotide-diphosphate reductase subunit beta [Leptothrix
           cholodnii SP-6]
 gi|170774519|gb|ACB32658.1| Ribonucleoside-diphosphate reductase [Leptothrix cholodnii SP-6]
          Length = 402

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 208/338 (61%), Positives = 255/338 (75%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RVNV DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+A WK  NGL
Sbjct: 65  RRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMSRDIATWKDPNGL 124

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TDDER +IKRNLGFF +++SL ANNI L  YRH++ PECRQ+LLRQAFEEA+H+H +QYI
Sbjct: 125 TDDERRLIKRNLGFFVTADSLAANNITLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYI 184

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + SLGLDE E+FN Y EV SI  K  + + Y   +  P F TGT + DQ  L+ L VF  
Sbjct: 185 VESLGLDESEIFNAYHEVASIREKDEFLIPYIDAIMDPHFKTGTPENDQTLLKSLIVFAC 244

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT
Sbjct: 245 LMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINAIKLENPHLWT 304

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
             F+ + + +  +A  LE  YA +TMP+G +GLNA   + Y+++IANRR  QIGLE LF 
Sbjct: 305 PAFKAEIKALFLKAVELEYRYAEDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEELFP 364

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 365 NEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 402


>gi|145588393|ref|YP_001154990.1| ribonucleotide-diphosphate reductase subunit beta [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046799|gb|ABP33426.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 394

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 207/337 (61%), Positives = 262/337 (77%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGLT
Sbjct: 58  RVNAADKRVINAKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMNRDIALWKDPNGLT 117

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 118 EDERRIIKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 177

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLD+ E+FN Y E+ SI AK  + + Y   L++P+F TGT + DQ  L+ L VF  V
Sbjct: 178 ESLGLDQSEIFNAYNEIESIRAKDEFLIPYIDVLTNPNFKTGTLETDQTLLRSLIVFACV 237

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL++GR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT 
Sbjct: 238 MEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTS 297

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+ + +++  +A  LE  YA +TMP+G +GLNAP  + Y+++I NRRC QIGL+ +F  
Sbjct: 298 AFKDEIKSIFEKAVELEYRYAEDTMPRGVLGLNAPMFKGYLRYICNRRCLQIGLDAMFPN 357

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 358 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 394


>gi|30250346|ref|NP_842416.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           europaea ATCC 19718]
 gi|30181141|emb|CAD86334.1| Ribonucleotide reductase [Nitrosomonas europaea ATCC 19718]
          Length = 382

 Score =  332 bits (850), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 216/339 (63%), Positives = 271/339 (79%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV+V+DKR++N ++DVNQL+P KY WAWEKYLSAC NHWMP E+ M  D+ALWK  NG
Sbjct: 44  HRRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLSACANHWMPQEINMTRDIALWKDPNG 103

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QY
Sbjct: 104 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQY 163

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ S+GLDEGE+FN Y E+ SI  K  + + +  TL+ PSF TGT + DQ+ L+ L VF 
Sbjct: 164 IVESIGLDEGEIFNAYHEIGSIRDKDEFLIPFIDTLTDPSFRTGTLETDQQLLKSLIVFA 223

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLW
Sbjct: 224 CIMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLW 283

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T+EF+++   ++ +A  LE  YA +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF
Sbjct: 284 TREFREEISALMRKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLF 343

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               NPFPWMSE+IDLKKEKNFFETRV EYQ G  L WD
Sbjct: 344 PEAGNPFPWMSEMIDLKKEKNFFETRVIEYQTGGVLSWD 382


>gi|300022335|ref|YP_003754946.1| ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524156|gb|ADJ22625.1| Ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 374

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 266/351 (75%), Positives = 294/351 (83%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + TGL  I     RV VDDK M+NAR+DVNQLLPLKY WAWEKYL+ CNNHWMPTEV M
Sbjct: 24  EDATGLGNIDRNGGRVRVDDKAMINARADVNQLLPLKYRWAWEKYLAGCNNHWMPTEVSM 83

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
           Q D+ALWKSK+GLT++ER MIKRNLGFFA+SESLVANNIVLAIYR+L+NPECRQYLLRQA
Sbjct: 84  QADIALWKSKDGLTEEERRMIKRNLGFFAASESLVANNIVLAIYRNLTNPECRQYLLRQA 143

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEAVH+HTFQYI+ SLGLDEGELFNMYREVPSIT KA WAL YT+ L  PSF TGTK+ 
Sbjct: 144 FEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITDKAAWALAYTKHLDDPSFKTGTKET 203

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYI+RDES+HLNFGIDV
Sbjct: 204 DQAFLRDLIAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDV 263

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQIK EN HLW+K FQ + R ML +A  LE AY  +TMP G +GLN    EQYM+FIAN
Sbjct: 264 INQIKAENAHLWSKAFQDEVRGMLRDAAQLEAAYGRDTMPTGLLGLNPGLTEQYMEFIAN 323

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RRC Q+GL P+FK  ENPFPWMSE +DLKKEKNFFETRV EYQ G  L W+
Sbjct: 324 RRCAQLGLTPVFKDRENPFPWMSEAMDLKKEKNFFETRVIEYQNGGALSWE 374


>gi|120609557|ref|YP_969235.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           citrulli AAC00-1]
 gi|120588021|gb|ABM31461.1| Ribonucleoside-diphosphate reductase [Acidovorax citrulli AAC00-1]
          Length = 387

 Score =  331 bits (849), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 206/339 (60%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 49  HRRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNG 108

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 109 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 168

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y EV SI  K  + + + + +  P F TGT + DQ  L+ L VF 
Sbjct: 169 IVESLGLDESEIFNAYNEVDSIRHKDEFLIPFIEAIMDPDFKTGTPETDQTLLKSLIVFA 228

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLW
Sbjct: 229 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLW 288

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+++ + +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF
Sbjct: 289 TAEFKEEIKGLFMKAVELEYQYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALF 348

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 349 PNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 387


>gi|241764092|ref|ZP_04762129.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
 gi|241366556|gb|EER61044.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
          Length = 398

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 208/339 (61%), Positives = 260/339 (76%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RVN  DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NG
Sbjct: 60  HRRVNAADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNG 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 120 LTDDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 179

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT +ADQ  L+ L VF 
Sbjct: 180 IVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFKTGTPEADQRLLKSLIVFA 239

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLW
Sbjct: 240 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLW 299

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+ + + +   A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF
Sbjct: 300 TAEFKAEIKALFMRAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLETLF 359

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 360 PNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWD 398


>gi|160896947|ref|YP_001562529.1| ribonucleotide-diphosphate reductase subunit beta [Delftia
           acidovorans SPH-1]
 gi|160362531|gb|ABX34144.1| Ribonucleoside-diphosphate reductase [Delftia acidovorans SPH-1]
          Length = 363

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 210/342 (61%), Positives = 262/342 (76%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
               KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK 
Sbjct: 22  STTHKRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMNRDIALWKD 81

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H 
Sbjct: 82  PNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHA 141

Query: 131 FQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +QYI+ SLGLDEGE+FN Y EVPSI  K  + + + + +  P+F TGT + DQ  L+ L 
Sbjct: 142 YQYIVESLGLDEGEIFNAYLEVPSIRDKDEFLIPFIEAIMDPAFKTGTFETDQTLLKSLI 201

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENP
Sbjct: 202 VFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENP 261

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
            LWT EF+++   +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE
Sbjct: 262 QLWTPEFKEEITALFVKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLE 321

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 322 ALFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|121608466|ref|YP_996273.1| ribonucleotide-diphosphate reductase subunit beta
           [Verminephrobacter eiseniae EF01-2]
 gi|121553106|gb|ABM57255.1| Ribonucleoside-diphosphate reductase [Verminephrobacter eiseniae
           EF01-2]
          Length = 399

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 206/342 (60%), Positives = 258/342 (75%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
            A ++RVN  DKR++N ++DVNQL+PLKY WAWEKYL++C NHWMP EV M  D+ALWK+
Sbjct: 58  DAAQRRVNAADKRIINGQTDVNQLVPLKYKWAWEKYLASCANHWMPQEVNMTRDIALWKT 117

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
             GL+DDER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H 
Sbjct: 118 PGGLSDDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHA 177

Query: 131 FQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P F TG+   DQ  L+ L 
Sbjct: 178 YQYIVESLGLDESEIFNAYNEVRSIRDKDQFLIPFIEAIMDPHFHTGSAANDQTLLKSLI 237

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           VF  + EG++FY GFAQIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP
Sbjct: 238 VFACLMEGLFFYVGFAQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENP 297

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
            LWT  F+ +   +  +A  LE  YA +TMP G +G+NA   + Y+++IANRR  QIGLE
Sbjct: 298 LLWTTAFKAEIEALFLQAVELEYRYAEDTMPHGVLGMNASMFKGYLRYIANRRATQIGLE 357

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            LF    NPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 358 TLFPQETNPFPWMSEMIDLKKERNFFETRVIEYQSGGALCWD 399


>gi|299533977|ref|ZP_07047329.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
 gi|298717886|gb|EFI58891.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
          Length = 363

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 210/351 (59%), Positives = 264/351 (75%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A +       +  KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M
Sbjct: 13  ATSAEAGASTSTHKRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNM 72

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 73  TRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 132

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + 
Sbjct: 133 FEEAIHTHAYQYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPET 192

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+
Sbjct: 193 DQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDL 252

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQ+K+ENPHLWT EF+Q+   +  +A  LE  YA +TMP+G +G+NA   + Y+++IAN
Sbjct: 253 INQLKLENPHLWTAEFKQEITELFQKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIAN 312

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  QIGLE LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 313 RRATQIGLEELFPGEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|221065168|ref|ZP_03541273.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
 gi|220710191|gb|EED65559.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
          Length = 363

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 210/351 (59%), Positives = 263/351 (74%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A +       +  KRVN  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M
Sbjct: 13  ATSAEAGASTSTHKRVNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNM 72

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQA
Sbjct: 73  TRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQA 132

Query: 122 FEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
           FEEA+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + 
Sbjct: 133 FEEAIHTHAYQYIVESLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPET 192

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           DQ  L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+
Sbjct: 193 DQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDL 252

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
           INQ+K+ENPHLWT EF+Q+   +   A  LE  YA +TMP+G +G+NA   + Y+++IAN
Sbjct: 253 INQLKLENPHLWTAEFKQEITELFQRAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIAN 312

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RR  QIGLE LF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 313 RRATQIGLEELFPGEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 363


>gi|293603286|ref|ZP_06685715.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
 gi|292818321|gb|EFF77373.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
          Length = 398

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 207/339 (61%), Positives = 264/339 (77%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV V DKR++N  +DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ NG
Sbjct: 60  SQRVKVADKRIINGETDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNG 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 120 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 179

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L VF 
Sbjct: 180 IVESLDLDEAEIFNAYNEVPSIRAKDQFLIPFIDAIADPNFKTGTPEADQTLLKSLIVFA 239

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN +K+ENPHLW
Sbjct: 240 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLW 299

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T  F+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+
Sbjct: 300 TPAFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLY 359

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 PQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 398


>gi|114321252|ref|YP_742935.1| ribonucleotide-diphosphate reductase subunit beta [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114227646|gb|ABI57445.1| Ribonucleoside-diphosphate reductase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 354

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 257/350 (73%), Positives = 296/350 (84%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           N TGL  I+AG  RV+VD+KRM+N R+DVNQLLPLKY WAWEKYL+ CNNHWMPTEVPM 
Sbjct: 5   NATGLEAIEAGAHRVSVDEKRMINCRADVNQLLPLKYEWAWEKYLAGCNNHWMPTEVPMG 64

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+ALW+  +GLT DERLMIKRNLGFFA+SESLVANNIVLAIYRH++NPECRQYLLRQAF
Sbjct: 65  ADIALWRHPDGLTADERLMIKRNLGFFATSESLVANNIVLAIYRHITNPECRQYLLRQAF 124

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEA+H+HTFQYI+ SL LDEGELFNMYREVPSIT KA WAL+YTQ L S  F T +++  
Sbjct: 125 EEAIHTHTFQYIVESLDLDEGELFNMYREVPSITDKAAWALKYTQNLESGHFDTTSREGA 184

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q FL+DL  FYVVFEGMWFYTGFAQILSLGR NKM GIAE YQYI+RDES+HLNFGIDVI
Sbjct: 185 QSFLRDLVAFYVVFEGMWFYTGFAQILSLGRQNKMTGIAEMYQYILRDESIHLNFGIDVI 244

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQI+ ENP LWT +F+Q+  TML EA  LE+AYA +TMP+G +GLNA  CE+YM FI NR
Sbjct: 245 NQIRHENPELWTNDFEQEVLTMLREAVELEVAYARDTMPRGMLGLNADMCEEYMHFITNR 304

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           RC Q+GL+ L+    NPFPWMSEV+DL+KEKNFFETRVT+Y+ G  L+WD
Sbjct: 305 RCAQLGLKELYPGATNPFPWMSEVMDLQKEKNFFETRVTDYRTGGALQWD 354


>gi|255019898|ref|ZP_05291973.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970678|gb|EET28165.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 374

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 209/338 (61%), Positives = 267/338 (78%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP EV M  D+ALWK   GL
Sbjct: 37  ERVRAEDKRIINGSADVNQLVPFKYHWAWDKYLAACANHWMPQEVQMARDIALWKDPKGL 96

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI
Sbjct: 97  TEDERRIVKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYI 156

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPSI AK  + L + +TL+ PSF TGT + DQ+ L+ L VF  
Sbjct: 157 VESIGLDEGEIFNMYHEVPSIRAKDEFLLPFIRTLTDPSFHTGTPENDQKLLRSLIVFAA 216

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+INQIK+ENP LWT
Sbjct: 217 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDLINQIKVENPDLWT 276

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQ++  +++ +   LE AYA +TMP+G +GLNAP  + Y+++I NRR  Q+GL   + 
Sbjct: 277 EPFQEEIVSLIRKGVELECAYADDTMPRGVLGLNAPIFKDYVKYIGNRRLQQLGLPVQWA 336

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L WD
Sbjct: 337 GIQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWD 374


>gi|300309722|ref|YP_003773814.1| transmembrane ribonucleoside reductase small subunit
           [Herbaspirillum seropedicae SmR1]
 gi|300072507|gb|ADJ61906.1| transmembrane ribonucleoside reductase (small chain) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 388

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 210/348 (60%), Positives = 266/348 (76%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            G S      +RVN  DKR++N  +DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D
Sbjct: 41  AGNSEQVDTTRRVNAADKRIINGHTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRD 100

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           + LWK+ NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEE
Sbjct: 101 IELWKNPNGLTEDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEE 160

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+H +QYI+ SLGLDE E+FN Y EV SI  K  + + +  TL+ P F TGT + DQ+
Sbjct: 161 AIHTHAYQYIVESLGLDEAEIFNAYHEVASIRDKDEFLIPFIDTLTDPEFKTGTMENDQK 220

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
            L+ L VF  + EG++FY GF QIL+LGR NKM+G AEQYQYI+RDES+H NFGID+IN 
Sbjct: 221 LLKSLIVFACIMEGLFFYVGFTQILALGRQNKMMGAAEQYQYILRDESMHCNFGIDLINT 280

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +K+ENPHLWT EF+++ +++   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR 
Sbjct: 281 VKMENPHLWTPEFREEIKSLFLRAVELEYRYAEDTMPRGVLGLNAPMFKSYLRFIANRRA 340

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 341 QQIGLDPLFAQEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 388


>gi|311103857|ref|YP_003976710.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
 gi|310758546|gb|ADP13995.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
          Length = 399

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 208/339 (61%), Positives = 266/339 (78%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV V DKR++N ++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK+ NG
Sbjct: 61  SQRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQEINMSRDIALWKNPNG 120

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QY
Sbjct: 121 LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQY 180

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SL LDE E+FN Y EVPSI AK  + + +   ++ P+F TGT +ADQ  L+ L VF 
Sbjct: 181 IVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFKTGTPEADQTLLKSLIVFA 240

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QIL+LGR NKM G AEQY YI+RDES+H NFGID+IN +K+ENPHLW
Sbjct: 241 CLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLW 300

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EF+++ R +  +A  LE AYA +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+
Sbjct: 301 TPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLY 360

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
              ENPFPWM+E+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 361 PQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE 399


>gi|198284354|ref|YP_002220675.1| ribonucleotide-diphosphate reductase subunit beta
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198248875|gb|ACH84468.1| Ribonucleoside-diphosphate reductase [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 374

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 201/338 (59%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP E+ M  D+ALWK   GL
Sbjct: 37  ERVRAEDKRIINGHADVNQLVPFKYQWAWDKYLAACANHWMPQEIQMSRDIALWKDPKGL 96

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQY+LRQAFEEA+H+H +QYI
Sbjct: 97  TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYMLRQAFEEAIHTHAYQYI 156

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPS+  K  + + +   L+ P F TGT + DQ+ L+ L VF  
Sbjct: 157 VESIGLDEGEIFNMYHEVPSVRDKDQFLMPFIDVLADPHFKTGTLENDQKLLRSLIVFAA 216

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT
Sbjct: 217 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWT 276

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQQ+   ++     LE AYA +TMP+G +GLNAP   +Y+++I NRR  Q+GL   + 
Sbjct: 277 EAFQQEIIDLIRRGVELECAYADDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYP 336

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L W+
Sbjct: 337 GVQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWE 374


>gi|315122301|ref|YP_004062790.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495703|gb|ADR52302.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 372

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 276/352 (78%), Positives = 313/352 (88%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A+  GL PIQ G  R++ D+KRM+NARSDVNQLLPLKY WAWEKYL  CNNHWMPTEV 
Sbjct: 21  IADTVGLGPIQKGSARIHADEKRMINARSDVNQLLPLKYKWAWEKYLFGCNNHWMPTEVS 80

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           MQ D+ALW+SKNGLT+DER MIKRNLGFFA+SESLVANNIVLAIYRH+SNPECRQYLLRQ
Sbjct: 81  MQADIALWQSKNGLTNDERHMIKRNLGFFATSESLVANNIVLAIYRHISNPECRQYLLRQ 140

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEAVH+HTFQYI+ SL L+EGELFNMYRE+PSIT KA+WAL+YT+ L+S SF+TGT D
Sbjct: 141 AFEEAVHTHTFQYIVESLSLNEGELFNMYREIPSITNKASWALRYTKNLNSTSFSTGTDD 200

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            DQ+FL+DL  FYVVFEGMWFYTGFAQILSLGR NKMVGIAEQYQYIMRDES+HLNFGID
Sbjct: 201 RDQDFLRDLIAFYVVFEGMWFYTGFAQILSLGRYNKMVGIAEQYQYIMRDESVHLNFGID 260

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +INQIKIENPHLWT++FQQ+ R ML EA LLE+AY  +TMPK F+G+NA  CE+YM FI 
Sbjct: 261 MINQIKIENPHLWTEDFQQEVRKMLQEAALLEVAYGKDTMPKPFLGINANLCEKYMYFIT 320

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NRRC QIGL+P+F+ TENPFPWMSEVIDL+KEKNFFETRVTEYQ+G  L WD
Sbjct: 321 NRRCTQIGLDPVFEKTENPFPWMSEVIDLQKEKNFFETRVTEYQKGTSLDWD 372


>gi|152980709|ref|YP_001354668.1| ribonucleotide-diphosphate reductase subunit beta
           [Janthinobacterium sp. Marseille]
 gi|151280786|gb|ABR89196.1| ribonucleoside-diphosphate reductase beta chain [Janthinobacterium
           sp. Marseille]
          Length = 392

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 210/340 (61%), Positives = 269/340 (79%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
             +R++  DKR++N ++DVNQL+P KY WAW+KYL+ C NHWMP E+ MQ D+ LWK+ N
Sbjct: 53  PTRRMDAADKRVINGQTDVNQLVPFKYKWAWDKYLAGCANHWMPQEINMQRDIELWKNPN 112

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
           GLTDDER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +Q
Sbjct: 113 GLTDDERRLVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQ 172

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDEGE+FN Y EV SI  K  + + + +TL+ P F TGT + DQ+ L+ L VF
Sbjct: 173 YIVESLGLDEGEIFNAYNEVESIRDKDQFLIPFIETLTDPEFKTGTTENDQKLLRSLIVF 232

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             + EG++FY GFAQIL+LGR NKM+G AEQYQYI+RDES+H NFGID+IN IK+ENPHL
Sbjct: 233 ACLMEGLFFYVGFAQILALGRQNKMMGAAEQYQYILRDESMHCNFGIDLINTIKLENPHL 292

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT +F+++ +T+   A  LE  YA +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+
Sbjct: 293 WTPQFREEIKTLFLRAVELEYRYAEDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPM 352

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           F+  ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 353 FEQEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALNWE 392


>gi|261855609|ref|YP_003262892.1| ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
 gi|261836078|gb|ACX95845.1| Ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
          Length = 398

 Score =  328 bits (841), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 253/349 (72%), Positives = 287/349 (82%), Gaps = 1/349 (0%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            TGL  I  G  RV+V  KR++NA +DVNQLLP+KY WAWEKYL+ CNNHWMPTEV MQ 
Sbjct: 50  QTGLEGIAQGAGRVDVSAKRIINATADVNQLLPMKYTWAWEKYLAGCNNHWMPTEVSMQA 109

Query: 64  DLALWKSKNG-LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
           D+ALWK ++G LT DER MI RNLGFFA++ESLVANNIVLAIY+ ++NPECRQYLLRQAF
Sbjct: 110 DIALWKGRDGGLTADERAMIMRNLGFFATAESLVANNIVLAIYKQVTNPECRQYLLRQAF 169

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EEAVH+HTFQYI+ SLGL EGELFNMYRE+PSITAK  WAL+YT+ L+   F T T    
Sbjct: 170 EEAVHTHTFQYIVESLGLAEGELFNMYREIPSITAKDEWALKYTKNLADGDFDTSTTKGA 229

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
           Q+FL+DL  FYVVFEGMWFYTGFAQILSLGR NKM GIAEQYQYIMRDES+H+NFGIDVI
Sbjct: 230 QDFLRDLVAFYVVFEGMWFYTGFAQILSLGRRNKMTGIAEQYQYIMRDESIHMNFGIDVI 289

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           NQIKIENPHLWT++F+ +   ML EA  LEIAYA +TMP G +GLNA  C +Y+ FIANR
Sbjct: 290 NQIKIENPHLWTEDFKAEVTRMLKEAAELEIAYARDTMPHGLLGLNAEMCAEYLHFIANR 349

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           RC+QIGL  LF    NPFPWMSEVIDLKKEKNFFETRVT+YQ G  L W
Sbjct: 350 RCNQIGLAELFPGATNPFPWMSEVIDLKKEKNFFETRVTDYQTGGALNW 398


>gi|114332419|ref|YP_748641.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           eutropha C91]
 gi|114309433|gb|ABI60676.1| Ribonucleoside-diphosphate reductase [Nitrosomonas eutropha C91]
          Length = 377

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 215/339 (63%), Positives = 272/339 (80%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +RV+V+DKR++N ++DVNQL+P KY WAWEKYLSAC NHWMP E+ M  D+ALWK  NG
Sbjct: 39  HRRVSVEDKRIINCKADVNQLVPFKYKWAWEKYLSACANHWMPQEINMTRDIALWKDPNG 98

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT+DER ++KRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QY
Sbjct: 99  LTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQY 158

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ S+GLDEGE+FN Y E+ SI  K  + + +  TL++P+F TGT + DQ+ L+ L VF 
Sbjct: 159 IVESIGLDEGEIFNAYHEIKSIRDKDEFLIPFIDTLTNPTFQTGTLETDQQLLKSLIVFA 218

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            + EG++FY GF QILSLGR NKM G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLW
Sbjct: 219 CIMEGLFFYVGFVQILSLGRQNKMTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLW 278

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T+EF+++   ++ +A  LE  YA +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF
Sbjct: 279 TREFREEISALMRKAVELEYRYAEDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLF 338

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
               NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 339 PEAGNPFPWMSEMVDLKKEKNFFETRVIEYQTGGVLSWD 377


>gi|218665361|ref|YP_002427016.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517574|gb|ACK78160.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 380

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 201/338 (59%), Positives = 260/338 (76%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +RV  +DKR++N  +DVNQL+P KY WAW+KYL+AC NHWMP E+ M  D+ALWK   GL
Sbjct: 43  ERVRAEDKRIINGHADVNQLVPFKYQWAWDKYLAACANHWMPQEIQMSRDIALWKDPKGL 102

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T+DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQY+LRQAFEEA+H+H +QYI
Sbjct: 103 TEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYMLRQAFEEAIHTHAYQYI 162

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           + S+GLDEGE+FNMY EVPS+  K  + + +   L+ P F TGT + DQ+ L+ L VF  
Sbjct: 163 VESIGLDEGEIFNMYHEVPSVRDKDQFLMPFIDVLADPHFKTGTLENDQKLLRSLIVFAA 222

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           + EG +FY GF+QIL++GR NKMVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT
Sbjct: 223 IMEGTFFYVGFSQILAMGRQNKMVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWT 282

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           + FQQ+   ++     LE AYA +TMP+G +GLNAP   +Y+++I NRR  Q+GL   + 
Sbjct: 283 EAFQQEIIDLIRRGVELECAYADDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYP 342

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             +NPFPWMSE++DLKKEKNFFETRVTEYQ G  L W+
Sbjct: 343 GVQNPFPWMSEMMDLKKEKNFFETRVTEYQTGGALSWE 380


>gi|171463021|ref|YP_001797134.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192559|gb|ACB43520.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 394

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 205/337 (60%), Positives = 260/337 (77%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           RV   DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP E+ M  D+ALWK  NGLT
Sbjct: 58  RVKAADKRVINAKTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMNRDIALWKDPNGLT 117

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQYLLRQAFEEA+H+H +QYI+
Sbjct: 118 EDERRIIKRNLGFFTTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAYQYIV 177

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLD+ E+FN Y E+ SI AK  + + Y   L++P+F TGT +ADQ  L+ L VF  V
Sbjct: 178 ESLGLDQSEIFNAYHEIDSIRAKDEFLIPYIDVLTNPNFKTGTLEADQTLLRSLIVFACV 237

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL++GR NKM G AEQYQYI+RDES+H NFGID+INQIK+ENP LW  
Sbjct: 238 MEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWIS 297

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+ + +++  +A  LE  YA +TMP+G +GLNAP  +  +++I NRRC QIGL+ +F  
Sbjct: 298 AFKDEIKSIFEKAVELEYRYAEDTMPRGVLGLNAPMFKGCLRYICNRRCLQIGLDAMFPN 357

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 358 EENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWE 394


>gi|284032753|ref|YP_003382684.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
 gi|283812046|gb|ADB33885.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
          Length = 354

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 259/353 (73%), Positives = 287/353 (81%), Gaps = 4/353 (1%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            T   PI  G  RV V DK M+NAR+DVNQLLPLKY WAW+KYL+ACNNHWMPTEV MQ 
Sbjct: 2   TTTTPPIAVGATRVEVADKAMINARADVNQLLPLKYQWAWDKYLAACNNHWMPTEVSMQA 61

Query: 64  DLALWKS----KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
           D+ALW+     K+GLT+DERLM+KRNLGFFA++ESLVANNIVLA+YR LSNPECRQYLLR
Sbjct: 62  DIALWRRPAGAKDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLSNPECRQYLLR 121

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           QAFEEAVH+HTFQYI TSLGLDEGELFNMYREVPSI AK  WAL+YT+ L+   F TGT 
Sbjct: 122 QAFEEAVHTHTFQYICTSLGLDEGELFNMYREVPSIAAKDAWALKYTRHLTDGDFRTGTP 181

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +AD +FL+DL  FYVVFEGMWFYTGFAQIL LGR NKMVGIAEQYQYI+RDESLHLNFGI
Sbjct: 182 EADTDFLRDLIAFYVVFEGMWFYTGFAQILVLGRRNKMVGIAEQYQYILRDESLHLNFGI 241

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           D INQIK+ENPHLWT  FQ + R ML EA  LE+AY   T+P G +GL A  CEQYM FI
Sbjct: 242 DCINQIKLENPHLWTPAFQAEVRRMLTEACELEVAYGRATLPNGMLGLTAELCEQYMHFI 301

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +RR  Q+GL PLF  T NPF WMSEV+DLKKEKNFFETRV EYQ G  L WD
Sbjct: 302 TDRRAEQLGLAPLFGETRNPFGWMSEVMDLKKEKNFFETRVIEYQSGGGLSWD 354


>gi|257055668|ref|YP_003133500.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
 gi|256585540|gb|ACU96673.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
          Length = 349

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 261/343 (76%), Positives = 299/343 (87%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           +  G  RVNVDDK M+NAR+DVNQLLP+KYGWAWEKYL+ C+NHWMPTEV MQ D+ALWK
Sbjct: 7   LDFGAARVNVDDKAMINARADVNQLLPMKYGWAWEKYLAGCDNHWMPTEVSMQADIALWK 66

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
           S +GLTDDERLM+KRNLGFFA++ESLVANN+VLA+YRHL+NPECRQYLLRQAFEEAVH+H
Sbjct: 67  SPDGLTDDERLMLKRNLGFFATAESLVANNLVLAVYRHLTNPECRQYLLRQAFEEAVHTH 126

Query: 130 TFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
           TFQYI  SLGLDEGELFN YREVPSI  K +WAL+YT+ L  P+FTTGT +ADQEFL+DL
Sbjct: 127 TFQYICVSLGLDEGELFNAYREVPSIANKDSWALRYTRNLEDPNFTTGTMEADQEFLRDL 186

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
             FYVVFEGMWFYTGFAQ+LSLGR NKMVGIAEQYQYI+RDES+HLNFG+D INQIK EN
Sbjct: 187 VAFYVVFEGMWFYTGFAQVLSLGRRNKMVGIAEQYQYILRDESIHLNFGVDCINQIKAEN 246

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           PHLWT EFQQ+ R ML EA  LE+AYAH+TMP+  +GL+A  CEQYM FI +RR  Q+GL
Sbjct: 247 PHLWTPEFQQQVRDMLVEACELEVAYAHDTMPRPMLGLSAELCEQYMHFITDRRAAQLGL 306

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +P+F   ENPFPWMSEVIDL+KEKNFFETRVT+Y+ GA L WD
Sbjct: 307 DPVFGERENPFPWMSEVIDLRKEKNFFETRVTDYRSGAALAWD 349


>gi|302877617|ref|YP_003846181.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
 gi|302580406|gb|ADL54417.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
          Length = 365

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 215/337 (63%), Positives = 271/337 (80%), Gaps = 1/337 (0%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R+ V+DKR++N ++DVNQL+P KY WAWEKYL+AC NHWMP EV M  D+ALWKS + L+
Sbjct: 30  RIRVEDKRIINCKADVNQLVPFKYKWAWEKYLAACANHWMPQEVNMTADIALWKS-DKLS 88

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           DDER +IKRNLGFF +++SL ANNIVL  YRH++NPECRQ+LLRQAFEEA+H+H +QYI+
Sbjct: 89  DDERRLIKRNLGFFTTADSLAANNIVLGSYRHITNPECRQFLLRQAFEEAIHTHAYQYIV 148

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGLDEGE+FNMY EVPSI  K  + L Y   L++P F TGT +ADQ  L+ L VF  +
Sbjct: 149 ESLGLDEGEIFNMYHEVPSIRNKDEFLLPYIDVLTNPEFKTGTPEADQALLRSLIVFACI 208

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+HLNFG+D+INQIK+ENPHLWT 
Sbjct: 209 MEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHLNFGVDLINQIKMENPHLWTA 268

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
            F+++ R ++ +   LE AYA +TMP+G +GLNA   ++Y++FIANRRC QIG++ L++ 
Sbjct: 269 AFREEIRGLMQKGVELEYAYAEDTMPRGILGLNATMFKEYLRFIANRRCQQIGVDILYQG 328

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             NPFPWMSE+IDLKKEKNFFE+RVTEYQ G  L WD
Sbjct: 329 ATNPFPWMSEMIDLKKEKNFFESRVTEYQTGGTLSWD 365


>gi|264680215|ref|YP_003280125.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
 gi|262210731|gb|ACY34829.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
          Length = 336

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 206/336 (61%), Positives = 259/336 (77%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +N  DKR++NA++DVNQL+P KY WAWEKYL+ C NHWMP EV M  D+ALWK  NGLT+
Sbjct: 1   MNAADKRIINAKTDVNQLVPFKYKWAWEKYLATCANHWMPQEVNMTRDIALWKDPNGLTE 60

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DER ++KRNLGFF +++SL ANNIVL  YRH++ PECRQ+LLRQAFEEA+H+H +QYI+ 
Sbjct: 61  DERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQFLLRQAFEEAIHTHAYQYIVE 120

Query: 137 SLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
           SLGLDE E+FN Y EV SI  K  + + + + +  P+F TGT + DQ  L+ L VF  + 
Sbjct: 121 SLGLDESEIFNAYNEVQSIRDKDEFLIPFIEAIMDPNFHTGTPETDQTLLKSLIVFACLM 180

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++FY GF QIL+LGR NKM G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT E
Sbjct: 181 EGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAE 240

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
           F+Q+   +  +A  LE  YA +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   
Sbjct: 241 FKQEITELFQKAVELEYRYAEDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFPGE 300

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L WD
Sbjct: 301 ENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD 336


>gi|294339031|emb|CAZ87378.1| putative Ribonucleoside-diphosphate reductase (ribonucleoside
           diphosphate reductase, beta subunit) [Thiomonas sp. 3As]
          Length = 410

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 207/343 (60%), Positives = 263/343 (76%), Gaps = 4/343 (1%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
             RV  +DKR++N   DVNQL+P KY WAW+KYL++C NHWMP EV M  D+A+WK  NG
Sbjct: 68  TARVRAEDKRIINCSVDVNQLVPFKYKWAWDKYLASCANHWMPQEVNMSRDIAMWKDPNG 127

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTDDERL+IKRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QY
Sbjct: 128 LTDDERLIIKRNLGFFTTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQY 187

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT----GTKDADQEFLQDL 189
           I+ S+GLDE E+FN Y E+ SI  K  + + +  TL++P F T    G++  DQE L+ +
Sbjct: 188 IVESIGLDESEIFNSYHEITSIREKDEFLIPFIDTLTNPEFRTSAFGGSERNDQELLRSI 247

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            VF  + EG++FY GF QILS+GR NKM G AEQYQYI+RDES+H NFGID++NQIK+EN
Sbjct: 248 IVFACLMEGLFFYVGFTQILSMGRQNKMTGAAEQYQYILRDESMHTNFGIDLVNQIKLEN 307

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           PHLWT EF+++   + H+A  LE  YA +TMP+G +GLNA   + Y++FIANRR  QIGL
Sbjct: 308 PHLWTPEFKRELTGLFHQAVELEYRYAEDTMPRGVLGLNASMFKGYLRFIANRRAVQIGL 367

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           + +F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 368 DAIFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWE 410


>gi|296135014|ref|YP_003642256.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
 gi|295795136|gb|ADG29926.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
          Length = 402

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 206/343 (60%), Positives = 263/343 (76%), Gaps = 4/343 (1%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
             RV  +DKR++N   DVNQL+P KY WAW+KYL++C NHWMP E+ M  D+A+WK  NG
Sbjct: 60  TARVRAEDKRIINCSVDVNQLVPFKYKWAWDKYLASCANHWMPQEINMSRDIAMWKDPNG 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTDDERL+IKRNLGFF +++SL ANNIVL  YRH++NPECRQYLLRQAFEEA+H+H +QY
Sbjct: 120 LTDDERLIIKRNLGFFTTADSLAANNIVLGTYRHITNPECRQYLLRQAFEEAIHTHAYQY 179

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT----GTKDADQEFLQDL 189
           I+ S+GLDE E+FN Y E+ SI  K  + + +  TL++P F T    G++  DQE L+ +
Sbjct: 180 IVESIGLDESEIFNSYHEIASIRDKDEFLIPFIDTLTNPEFRTSAFGGSERNDQELLRSI 239

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            VF  + EG++FY GF QILS+GR NKM G AEQYQYI+RDES+H NFGID++NQIK+EN
Sbjct: 240 IVFACLMEGLFFYVGFTQILSMGRQNKMTGAAEQYQYILRDESMHTNFGIDLVNQIKLEN 299

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           PHLWT EF+++   + H+A  LE  YA +TMP+G +GLNA   + Y++FIANRR  QIGL
Sbjct: 300 PHLWTPEFKRELTGLFHQAVELEYRYAEDTMPRGVLGLNASMFKGYLRFIANRRAVQIGL 359

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           + +F   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L W+
Sbjct: 360 DAIFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGALSWE 402


>gi|268316001|ref|YP_003289720.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
 gi|262333535|gb|ACY47332.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
          Length = 347

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 207/341 (60%), Positives = 271/341 (79%), Gaps = 3/341 (0%)

Query: 13  GEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           G +R+ V+DKR++N    DVNQL+P+KY WAWE YL+ C NHWMP+E+PM  D+ LW+S 
Sbjct: 8   GSRRIRVEDKRLINCHEVDVNQLMPIKYAWAWEHYLNGCKNHWMPSEIPMARDIELWRS- 66

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           + LTDDERL+I RNLGFFA++ESLV NNIVLAI+RH++NPECRQYLLRQAFEEA+H+H F
Sbjct: 67  DKLTDDERLVILRNLGFFATAESLVGNNIVLAIFRHVTNPECRQYLLRQAFEEAIHTHAF 126

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
            YI+ SLGLDEGE+FNMYRE+P++  K  + ++ T+ +  P FTT T +  Q FL++L  
Sbjct: 127 LYIVESLGLDEGEVFNMYREIPAVARKDEFEMELTREVLRPDFTTATVEGAQAFLKNLIG 186

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           +YV+ EG++FY+GFA ILS  R NKM GI EQ+QYI+RDE++HLNFGID+IN IK ENP 
Sbjct: 187 YYVIMEGIFFYSGFAMILSFHRQNKMTGIGEQFQYILRDETIHLNFGIDLINGIKAENPE 246

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EFQ++ + ++ EA  LE+AYA++ +P+G +GL AP   +Y+Q+IA+RR  +IGL+ 
Sbjct: 247 LWTPEFQREVQQLIEEAVELEVAYAYDCLPRGVLGLTAPMFREYVQYIADRRLERIGLKA 306

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +  ++NPFPWMSE IDL KEKNFFETRVTEYQQ A L WD
Sbjct: 307 RYG-SKNPFPWMSETIDLLKEKNFFETRVTEYQQAAALSWD 346


>gi|325110864|ref|YP_004271932.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
 gi|324971132|gb|ADY61910.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
          Length = 353

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 198/344 (57%), Positives = 256/344 (74%), Gaps = 3/344 (0%)

Query: 10  IQAGEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           + A   R    +KR++N  + DVNQL+P+KY WAWE YL+ C NHWMPTEVPM  D+ +W
Sbjct: 12  LDAPTGRFKASEKRLINCAQVDVNQLMPIKYAWAWEHYLNGCANHWMPTEVPMTKDIEVW 71

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L+DDERL+I RNLGFF+++ESLV NN+VLAI++H++N ECRQYLLRQAFEEAVH+
Sbjct: 72  KS-NKLSDDERLVIMRNLGFFSTAESLVGNNLVLAIFKHVTNAECRQYLLRQAFEEAVHT 130

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF Y++ SLGL EGE+FNMY EVP+I  K  + ++ T  + S  FTT T +  Q FL++
Sbjct: 131 HTFLYVVDSLGLHEGEVFNMYHEVPAIARKDEFEMKLTAEVLSEDFTTETYEGRQTFLRN 190

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FYTGF  ILS  R N + GI EQ+QYI+RDE+ HLNFGID+IN IK E
Sbjct: 191 LIGYYLIMEGIFFYTGFVMILSFHRRNLLTGIGEQFQYILRDETTHLNFGIDLINGIKHE 250

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT++FQQ+   ++ EA  LEI YA + +P+G +GLN      Y+Q IA+RR  +IG
Sbjct: 251 NPDIWTEKFQQEIIDLVKEAVELEIDYARDCLPRGVLGLNGNLFRDYVQHIADRRLERIG 310

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L  L+  + NPFPWMSE +DL KEKNFFETRVTEYQ G  L WD
Sbjct: 311 LPTLYN-SSNPFPWMSETMDLAKEKNFFETRVTEYQTGGTLSWD 353


>gi|283779060|ref|YP_003369815.1| ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
 gi|283437513|gb|ADB15955.1| Ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
          Length = 357

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 193/335 (57%), Positives = 257/335 (76%), Gaps = 3/335 (0%)

Query: 19  VDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
            ++KR++N  + DVNQL+P+KY WAWE Y + C NHWMP+EVPM  D+  W++ + LTDD
Sbjct: 25  AEEKRLINCSTVDVNQLMPIKYHWAWEHYQNGCANHWMPSEVPMGKDIETWRTGS-LTDD 83

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+L+I RNLGFF+++ESLV NN+VLAI+RH++NPECRQYLLRQAFEEA+H+HTF YI+ S
Sbjct: 84  EKLVILRNLGFFSTAESLVGNNLVLAIFRHVTNPECRQYLLRQAFEEAIHTHTFLYIVES 143

Query: 138 LGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           LGLD+ E+FNMYRE+PSI  K  + +Q T  L  P+FTT T +  Q+FL++L  +Y++ E
Sbjct: 144 LGLDDREVFNMYREIPSIARKDAFEMQLTTGLLDPNFTTETAEGAQKFLENLIGYYLIME 203

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++FYTGF  ILS  R N+M GI EQ+QYI+RDE++HLNFGID+IN ++ ENP +WT +F
Sbjct: 204 GIFFYTGFVMILSFHRQNRMTGIGEQFQYILRDETIHLNFGIDLINGVRAENPGIWTADF 263

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           Q++   ++ EA  LE+AYA + +P+G VGLN      Y+Q IA+RR  +IGL   +  + 
Sbjct: 264 QERVIKLVREAVELEVAYAWDCLPRGIVGLNGELFRDYVQHIADRRLERIGLPTQYG-SA 322

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NPFPWMSE +DL KEKNFFETRVTEYQ  A L WD
Sbjct: 323 NPFPWMSETMDLGKEKNFFETRVTEYQSAASLAWD 357


>gi|166154172|ref|YP_001654290.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 434/Bu]
 gi|166155047|ref|YP_001653302.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
 gi|301335416|ref|ZP_07223660.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2tet1]
 gi|165930160|emb|CAP03644.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis 434/Bu]
 gi|165931035|emb|CAP06598.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
          Length = 346

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 194/343 (56%), Positives = 259/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVTEYQHAASLTW 346


>gi|76789573|ref|YP_328659.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis A/HAR-13]
 gi|237803260|ref|YP_002888454.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/Jali20/OT]
 gi|237805181|ref|YP_002889335.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|255349232|ref|ZP_05381239.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70]
 gi|255503769|ref|ZP_05382159.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70s]
 gi|255507450|ref|ZP_05383089.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D(s)2923]
 gi|76168103|gb|AAX51111.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis A/HAR-13]
 gi|231273481|emb|CAX10397.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|231274494|emb|CAX11290.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/Jali20/OT]
 gi|289525874|emb|CBJ15356.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis Sweden2]
 gi|296435459|gb|ADH17637.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/150]
 gi|296439176|gb|ADH21329.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/11023]
          Length = 346

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 193/343 (56%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPGIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|329943118|ref|ZP_08291892.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|332287701|ref|YP_004422602.1| ribonucleotide reductase subunit beta [Chlamydophila psittaci 6BC]
 gi|325507260|gb|ADZ18898.1| ribonucleotide reductase subunit beta [Chlamydophila psittaci 6BC]
 gi|328814665|gb|EGF84655.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|328914953|gb|AEB55786.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           psittaci 6BC]
          Length = 346

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 189/343 (55%), Positives = 255/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 6   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 125 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 245 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 346


>gi|15605563|ref|NP_220349.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D/UW-3/CX]
 gi|255311668|ref|ZP_05354238.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276]
 gi|255317969|ref|ZP_05359215.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276s]
 gi|14195107|sp|O84835|RIR2_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|51247460|pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide
           Reductase From Chlamydia Trachomatis
 gi|3329298|gb|AAC68425.1| Ribonucleoside Reductase, Small Chain [Chlamydia trachomatis
           D/UW-3/CX]
 gi|296436383|gb|ADH18557.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9768]
 gi|296437314|gb|ADH19484.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11222]
 gi|296438242|gb|ADH20403.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11074]
 gi|297140743|gb|ADH97501.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9301]
 gi|297748957|gb|ADI51503.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-EC]
 gi|297749837|gb|ADI52515.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-LC]
          Length = 346

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 193/343 (56%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|112489977|pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide
           Reductase R2 From Chlamydia Trachomatis
          Length = 346

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 192/343 (55%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+PM  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEIPMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DRLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HT+ YI  SLGLDE E+FN Y E  +I AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTYLYICESLGLDEKEIFNAYNERAAIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM+GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   ++  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTPELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW 346


>gi|62185356|ref|YP_220141.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           abortus S26/3]
 gi|62148423|emb|CAH64191.1| putative ibonucleoside reductase small subunit [Chlamydophila
           abortus S26/3]
          Length = 349

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 188/343 (54%), Positives = 254/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N    DVNQL+P+KY WAWE Y++ C N W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYVNGCANTWLPTEVPMARDIELW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 128 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 248 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 308 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 349


>gi|313848275|emb|CBY17276.1| putative ibonucleoside reductase small subunit [Chlamydophila
           psittaci RD1]
          Length = 349

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 189/343 (55%), Positives = 255/343 (74%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NNLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T  +  P+F+T + +   +F+++
Sbjct: 128 HTFLYICESLGLDEAEVFNAYNERATIRAKDDFQMTLTGDVLDPNFSTNSLEGLSQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q +   ++ +A  LEI YA + +P+G +GL A     Y++ IA+RR  +IG
Sbjct: 248 NPEVWTPELQSEIIALIEKAVDLEIEYARDCLPRGILGLKASMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +++NPFPWMSE IDL KEKNFFETRV EYQ  A L W
Sbjct: 308 LKPIY-HSKNPFPWMSETIDLNKEKNFFETRVIEYQTAANLSW 349


>gi|29840533|ref|NP_829639.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           caviae GPIC]
 gi|29834882|gb|AAP05517.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           caviae GPIC]
          Length = 346

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 188/341 (55%), Positives = 257/341 (75%), Gaps = 3/341 (0%)

Query: 12  AGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
              KRV ++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LWKS
Sbjct: 8   GKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELWKS 67

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+HT
Sbjct: 68  ND-LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTHT 126

Query: 131 FQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           F YI  SLGLDEGE+FN Y E  +I AK ++ +  T  + +P+F+T + +  ++F+++L 
Sbjct: 127 FLYICESLGLDEGEVFNAYNERATIKAKDDFQMTLTVDVLNPNFSTDSVEGLRQFIKNLV 186

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
            +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP
Sbjct: 187 GYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENP 246

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
            +W++E Q +   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IGL+
Sbjct: 247 EVWSQELQDEIIALIQKAVDLEIEYAKDCLPRGILGLKSSMFIDYVRHIADRRLERIGLK 306

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           P++ Y++NPFPWMSE IDL KEKNFFETRVTEYQ    L W
Sbjct: 307 PIY-YSKNPFPWMSETIDLNKEKNFFETRVTEYQTSGNLSW 346


>gi|15834835|ref|NP_296594.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270285001|ref|ZP_06194395.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270289024|ref|ZP_06195326.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Weiss]
 gi|301336399|ref|ZP_07224601.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum MopnTet14]
 gi|14195147|sp|Q9PL92|RIR2_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|7190253|gb|AAF39087.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydia
           muridarum Nigg]
          Length = 346

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 196/343 (57%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +   +KRVN++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+ M  D+ LW
Sbjct: 6   LDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEISMGKDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-NVLSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHVTNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  SI AK ++ ++ T  +  P+F T + +  QEF+++
Sbjct: 125 HTFLYICESLGLDEKEIFNAYNERASIKAKDDFQMEITGKVLDPNFRTDSVEGLQEFIKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKMVGI EQYQYI+RDE++HLNFG+D+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMVGIGEQYQYILRDETIHLNFGVDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E QQ+   M+  A  LEI YA + +P+G +GL A     Y+Q IA+RR  +IG
Sbjct: 245 NPEIWTTELQQEIIEMIQRAVDLEIDYARDCLPRGILGLRASMFIDYVQHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ +T+NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 305 LKPIY-HTKNPFPWMSETIDLNKEKNFFETRVTEYQHAASLTW 346


>gi|89898045|ref|YP_515155.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           felis Fe/C-56]
 gi|89331417|dbj|BAE81010.1| ribonucleoside-diphosphate reductase beta chain [Chlamydophila
           felis Fe/C-56]
          Length = 349

 Score =  299 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 188/343 (54%), Positives = 258/343 (75%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           ++   KRV ++ KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 9   LEGKSKRVQLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIDLW 68

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS N L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 69  KS-NELSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEVRQYLLRQAFEEAVHT 127

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDE E+FN Y E  +I AK ++ +  T+ +  P+F+T T +  ++F+++
Sbjct: 128 HTFLYICESLGLDESEVFNAYNERATIKAKDDFQMDLTRDVLDPNFSTHTIENLRQFIKN 187

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 188 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 247

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +W+++ Q +   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IG
Sbjct: 248 NPEVWSQQLQDEIVDLIQKAVDLEIEYARDCLPRGILGLRSSMFIDYVRHIADRRLERIG 307

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++  ++NPFPWMSE IDL KEKNFFETRVTEYQ  A L W
Sbjct: 308 LKPIYN-SKNPFPWMSETIDLNKEKNFFETRVTEYQTAANLNW 349


>gi|33242353|ref|NP_877294.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae TW-183]
 gi|33236864|gb|AAP98951.1| ribonucleoside reductase small chain [Chlamydophila pneumoniae
           TW-183]
          Length = 365

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 187/343 (54%), Positives = 252/343 (73%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +    KRV V  K ++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 25  LDGKLKRVEVSKKGLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 84

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 85  KS-DELSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 143

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDEGE+FN Y E  SI AK ++ +  T  +  P+F+  + +   +F+++
Sbjct: 144 HTFLYICESLGLDEGEVFNAYNERASIRAKDDFQMTLTVDVLDPNFSVQSSEGLGQFIKN 203

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 204 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 263

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q++   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IG
Sbjct: 264 NPEVWTTELQEEIVALIEKAVELEIEYAKDCLPRGILGLRSSMFIDYVRHIADRRLERIG 323

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ ++ NPFPWMSE +DL KEKNFFETRVTEYQ    L W
Sbjct: 324 LKPIY-HSRNPFPWMSETMDLNKEKNFFETRVTEYQTAGNLSW 365


>gi|269839640|ref|YP_003324332.1| ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791370|gb|ACZ43510.1| Ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 353

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 198/344 (57%), Positives = 254/344 (73%), Gaps = 3/344 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +    +R+ V+DKR++N ++ DVNQL PLKY WAWE YL+ C NHWMPTEVPM  D+ LW
Sbjct: 12  MYDLSQRIRVEDKRLINCKAVDVNQLWPLKYAWAWEHYLNGCANHWMPTEVPMHKDIELW 71

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           +S N LT DERL+I RNLGFF++ ESLV NNIVLAI++H++NPE RQYLLRQAFEEA+H+
Sbjct: 72  RS-NALTPDERLVIMRNLGFFSTGESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAIHT 130

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           H F YI+ SLGLD  E+FNMYREV SI  K  + +  T+ +  P FTT T +  Q+F+++
Sbjct: 131 HAFHYIVESLGLDGREVFNMYREVDSIKGKDEFVMSLTERVLDPDFTTETLEGIQDFIRN 190

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  FYV+ EG++FY+GF  ILS  R N+M GI EQ+QYI+RDE++HLNFGID+IN IK E
Sbjct: 191 LVGFYVIMEGIFFYSGFVMILSFHRQNRMTGIGEQFQYILRDETVHLNFGIDLINTIKEE 250

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP  WT+E ++    M+ +A   EIAYA E +P G +GLNA    +Y+Q+IA+RR  +I 
Sbjct: 251 NPEAWTEELRRDLVGMIRQAVEYEIAYARECLPNGVLGLNADLFREYVQYIADRRLERIE 310

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           L   +  + NPFPWMSE +DL KEKNFFETRVTEYQ    L WD
Sbjct: 311 LPVQY-RSRNPFPWMSETMDLPKEKNFFETRVTEYQNAGTLVWD 353


>gi|330443801|ref|YP_004376787.1| ribonucleoside-diphosphate reductase subunit beta [Chlamydophila
           pecorum E58]
 gi|328806911|gb|AEB41084.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pecorum E58]
          Length = 346

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 187/338 (55%), Positives = 255/338 (75%), Gaps = 3/338 (0%)

Query: 15  KRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           KRV++++KR++N    DVNQL+P+KY WAWE YL+ C N+W+PTE+ M  D+ LWKS NG
Sbjct: 11  KRVHINNKRLVNCSQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEISMARDIELWKS-NG 69

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+ TF Y
Sbjct: 70  LSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHTQTFLY 129

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I  SL LDE E+FN Y E  SI AK ++ +  T  +  P+F+T + +  ++F+++L  +Y
Sbjct: 130 ICESLSLDEAEVFNAYNERESIKAKDDFQMTLTVDVLDPNFSTDSIEGLRKFIKNLVGYY 189

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           ++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK ENP +W
Sbjct: 190 LIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVW 249

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           +KE Q++   ++  A  LEI YA + +PKG +GL +     Y++ IA+RR  +IGL+P++
Sbjct: 250 SKELQEEIIALIETAVGLEIDYAKDCLPKGILGLKSSMFIDYVRHIADRRLERIGLKPIY 309

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             ++NPFPWMSE +DL KEKNFFETRVTEYQ  A L W
Sbjct: 310 N-SKNPFPWMSETMDLNKEKNFFETRVTEYQTAASLSW 346


>gi|149173739|ref|ZP_01852368.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
 gi|148847269|gb|EDL61603.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
          Length = 359

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 198/356 (55%), Positives = 248/356 (69%), Gaps = 7/356 (1%)

Query: 2   ANNTGLSPIQ----AGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMP 56
           AN    +P+         R   D KR++N    DVNQL+PLKY WAWE YL+ C NHWMP
Sbjct: 6   ANTNSKTPVSPVGDTPTGRFKADKKRLINCSQVDVNQLMPLKYHWAWEHYLNGCANHWMP 65

Query: 57  TEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQY 116
           TEV M  D+  W+S + L++ ER +I RNLGFFA++ESLVANNIVLAI++H++N ECRQY
Sbjct: 66  TEVGMTKDIETWRS-SKLSEGERFVIMRNLGFFATAESLVANNIVLAIFKHVTNAECRQY 124

Query: 117 LLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT 176
           LLRQAFEEAVHSHTF YI+ SLGL+E E+FNMY EVP+I  K    ++ T  +    FTT
Sbjct: 125 LLRQAFEEAVHSHTFLYIVESLGLNESEVFNMYHEVPAIAKKDQLEMELTSEILDHDFTT 184

Query: 177 GTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLN 236
            T +  Q FL++L  +Y++ EG++FYTGF  +LS  R N M GI EQ+QYI+RDE++HLN
Sbjct: 185 DTFEGAQAFLKNLIGYYLIMEGLFFYTGFVMVLSFHRRNMMTGIGEQFQYILRDETIHLN 244

Query: 237 FGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           FGID+IN IK ENP LWT EFQQ     +  A  LEI YA + +P G +GLN     +Y+
Sbjct: 245 FGIDLINGIKQENPDLWTPEFQQLIIDRMKYAAELEIEYAKDCLPTGILGLNGELFREYV 304

Query: 297 QFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           Q IA+RR  +IGL   +  + NPFPWMSE +DL KEKNFFETRVTEYQ    L WD
Sbjct: 305 QHIADRRLERIGLPAQYG-SANPFPWMSETMDLSKEKNFFETRVTEYQSSGSLNWD 359


>gi|15618893|ref|NP_225179.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae CWL029]
 gi|15836516|ref|NP_301040.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae J138]
 gi|16752043|ref|NP_445409.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae AR39]
 gi|14195165|sp|Q9Z6S4|RIR2_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|4377313|gb|AAD19122.1| Ribonucleoside Reductase, Small Chain [Chlamydophila pneumoniae
           CWL029]
 gi|7189783|gb|AAF38660.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae AR39]
 gi|8979358|dbj|BAA99192.1| ribonucleoside reductase, small chain [Chlamydophila pneumoniae
           J138]
 gi|269302786|gb|ACZ32886.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae LPCoLN]
          Length = 346

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 187/343 (54%), Positives = 252/343 (73%), Gaps = 3/343 (0%)

Query: 10  IQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           +    KRV V  K ++N    DVNQL+P+KY WAWE YL+ C N+W+PTEVPM  D+ LW
Sbjct: 6   LDGKLKRVEVSKKGLVNCNQVDVNQLVPIKYKWAWEHYLNGCANNWLPTEVPMARDIELW 65

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           KS + L++DER +I  NLGFF+++ESLV NNIVLAI++H++NPE RQYLLRQAFEEAVH+
Sbjct: 66  KS-DELSEDERRVILLNLGFFSTAESLVGNNIVLAIFKHITNPEARQYLLRQAFEEAVHT 124

Query: 129 HTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
           HTF YI  SLGLDEGE+FN Y E  SI AK ++ +  T  +  P+F+  + +   +F+++
Sbjct: 125 HTFLYICESLGLDEGEVFNAYNERASIRAKDDFQMTLTVDVLDPNFSVQSSEGLGQFIKN 184

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  +Y++ EG++FY+GF  ILS  R NKM GI EQYQYI+RDE++HLNFGID+IN IK E
Sbjct: 185 LVGYYIIMEGIFFYSGFVMILSFHRQNKMTGIGEQYQYILRDETIHLNFGIDLINGIKEE 244

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
           NP +WT E Q++   ++ +A  LEI YA + +P+G +GL +     Y++ IA+RR  +IG
Sbjct: 245 NPEVWTTELQEEIVALIEKAVELEIEYAKDCLPRGILGLRSSMFIDYVRHIADRRLERIG 304

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           L+P++ ++ NPFPWMSE +DL KEKNFFETRVTEYQ    L W
Sbjct: 305 LKPIY-HSRNPFPWMSETMDLNKEKNFFETRVTEYQTAGNLSW 346


>gi|298243909|ref|ZP_06967716.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
 gi|297556963|gb|EFH90827.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
          Length = 361

 Score =  292 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 194/341 (56%), Positives = 251/341 (73%), Gaps = 3/341 (0%)

Query: 13  GEKRVNVDDKRMLNA-RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
                    KR++N    DVNQL+PLKY WAWE YL+ C NHWMPTEVPM  D+  W+S 
Sbjct: 23  PASEQQAQKKRLINGWHVDVNQLMPLKYRWAWEHYLNGCANHWMPTEVPMTKDIETWRS- 81

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N LT  ERL+I RNLGFFA++ESLV NN+VLAI++H++N ECRQYLLRQAFEEA+H+HTF
Sbjct: 82  NKLTAGERLVIMRNLGFFATAESLVGNNLVLAIFKHITNAECRQYLLRQAFEEAIHTHTF 141

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
            YI+ SLGL E E+FNMY E+PSI  K  + +Q T  +  P F+T T +  Q+FLQ+L  
Sbjct: 142 LYIVESLGLSEHEVFNMYHEIPSIKEKDEFEMQLTSAVLDPDFSTETFEGMQKFLQNLIG 201

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           +Y++ EG++FY+GF  +LS  R N M G+ EQ+QYI+RDE++HLNFGID+IN IK ENP 
Sbjct: 202 YYIIMEGIFFYSGFVMMLSFHRRNLMTGVGEQFQYILRDETIHLNFGIDLINGIKAENPE 261

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
           LWT EFQ     ++  A  LEIAYA++ +P G +GLNA S   Y+Q +A+RR  +IGL P
Sbjct: 262 LWTTEFQAHIYDLIKRAVELEIAYAYDCLPNGILGLNAESFRSYVQHVADRRLERIGLAP 321

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +F ++ +PFPWMSE +DL KEKNFFETRVTEYQ  + L+W+
Sbjct: 322 IF-HSSHPFPWMSETMDLSKEKNFFETRVTEYQAASTLEWE 361


>gi|159465291|ref|XP_001690856.1| ribonucleoside-diphosphate reductase small subunit [Chlamydomonas
           reinhardtii]
 gi|158279542|gb|EDP05302.1| ribonucleoside-diphosphate reductase small subunit [Chlamydomonas
           reinhardtii]
          Length = 493

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 95/345 (27%), Positives = 151/345 (43%), Gaps = 29/345 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
            P      R  + D+ +L    +   L P+KY   WE Y     + W   EV    DL  
Sbjct: 153 EPSAEVASRSTLLDEDLLRENPNRFTLFPIKYPDLWEFYKQGVASFWTVEEVDFTGDLID 212

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W     L  +E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E VH
Sbjct: 213 WH---RLKPEEQRFIKYVLAFFAASDGIVMENLAARFMSDIQVPEARAFYGFQIAMENVH 269

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  ++     +  E   LF+    +P++  KA WA+++  +                
Sbjct: 270 SEMYSVLLDHYVREPEERNQLFDAIHTIPTVAKKAEWAMRWISS-------------SNV 316

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F + L   +   EG+ F   F  I  L +   M G++     I RDE LH +F   + + 
Sbjct: 317 FAERLVG-FACVEGIHFSGSFCSIFWLKKRCLMPGLSFSNVLISRDEGLHCDFACCLYSH 375

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +K           +++   ++ EA  LE  +  E +    +G+NA    QY++F+A+R  
Sbjct: 376 LKNRLS-------RERVLQIVDEAVQLEDEFCTEALSCELLGMNADLMRQYIRFVADRLL 428

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             +G E  +  T NPF WM E+I L+ + NFFE RV EYQ+   +
Sbjct: 429 VSLGYEKHYN-TRNPFDWM-EMISLQGKANFFERRVGEYQRAGVM 471


>gi|159899093|ref|YP_001545340.1| ribonucleotide-diphosphate reductase subunit beta [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892132|gb|ABX05212.1| Ribonucleoside-diphosphate reductase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 342

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 192/339 (56%), Positives = 253/339 (74%), Gaps = 3/339 (0%)

Query: 15  KRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            R N  DKR++N    DVNQL+PL+YGWAWE YL+ C NHWMP EV M  D+A+W+S + 
Sbjct: 6   GRFNASDKRLINCNQVDVNQLMPLRYGWAWEHYLNGCANHWMPNEVSMTGDIAIWRSTS- 64

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L+ DERLM+ RNLGFFA++ESLV NNIVLAI+RH++N ECRQYLLRQAFEEA+H+H F +
Sbjct: 65  LSADERLMVLRNLGFFATAESLVGNNIVLAIFRHITNAECRQYLLRQAFEEAIHTHAFLH 124

Query: 134 IITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           I+ SLGL+E E+FNMY E+P I+ K  + +Q T  +  P F+T T    Q F+++L  +Y
Sbjct: 125 IVESLGLNEREIFNMYHEIPVISQKDQFEMQLTAAVLDPQFSTETLTGMQTFVKNLIGYY 184

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
           V+ EG++FY+GFA +LSL R N + GI EQ QYI+RDE++HLNFG+D+IN IK ENP +W
Sbjct: 185 VIMEGIFFYSGFAMLLSLHRRNVLTGIGEQIQYILRDETIHLNFGVDLINGIKAENPAIW 244

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
           T EFQ +   ++ ++  LE  YA E +P+G +GL+A     Y+Q+IA+RR  +IGL   +
Sbjct: 245 TNEFQAEIVQLIRQSVELEAQYAAECLPRGVMGLHAAMFRDYVQYIADRRLQRIGLAIQY 304

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
             ++NPFPWMSE IDL KEKNFFETRVTEYQ  A L+WD
Sbjct: 305 G-SQNPFPWMSETIDLTKEKNFFETRVTEYQSAASLEWD 342


>gi|297621807|ref|YP_003709944.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
 gi|297377108|gb|ADI38938.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
          Length = 344

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 193/340 (56%), Positives = 255/340 (75%), Gaps = 5/340 (1%)

Query: 14  EKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
             R   D K+++N    DVNQLLPLKY WAWE YL+ C NHWMP+EVPM  D+  WKS +
Sbjct: 9   TGRFRSDQKKLINCSEVDVNQLLPLKYKWAWEHYLNGCANHWMPSEVPMTKDIETWKS-D 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            +++DERL+IKRNLGFFA++ESLVANN+VLAI++H++N ECRQYLLRQAFEEA+HSH F 
Sbjct: 68  SISEDERLLIKRNLGFFATAESLVANNLVLAIFKHVTNAECRQYLLRQAFEEALHSHAFL 127

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGL+E E+FNMYRE+ +I+ K  + +Q T+ L      T T    Q+FL++L  +
Sbjct: 128 YIVDSLGLEEQEIFNMYREISTISEKDEFEMQLTKGLIDG--ETKTLAGKQQFLKNLVGY 185

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           Y++ EG++FY+GFA +LSL R N M GI EQ+QYI+RDE++HLNFGID+IN IK ENP +
Sbjct: 186 YIIMEGIFFYSGFAMVLSLHRRNIMPGIGEQFQYILRDETIHLNFGIDLINGIKAENPEI 245

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           W ++   +   ++ +A  LEIAYA E +P G +GLNA    +Y+Q++A+RR  +IGL  +
Sbjct: 246 WNEDLTDEINGLVQQAVELEIAYAKECLPHGVLGLNAGLFVEYVQYVADRRLERIGLSAI 305

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +K + NPFPWMSE +DL KEKNFFETRVTEYQ  A L WD
Sbjct: 306 YK-SSNPFPWMSETMDLTKEKNFFETRVTEYQSAAVLSWD 344


>gi|330921941|ref|XP_003299625.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
 gi|311326599|gb|EFQ92269.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
          Length = 410

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 161/351 (45%), Gaps = 27/351 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A+   + P  A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 52  ADAEEVKPTVAPTIKPEEADEPLLQENPGRFVLFPIKYHDVWQMYKKAEASFWTAEEIDL 111

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W  +  L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 112 SKDLHDWNKR--LNDDERFFISHVLAFFAASDGIVNENLVERFSSEVQIPEARCFYGFQI 169

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS T+  +I +   +  +   LFN    +P I  KA+WAL++             
Sbjct: 170 MMENVHSETYSLLIDTYISEPRQRKYLFNAIDNIPCIRKKADWALRWI------------ 217

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F   L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F 
Sbjct: 218 SDKNSTFANRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFA 276

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         +  ++  R ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 277 CLLFSLLNN-------RPSKESVRAIITEAVEIEQEFLSDALPCALLGMNATLMCQYIEF 329

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G   ++  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 330 VADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 378


>gi|189219089|ref|YP_001939730.1| ribonucleotide-diphosphate reductase subunit beta
           [Methylacidiphilum infernorum V4]
 gi|189185947|gb|ACD83132.1| Ribonucleotide reductase, beta subunit [Methylacidiphilum
           infernorum V4]
          Length = 361

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 194/339 (57%), Positives = 262/339 (77%), Gaps = 3/339 (0%)

Query: 14  EKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           +KR+NV++KR++N ++ DVNQL+PLKY WAWE YL+ C N+W+P+EVPMQ D+ LWKS N
Sbjct: 25  KKRINVEEKRLINCKAVDVNQLMPLKYKWAWEHYLNGCANNWLPSEVPMQRDVELWKS-N 83

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++DERL+I RNLGFFA+ ESLV NNIVLAI++ ++N E RQYLLRQA+EEAVH+H F 
Sbjct: 84  RLSNDERLVIMRNLGFFATGESLVGNNIVLAIFKFVTNAEARQYLLRQAYEEAVHTHAFL 143

Query: 133 YIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
           YI+ SLGLDE E+FNMY EV SI+ K  + +  T+ +    F T + +  Q+F+++L  F
Sbjct: 144 YIVESLGLDEREVFNMYHEVNSISNKDQFEMTLTEDILREGFNTESVENIQKFVKNLVGF 203

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           YV+ EG++FY+GFA ILS  R NKM GI EQ+QYI+RDE++HLNFGID+IN I+ ENP +
Sbjct: 204 YVIMEGIFFYSGFAMILSFHRQNKMTGIGEQFQYILRDETIHLNFGIDLINGIREENPEI 263

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
           WT  FQ++   M+ E+  LE AYA + +P+G +GLN+   + Y+++IA+RR  +IG +  
Sbjct: 264 WTAGFQKEIEEMIDESVRLEYAYARDCLPRGILGLNSALFKDYVEYIADRRLERIGFKAK 323

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           +  ++NPFPWMSEV+DL KEKNFFETRVTEYQ GA L W
Sbjct: 324 YG-SKNPFPWMSEVMDLVKEKNFFETRVTEYQSGAVLNW 361


>gi|225684487|gb|EEH22771.1| ribonucleoside-diphosphate reductase small chain A
           [Paracoccidioides brasiliensis Pb03]
          Length = 413

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 98/356 (27%), Positives = 165/356 (46%), Gaps = 32/356 (8%)

Query: 2   ANNTGLSPIQ-----AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMP 56
           ++ T + P++         +    D+ +L        L PLKY   W+ Y  A  + W  
Sbjct: 54  SDATPVKPVEQEKKIGSTAKDLEADEPLLQENPHRFVLFPLKYHEIWQMYKKAEASFWTA 113

Query: 57  TEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQY 116
            E+ +  DL  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +
Sbjct: 114 EEIDLSKDLHDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQVPEARCF 171

Query: 117 LLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPS 173
              Q   E +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ +      
Sbjct: 172 YGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRWIE------ 225

Query: 174 FTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESL 233
                 D +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE L
Sbjct: 226 ------DKESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGL 278

Query: 234 HLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCE 293
           H +F   + + ++        +   +  + ++ EA  +E  +  + +P   +G+NA    
Sbjct: 279 HTDFACLLFSHLR-------HRPSPEAVQKIITEAVAIEQEFLTDALPCALLGMNAKLMC 331

Query: 294 QYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           QY++F+A+R    +G + ++  + NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 332 QYIEFVADRLLVALGNKKVYN-STNPFDFMD-NISLTGKTNFFEKRVGDYQKAGVM 385


>gi|298713498|emb|CBJ27053.1| Ribonucleoside-diphosphate reductase small chain [Ectocarpus
           siliculosus]
          Length = 504

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 92/328 (28%), Positives = 155/328 (47%), Gaps = 29/328 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +  A      L P+K+   W+ Y  A  + W   EV +  D   W+    LT +E+  
Sbjct: 181 EPICRADPSRFVLFPIKHPELWDMYKKAKASFWTVEEVDLSQDSRDWE---ALTGNEQHF 237

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+V    + +  PE R +   Q   E++H   +  ++ +   D
Sbjct: 238 ISMVLAFFAASDGIVMENLVERFSQEVQLPEARCFYGFQIAMESIHQEMYALLLDTYIKD 297

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   LFN Y ++P +  KA+WA+++  +             D  F + L  F  V EG
Sbjct: 298 KQERDNLFNAYNDIPCVKQKADWAMRWIGS-------------DATFAERLVAFAAV-EG 343

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   +   ++        K  +
Sbjct: 344 VFFSGSFCAIFWLKKRGLMPGLTFSNEMISRDEGLHCDFACQLFASLEN-------KPSR 396

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +    ++ EA  +E ++    +P   +G+NA    QY++F+A+R    +G    +  T+N
Sbjct: 397 ETVMAIVREAVEVEKSFICGALPCSLIGMNAGVMSQYIEFVADRLLGSLGYGKSYG-TQN 455

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQG 346
           PF WM  +I L+ + NFFE RV EYQ+ 
Sbjct: 456 PFDWMD-LISLQGKTNFFEKRVGEYQKA 482


>gi|189199548|ref|XP_001936111.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187983210|gb|EDU48698.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 410

 Score =  285 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 160/351 (45%), Gaps = 27/351 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A++  + P  A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 52  ADDEEVKPTVAPTIKPEEADEPLLQENPGRFVLFPIKYHDVWQMYKKAEASFWTAEEIDL 111

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W  +  L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 112 SKDLHDWNKR--LNDDERFFISHVLAFFAASDGIVNENLVERFSSEVQIPEARCFYGFQI 169

Query: 122 FEEAVHSHTFQYIITSLG---LDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS T+  +I +          LFN    +P I  KA+WAL++             
Sbjct: 170 MMENVHSETYSLLIDTYISDTRQRKYLFNAIENIPCIRKKADWALRWI------------ 217

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F   L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F 
Sbjct: 218 SDKNSTFANRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFA 276

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +     +       ++ R ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 277 CLLFSLLNNRPSN-------EEVRAIITEAVEIEQEFLSDALPCALLGMNATLMCQYIEF 329

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G   ++  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 330 VADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 378


>gi|297668213|ref|XP_002812343.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Pongo abelii]
          Length = 449

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 95/337 (28%), Positives = 160/337 (47%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  
Sbjct: 125 PDVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKP 181

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 182 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 241

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++              D +  + + +  F 
Sbjct: 242 TYIKDPKEREFLFNAIETLPCVKKKADWALRWI------------GDKEATYGERVVAFA 289

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 290 AV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------- 341

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 342 HKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVF 401

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 402 RV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 436


>gi|325181522|emb|CCA15972.1| ribonucleosidediphosphate reductase small chain put [Albugo
           laibachii Nc14]
          Length = 1611

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 89/352 (25%), Positives = 163/352 (46%), Gaps = 28/352 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           ++++  ++P +  E    +  +  L    +   L P++    W+ Y  A  + W   E+ 
Sbjct: 49  LSDSNSITPFKEKEMNGQLLPEPFLRENPNRFVLFPIQQSEIWDMYKKAEASFWTAEEID 108

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  D+  W     ++D+ER  IK  L FFA+S+ +V  N+ +     +  PE R +   Q
Sbjct: 109 LVHDMNDW---LNISDNERHFIKHVLAFFAASDGIVNENLAMNFSSEVQIPEARCFYGFQ 165

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS  +  +I +   D  E   L      +P +T KA WAL++            
Sbjct: 166 IAIENIHSEVYSLLIDTYIKDPTEKQHLLCAIETIPCVTNKAQWALKW------------ 213

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
             D       +  V +   EG++F   F  I  L +   M G+    + I RDE LH +F
Sbjct: 214 -CDPKCASFAERVVAFAAVEGIFFSGSFCSIFWLKKRGLMPGLCFSNELISRDEGLHCDF 272

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              + +++  + P       +     ++ +A ++E  +  +++P   +G+N+    QY++
Sbjct: 273 ACLMYSKLVNKLP-------EASIHAIISDAVVIEQEFVRDSLPVELIGMNSSLMGQYIE 325

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F+A+R  H +G+  L+ +T NPF WM  +I L+ + NFFE RV EY +   +
Sbjct: 326 FVADRLLHALGVSKLY-HTSNPFDWMD-MISLQGKTNFFEKRVGEYAKSGTI 375


>gi|119621373|gb|EAX00968.1| hCG23833, isoform CRA_b [Homo sapiens]
 gi|119621374|gb|EAX00969.1| hCG23833, isoform CRA_b [Homo sapiens]
          Length = 449

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 95/335 (28%), Positives = 159/335 (47%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 127 VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 183

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 184 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 243

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++              D +  + + +  F  V
Sbjct: 244 IKDPKEREFLFNAIETMPCVKKKADWALRWI------------GDKEATYGERVVAFAAV 291

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 292 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 343

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 344 PSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV 403

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 404 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 436


>gi|260064013|ref|NP_001159403.1| ribonucleoside-diphosphate reductase subunit M2 isoform 1 [Homo
           sapiens]
          Length = 449

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 95/335 (28%), Positives = 159/335 (47%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 127 VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 183

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 184 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 243

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++              D +  + + +  F  V
Sbjct: 244 IKDPKEREFLFNAIETMPCVKKKADWALRWI------------GDKEATYGERVVAFAAV 291

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 292 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 343

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 344 PSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV 403

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 404 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 436


>gi|282890382|ref|ZP_06298910.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499764|gb|EFB42055.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 350

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 201/352 (57%), Positives = 256/352 (72%), Gaps = 3/352 (0%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARS-DVNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           M      S +   E       KR+LN +  DVNQL+PLKY WAWE YL+ C+N+WMP+EV
Sbjct: 1   MEEGIMSSCLIPEEAEAAAQQKRILNCKQVDVNQLMPLKYHWAWEHYLNGCHNNWMPSEV 60

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
           PMQ D+ LWKS N L++DERL+I RNLGFF+++ESLV NNIVLAI++HL+N E RQYLLR
Sbjct: 61  PMQKDIELWKS-NRLSNDERLVIMRNLGFFSTAESLVGNNIVLAIFKHLTNAEARQYLLR 119

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
           QAFEEAVH+HTF YI+ SL LD+ E+F+MY  V SI AK  + ++ T+ +    FTT T 
Sbjct: 120 QAFEEAVHTHTFHYIVESLSLDQREVFDMYNAVNSIHAKDAFEMKLTEEVMQEGFTTDTP 179

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           +  Q FL++L  FY++ EG++FY+GF  ILS  R N M GI EQ+QYI+RDES+HLNFGI
Sbjct: 180 EGVQTFLKNLIGFYIIMEGIFFYSGFVMILSFHRKNIMTGIGEQFQYILRDESIHLNFGI 239

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
           D+IN IK ENP +WT EF+ +   M+ EA  LEI YA + +P G +GLNA     Y+ +I
Sbjct: 240 DLINTIKEENPEVWTPEFKDQIIDMVKEAVELEIQYAADCLPNGILGLNAALFRDYVGYI 299

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           A+RR  +IGL+P +  T NPFPWMSEV+DL KEKNFFETRVT+YQ GA L W
Sbjct: 300 ADRRLERIGLKPQYN-TANPFPWMSEVMDLDKEKNFFETRVTQYQSGAALVW 350


>gi|225561749|gb|EEH10029.1| ribonucleotide reductase M2 B [Ajellomyces capsulatus G186AR]
 gi|240275354|gb|EER38868.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H143]
 gi|325091193|gb|EGC44503.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H88]
          Length = 413

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 97/332 (29%), Positives = 157/332 (47%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           D+ +L    +   L PLKY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 78  DEPLLQENPNRFVLFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERY 135

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 136 FISHVLAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIK 195

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA+WA+++ +            D D  F Q L  F  V E
Sbjct: 196 EPKQRTYLFDAIETIPCIRKKADWAIRWIE------------DKDSTFAQRLVAFAAV-E 242

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + ++        +  
Sbjct: 243 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLR-------HRPS 295

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +    ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +G + ++  + 
Sbjct: 296 PEAVEKIITEAVTIEQEFLSDALPVALLGMNAKLMCQYIEFVADRLLVALGNKKVYN-ST 354

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 355 NPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 385


>gi|302665732|ref|XP_003024474.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
 gi|291188529|gb|EFE43863.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
          Length = 529

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 95/343 (27%), Positives = 156/343 (45%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++    +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W 
Sbjct: 186 VKPKTPKELEAEEPLLQENPQRFVLFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN 245

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 246 --NRLNDDERFFISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSE 303

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D D  F 
Sbjct: 304 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKDSTFA 351

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 352 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLN 410

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 411 -------YRPDPSAVEAIITEAVTIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 463

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 464 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 504


>gi|67515571|ref|XP_657671.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|40746089|gb|EAA65245.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|259489743|tpe|CBF90266.1| TPA: Ribonucleotide reductase [Source:UniProtKB/TrEMBL;Acc:Q9HEW8]
           [Aspergillus nidulans FGSC A4]
          Length = 406

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 98/349 (28%), Positives = 164/349 (46%), Gaps = 31/349 (8%)

Query: 8   SPIQAGEKRVNVD----DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            P++  +  ++V     ++ +L        L P+KY   W+ Y  A  + W   E+ +  
Sbjct: 56  KPVEPSKAALDVKAIEANEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSK 115

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DL  W   N L +DER  I R L FFA+S+ +V  N++      +  PE R +   Q   
Sbjct: 116 DLHDWN--NRLNEDERYFISRVLAFFAASDGIVNENLLERFSGEVQIPEARCFYGFQIMI 173

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E +H+ T+  +I +   +  +   LF+    +P I  KA+WA+++ Q            D
Sbjct: 174 ENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIKWIQ------------D 221

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 222 KESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACL 280

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           + + +         +  ++    ++ EA  +E  +  + +P   +G+NA    QY++F+A
Sbjct: 281 LFSHL-------NWRPSKKVVEDIIVEAVAIEKEFLTDALPCALLGMNAKLMCQYIEFVA 333

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +R    +G +  F  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 334 DRLLVALGNKKYFNAT-NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 380


>gi|322693757|gb|EFY85606.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           acridum CQMa 102]
          Length = 411

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 103/341 (30%), Positives = 160/341 (46%), Gaps = 27/341 (7%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   
Sbjct: 68  APGIKAEEADEPLLQENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN-- 125

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+
Sbjct: 126 NRLNDDEKYFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETY 185

Query: 132 QYIITSLGL---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +          LFN    +P I  KA+WA+++ Q            D +  F Q 
Sbjct: 186 SLLIDTYIKENAQRTYLFNAIDTIPCIRKKADWAIRWIQ------------DKESTFAQR 233

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K  
Sbjct: 234 LVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLHSHLKN- 291

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                 +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F+A+R    +G
Sbjct: 292 ------RASKQIIHDIITDAVAIEKEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALG 345

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            E ++K T NPF +M E I L  + NFFE RV +YQ+   L
Sbjct: 346 NEKVYK-TSNPFDFM-ENISLGGKTNFFEKRVGDYQKAGVL 384


>gi|167837963|ref|ZP_02464822.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis MSMB43]
          Length = 303

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 191/303 (63%), Positives = 238/303 (78%)

Query: 50  CNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLS 109
           C NHWMP E+ M  D+ALWK  NGLT+DER ++KRNLGFF +++SL ANNIVL  YRH++
Sbjct: 1   CANHWMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHIT 60

Query: 110 NPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTL 169
            PECRQ+LLRQAFEEA+H+H +QYI+ SLGLDEGE+FN Y EV +I AK  + + +  TL
Sbjct: 61  APECRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVAAIRAKDEFLIPFIHTL 120

Query: 170 SSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMR 229
           + P+FTTGT +ADQ+ L+ L VF  + EG++FY GF QIL+LGR NKM G AEQYQYI+R
Sbjct: 121 TDPAFTTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILR 180

Query: 230 DESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNA 289
           DES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA +TMP+G +GLNA
Sbjct: 181 DESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYAEDTMPRGVLGLNA 240

Query: 290 PSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
              + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFFETRV EYQ G  L
Sbjct: 241 SMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGAL 300

Query: 350 KWD 352
            W+
Sbjct: 301 SWE 303


>gi|261189551|ref|XP_002621186.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239591422|gb|EEQ74003.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239613047|gb|EEQ90034.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis ER-3]
 gi|327356917|gb|EGE85774.1| ribonucleotide reductase M2 B [Ajellomyces dermatitidis ATCC 18188]
          Length = 413

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 98/351 (27%), Positives = 163/351 (46%), Gaps = 35/351 (9%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
              TG+  ++A        ++ +L    +   L PLKY   W+ Y  A  + W   E+ +
Sbjct: 67  KALTGMKALEA--------EEPLLQENPNRFVLFPLKYHEIWQMYKKAEASFWTAEEIDL 118

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 119 SKDLHDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSSEVQVPEARCFYGFQI 176

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ +           
Sbjct: 177 MMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRWIE----------- 225

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 226 -DKESSFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 283

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + ++        +   +    ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 284 CLLFSHLR-------HRPSPEAVERIITEAVTIEQEFLSDALPVALLGMNAKLMCQYIEF 336

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G + ++  + NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 337 VADRLLVALGNKKVYN-STNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 385


>gi|260950985|ref|XP_002619789.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
 gi|238847361|gb|EEQ36825.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
          Length = 419

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 100/337 (29%), Positives = 157/337 (46%), Gaps = 27/337 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +    D+ +L        L P+KY   W+ Y  A  + W   E+ +  D+  WK  N +T
Sbjct: 88  KAQEKDEPLLVENKRRFVLFPIKYNEIWQMYKKAEASFWTAEEIDLSKDINDWK--NRMT 145

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           D+ER  I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I
Sbjct: 146 DNERFFISRVLAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLI 205

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            S   D  E   LFN    +P I  KA WAL++              D +  F + L  F
Sbjct: 206 DSYIKDPKEADFLFNAIENIPCIKKKAEWALRWI------------ADDEALFAERLVAF 253

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +       
Sbjct: 254 AAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLNN----- 307

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             +        ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + +
Sbjct: 308 --RPNPAIVEKIITEAVTIEKEYFTDALPASLLGMNCDLMCQYVEFVADRLLVALGNKKV 365

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +  T NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 366 YNVT-NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 400


>gi|312216546|emb|CBX96496.1| similar to ribonucleoside-diphosphate reductase subunit M2
           [Leptosphaeria maculans]
          Length = 410

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 100/351 (28%), Positives = 159/351 (45%), Gaps = 27/351 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + +   P  A   R     + +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 51  EDASDHKPSTAPTIRPEEAHEPLLQENPQRFVLFPIKYHDVWQMYKKAEASFWTAEEIDL 110

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W  +  L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 111 SKDLHDWNKR--LNDDERFFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQI 168

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS T+  +I +   +  +   LFN    +P I  KA+WAL++             
Sbjct: 169 MMENVHSETYSLLIDTYISEPRQRKYLFNAIDNIPCIRKKADWALRWI------------ 216

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F   L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F 
Sbjct: 217 SDKNSTFANRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFA 275

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +        T+  ++  + ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 276 CLLFSLL-------NTRPSKESVQAIITEAVEIEKEFLSDALPCALLGMNATLMCQYIEF 328

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G    +  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 329 VADRLLLSLGNTKFYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 377


>gi|332247268|ref|XP_003272775.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 1 [Nomascus leucogenys]
          Length = 434

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 95/335 (28%), Positives = 159/335 (47%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 112 VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 168

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 169 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 228

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++              D +  + + +  F  V
Sbjct: 229 IKDPKEREFLFNAIETMPCVKKKADWALRWI------------GDKEATYGERVVAFAAV 276

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 277 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 328

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 329 PSEERVREIIINAVRIEQEFLTEALPVKLIGMNCILMKQYIEFVADRLMLELGFGKVFRV 388

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 389 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 421


>gi|322709430|gb|EFZ01006.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 414

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 103/341 (30%), Positives = 160/341 (46%), Gaps = 27/341 (7%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   
Sbjct: 71  APGIKAEEVDEPLLQENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN-- 128

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+
Sbjct: 129 NRLNDDEKYFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETY 188

Query: 132 QYIITSLGL---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +          LFN    +P I  KA+WA+++ Q            D +  F Q 
Sbjct: 189 SLLIDTYIKENAQRTYLFNAIDTIPCIRKKADWAIRWIQ------------DKESTFAQR 236

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K  
Sbjct: 237 LVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLHSHLKN- 294

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                 +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F+A+R    +G
Sbjct: 295 ------RASKQVIYDIITDAVAIEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALG 348

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            E ++K T NPF +M E I L  + NFFE RV +YQ+   L
Sbjct: 349 NEKVYK-TSNPFDFM-ENISLGGKTNFFEKRVGDYQKAGVL 387


>gi|11878241|gb|AAG40862.1| ribonucleotide reductase [Emericella nidulans]
          Length = 406

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 98/349 (28%), Positives = 164/349 (46%), Gaps = 31/349 (8%)

Query: 8   SPIQAGEKRVNVD----DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            P++  +  ++V     ++ +L        L P+KY   W+ Y  A  + W   E+ +  
Sbjct: 56  KPVEPSKAALDVKAIEANEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSK 115

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DL  W   N L +DER  I R L FFA+S+ +V  N++      +  PE R +   Q   
Sbjct: 116 DLHDWN--NRLNEDERYFISRVLAFFAASDGIVNENLLERFSGEVQIPEARCFYGFQIMI 173

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E +H+ T+  +I +   +  +   LF+    +P I  KA+WA+++ Q            D
Sbjct: 174 ENIHAETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIKWIQ------------D 221

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 222 KESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACL 280

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           + + +         +  ++    ++ EA  +E  +  + +P   +G+NA    QY++F+A
Sbjct: 281 LFSHL-------NWRPSKKVVEDIIVEAVAIEKEFLTDALPCALLGMNAKLMCQYIEFVA 333

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +R    +G +  F  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 334 DRLLVALGNKEYFNAT-NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 380


>gi|126303832|ref|XP_001381111.1| PREDICTED: similar to hCG23833, [Monodelphis domestica]
          Length = 493

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 160/350 (45%), Gaps = 28/350 (8%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
              ++         + +D+ +L        + P++Y   W  Y  A  + W   EV +  
Sbjct: 156 TEPVTKAPNEPASPSKEDEPLLRENPRRFVIFPIEYHDIWHMYKKAEASFWTAEEVDLSK 215

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+  W++   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   
Sbjct: 216 DIQHWET---LKSEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAM 272

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E +HS  +  +I +   D  E   LFN    +P +  KA+WAL++              D
Sbjct: 273 ENIHSEMYSLLIDTYIKDPKEREFLFNAIETLPCVKKKADWALRWI------------GD 320

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            +  + + +  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 321 NEATYGERVVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACL 379

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +   +         K  ++K + ++  A  +E  +  E +P   +G+N    +QY++F+A
Sbjct: 380 MFKHLV-------HKPSEEKVKEIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVA 432

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +R   ++G   +F+  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 433 DRLMLELGFSKIFRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 480


>gi|145249942|ref|XP_001401310.1| ribonucleoside-diphosphate reductase small chain [Aspergillus niger
           CBS 513.88]
 gi|134081995|emb|CAK46680.1| unnamed protein product [Aspergillus niger]
          Length = 396

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 99/349 (28%), Positives = 162/349 (46%), Gaps = 31/349 (8%)

Query: 8   SPIQAGEKRVNVDD----KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
            P++A +    + +    + +L        L P+KY   W+ Y  A  + W   E+ +  
Sbjct: 50  KPVEAPKVAPGIKEMEASEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSK 109

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DL  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   
Sbjct: 110 DLHDWH--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQIMM 167

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ Q            D
Sbjct: 168 ENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIAKKADWAIKWIQ------------D 215

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 216 RESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACL 274

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           + + +         +  +Q    ++ EA  +E  +  + +P   +G+N+    QY++F+A
Sbjct: 275 LFSHLNN-------RPSKQVVEDIIVEAVGIEQEFLTDALPVALLGMNSKLMCQYIEFVA 327

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +R    +G +  +  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 328 DRLLVALGNKKYYNAT-NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 374


>gi|171687074|ref|XP_001908478.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943498|emb|CAP69151.1| unnamed protein product [Podospora anserina S mat+]
          Length = 409

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 163/351 (46%), Gaps = 27/351 (7%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
               +  + A E +  + D+ +L        L P+KY   W+ Y  A  + W   E+ + 
Sbjct: 57  KKEEIKTVAAPEPKQELLDEPLLTENPQRFVLFPIKYHEVWQMYKKAEASFWTAEEIDLS 116

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q  
Sbjct: 117 KDLHDW--SNKLNDDEKFFISHILAFFAASDGIVNENLVERFSAEVQIPEARCFYGFQIM 174

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS T+  +I +   +  +   LFN    +P I  KA+WAL++              
Sbjct: 175 MENIHSETYSLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWI------------S 222

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
           D D  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 223 DKDASFAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFAC 281

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            + + +         +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F+
Sbjct: 282 LLFSHLNN-------RPSKQLVEDIIRDAVTIEQEFLTEALPCALLGMNSNLMKQYIEFV 334

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           A+R    +G + ++  + NPF +M E I L  + NFFE RV EYQ+   + 
Sbjct: 335 ADRLLVALGNDKIY-RSTNPFDFM-ENISLGGKTNFFEKRVGEYQKAGVMN 383


>gi|169860861|ref|XP_001837065.1| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
 gi|116501787|gb|EAU84682.1| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 414

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 95/350 (27%), Positives = 158/350 (45%), Gaps = 27/350 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
              T L     GE  +   ++ +L        L P++Y   W+ Y  A  + W   E+ +
Sbjct: 63  DELTLLRRKFVGEVDLPESEEPLLKESKRRFVLFPIQYHEIWQMYKKAEASFWTAEEMDL 122

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N L D+ER  I   L FFA+S+ +V  N++      +   E R +   Q 
Sbjct: 123 SKDLHDWN--NKLNDNERHFISHVLAFFAASDGIVNENLLERFSNEVQAAEARCFYGFQI 180

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   D  +   LF+    +P I  KA+WAL +             
Sbjct: 181 MMENIHSETYSLLIDTYIKDPAQRDYLFDAVDTIPCIKKKADWALTWI------------ 228

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D    F + L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F 
Sbjct: 229 SDQKSTFAERLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFA 287

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +K        +      + ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 288 CLLFSHLKR-------RPHPDVVKRIITEAVAIEQEFLTDALPVKLIGMNAELMCQYIEF 340

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +A+R    +G E ++  + NPF +M  +I L+ + NFFE RV++Y +   
Sbjct: 341 VADRLLVSLGNEKVYN-STNPFDFMD-MISLQGKTNFFEKRVSDYAKAGV 388


>gi|242777635|ref|XP_002479074.1| ribonucleotide reductase small subunit RnrA, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218722693|gb|EED22111.1| ribonucleotide reductase small subunit RnrA, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 406

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 94/333 (28%), Positives = 155/333 (46%), Gaps = 27/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 72  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERY 129

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            + R L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 130 FVSRVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIN 189

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA+WAL++              D +  F Q L  F  V E
Sbjct: 190 EPKQRTYLFDAIDNIPCIRKKADWALRWI------------SDKESTFAQRLVAFAAV-E 236

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +         +  
Sbjct: 237 GIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNN-------RPN 289

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +    ++ +A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  + 
Sbjct: 290 PKVIEDIIVDAVAIEQEFLTDALPCSLLGMNSKLMCQYIEFVADRLLVALGNKKYYN-ST 348

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M E I L  + NFFE RV +YQ+   + 
Sbjct: 349 NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVMN 380


>gi|156058956|ref|XP_001595401.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980]
 gi|154701277|gb|EDO01016.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 407

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 102/341 (29%), Positives = 165/341 (48%), Gaps = 27/341 (7%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +    D+ +L    +   L P+KY   W+ Y  A  + W   E+ +  DL  W   
Sbjct: 61  APGIKPEEADEPLLQENPNRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN-- 118

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+
Sbjct: 119 NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETY 178

Query: 132 QYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +   ++ +   LFN    +P I  KA+WA+++ Q            D +  F Q 
Sbjct: 179 SLLIDTYIKEQAQKTYLFNAIDTIPCIKKKADWAVKWIQ------------DKNSTFAQR 226

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K  
Sbjct: 227 LVAFAAV-EGIFFSGSFASIFWLKKRGLMAGLTFSNELISRDEGLHTDFACLLFSHLK-- 283

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                 +  +Q  + ++ EA  +E  +  E +P   +G+N+   +QY++F+A+R    +G
Sbjct: 284 -----HRPSKQAVQDVITEAVEIEQEFLTEALPCALLGMNSTLMKQYIEFVADRLLVTLG 338

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            + ++K + NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 339 NDKVYK-SANPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 377


>gi|150863757|ref|XP_001382334.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
 gi|149385013|gb|ABN64305.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
          Length = 417

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 100/333 (30%), Positives = 159/333 (47%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L   +    L P+KY   W+ Y  A  + W   E+ +  D+  W   N L D+ER
Sbjct: 89  KDEPLLMENTRRFVLFPIKYNEVWQMYKKAEASFWTAEEIDLSKDITDWN--NRLNDNER 146

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I S  
Sbjct: 147 FFISRILAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDSYI 206

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA+WAL++              D D  F + L  F  V 
Sbjct: 207 KDPKEADFLFNAIDNIPCIRKKADWALRWI------------SDDDALFGERLVAFAAV- 253

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + ++        + 
Sbjct: 254 EGIFFSGSFASIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFSHLQN-------RP 306

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +G + ++  T
Sbjct: 307 DAEIVEKIITEAVKIEKEFFTDALPSSLLGMNAELMCQYVEFVADRLLVALGNKKVYNVT 366

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 367 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 397


>gi|302904131|ref|XP_003049009.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729943|gb|EEU43296.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 389

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 103/338 (30%), Positives = 162/338 (47%), Gaps = 27/338 (7%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +     D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L
Sbjct: 50  EEAEEADEPLLQENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRL 107

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           T DE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +
Sbjct: 108 TSDEQFFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLL 167

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   +  +   LFN    +P I  KA+WA+++ Q            D D  F Q L  
Sbjct: 168 IDTYIKEPSQRTYLFNAIETIPCIRKKADWAIRWIQ------------DKDSSFAQRLVA 215

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K     
Sbjct: 216 FAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLHSHLK----- 269

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              +  +Q  + ++ +A  +E  +  E +P   +G+NA   +QY++F+A+R    +G E 
Sbjct: 270 --GRASKQVIQDIITDAVTIEQEFLTEALPCALLGMNADLMKQYIEFVADRLLVALGNEK 327

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ++K + NPF +M E I L  + NFFE RV +YQ+   L
Sbjct: 328 VYK-SANPFDFM-ENISLGGKTNFFEKRVGDYQKAGVL 363


>gi|303314521|ref|XP_003067269.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240106937|gb|EER25124.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320037571|gb|EFW19508.1| ribonucleoside-diphosphate reductase small subunit [Coccidioides
           posadasii str. Silveira]
          Length = 408

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 97/351 (27%), Positives = 163/351 (46%), Gaps = 27/351 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
             +   +P ++   +    ++ +L        L PLKY   W+ Y  A  + W   E+ +
Sbjct: 57  KPSAPEAPKKSLTPKELEAEEPLLQENPHRFVLFPLKYHEIWQMYKKAEASFWTAEEIDL 116

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W  +  L DDER  I R L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 117 SKDLHDWNHR--LNDDERYFISRVLAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQI 174

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   +  +   LF+    +P I  KA+WA+++ Q           
Sbjct: 175 MMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIRKKADWAIRWIQ----------- 223

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 224 -DQESTFAQRLIAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 281

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + ++        +   +  + ++ EA  +E  +  + +P   +G+N+    QY++F
Sbjct: 282 CLLFSHLR-------HRPGPEAVQAIITEAVEIEKEFLTDALPCALLGMNSKLMCQYIEF 334

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 335 VADRLLVALGNKKFYNAT-NPFDFMD-NISLSGKTNFFEKRVGDYQKAGVM 383


>gi|289620013|emb|CBI53457.1| unnamed protein product [Sordaria macrospora]
          Length = 410

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 101/352 (28%), Positives = 161/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
              +    I A   +     + +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 58  KKASEAKKI-APTLKPEEAAEPLLTENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDL 116

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N LTDDER  +   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 117 SKDLHDWN--NRLTDDERFFVSHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQI 174

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   +  +   LFN    +P I  KA+WAL++             
Sbjct: 175 MMENIHSETYSLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWI------------ 222

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D    F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 223 TDKSSTFAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 281

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         +  +Q  + ++ +A  +E  +  E +P   +G+NA   +QY++F
Sbjct: 282 CLLFSHLNN-------RPSKQLIQDIIVDAVRIEQEFLTEALPCALLGMNADLMKQYIEF 334

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E ++  + NPF +M E I L  + NFFE RV +YQ+   + 
Sbjct: 335 VADRLLVALGNEKVY-RSTNPFDFM-ENISLGGKTNFFEKRVADYQKAGVMN 384


>gi|212533263|ref|XP_002146788.1| ribonucleotide reductase small subunit RnrA, putative [Penicillium
           marneffei ATCC 18224]
 gi|210072152|gb|EEA26241.1| ribonucleotide reductase small subunit RnrA, putative [Penicillium
           marneffei ATCC 18224]
          Length = 406

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 98/352 (27%), Positives = 159/352 (45%), Gaps = 27/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
                 +P  A   +    ++ +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 53  KPTVQATPKVAPSIKEMEANEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDL 112

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 113 SKDLHDWN--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQI 170

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   +  +   LF+    +P I  KA+WAL++             
Sbjct: 171 MMENIHSETYSLLIDTYINEPKQRTYLFDAIDNIPCIRKKADWALRWI------------ 218

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 219 SDKESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 277

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +        T+   +    ++ +A  +E  +  + +P   +G+N+    QY++F
Sbjct: 278 CMLFSHL-------NTRPNPKVIEDIIVDAVAIEQEFLTDALPCALLGMNSKLMCQYIEF 330

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G +  +  T NPF +M E I L  + NFFE RV +YQ+   + 
Sbjct: 331 VADRLLVALGNKKYYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVMN 380


>gi|255536887|ref|XP_002509510.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
 gi|223549409|gb|EEF50897.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
          Length = 329

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 92/333 (27%), Positives = 154/333 (46%), Gaps = 29/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  DL  W+S   LT DE+ 
Sbjct: 6   EEPLLAPNPDRFCMFPIQYPEIWEMYKKAEASFWTAEEVDLSQDLRHWES---LTPDEKH 62

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ +   
Sbjct: 63  FISHVLAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLETYIK 122

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF+    VP I  KA WAL++     S                +  + +   E
Sbjct: 123 DSNEKNRLFHAIETVPCIAKKAEWALKWIDGSES--------------FAERIIAFACVE 168

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + +K +         
Sbjct: 169 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLKKKLS------- 221

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G    +  + 
Sbjct: 222 EERVKGIVRDAVNIEREFVCDALPCALVGMNGELMSQYIEFVADRLLGALGCGKEYNVS- 280

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ A + 
Sbjct: 281 NPFDWM-ELISLQGKTNFFEKRVGEYQKAAVMS 312


>gi|85109237|ref|XP_962820.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
 gi|30316285|sp|Q9C167|RIR2_NEUCR RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|16273691|gb|AAK14804.2| small subunit of ribonucleotide reductase [Neurospora crassa]
 gi|28924456|gb|EAA33584.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
          Length = 410

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 99/342 (28%), Positives = 159/342 (46%), Gaps = 27/342 (7%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   
Sbjct: 67  APTLKPEEANEPLLTENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN-- 124

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N L DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+
Sbjct: 125 NRLNDDEKFFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETY 184

Query: 132 QYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +   +  +   LFN    +P I  KA+WAL++              D    F Q 
Sbjct: 185 SLLIDTYIKEPSQRTYLFNAIDTIPCIRKKADWALRWI------------TDKSSTFAQR 232

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +   
Sbjct: 233 LVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNN- 290

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                 +  +Q  + ++ +A  +E  +  E +P   +G+NA   +QY++F+A+R    +G
Sbjct: 291 ------RPSKQLIQEIIVDAVRIEQEFLTEALPCALLGMNADLMKQYIEFVADRLLVALG 344

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            E ++  + NPF +M E I L  + NFFE RV +YQ+   + 
Sbjct: 345 NEKIY-RSTNPFDFM-ENISLGGKTNFFEKRVGDYQKAGVMN 384


>gi|119174781|ref|XP_001239725.1| hypothetical protein CIMG_09346 [Coccidioides immitis RS]
          Length = 408

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 96/332 (28%), Positives = 157/332 (47%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L PLKY   W+ Y  A  + W   E+ +  DL  W  +  L DDER 
Sbjct: 76  EEPLLQENPHRFVLFPLKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNHR--LNDDERY 133

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 134 FISRVLAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIK 193

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA+WA+++ Q            D +  F Q L  F  V E
Sbjct: 194 EPKQRTYLFDAIDTIPCIRKKADWAIRWIQ------------DQESTFAQRLIAFAAV-E 240

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + ++        +  
Sbjct: 241 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLR-------HRPG 293

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +  + ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  T 
Sbjct: 294 PEAVQAIITEAVEIEKEFLTDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYNAT- 352

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 353 NPFDFMD-NISLSGKTNFFEKRVGDYQKAGVM 383


>gi|154296564|ref|XP_001548712.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
 gi|150843273|gb|EDN18466.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
          Length = 407

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 101/341 (29%), Positives = 164/341 (48%), Gaps = 27/341 (7%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +    D+ +L    +   L P+KY   W+ Y  A  + W   E+ +  DL  W  +
Sbjct: 61  APGIKPEEADEPLLQENPNRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWNER 120

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
             L DDER  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+
Sbjct: 121 --LNDDERYFISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETY 178

Query: 132 QYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +   ++ +   LFN    +P I  KA+WA+++ Q            D +  F Q 
Sbjct: 179 SLLIDTYIKEQSQKTYLFNAIDTIPCIKKKADWAVKWIQ------------DKNSTFAQR 226

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
           L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K  
Sbjct: 227 LVAFAAV-EGIFFSGSFASIFWLKKRGLMAGLTFSNELISRDEGLHTDFACLLFSHLK-- 283

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                 +  +Q  + ++ EA  +E  +  E +P   +G+N+   +QY++F+A+R    +G
Sbjct: 284 -----HRPSKQAVQDVITEAVEIEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLLSLG 338

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +  +K + NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 339 NDKYYK-SANPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 377


>gi|2500209|sp|Q60561|RIR2_MESAU RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|49650|emb|CAA48232.1| ribonucleotide reductase [Mesocricetus auratus]
          Length = 386

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 95/346 (27%), Positives = 157/346 (45%), Gaps = 28/346 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
            P        +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  
Sbjct: 57  EPESKVSTNPSVEDEPLLRENPRRFVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQH 116

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W+    L  DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +H
Sbjct: 117 WE---ALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIH 173

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL++                 + 
Sbjct: 174 SEMYSLLIDTYIKDSKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEA 220

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 221 TYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKH 280

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +         K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R  
Sbjct: 281 LV-------HKPSEQRVQEIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLM 333

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++G   +FK  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 334 LELGFNKIFKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|70997335|ref|XP_753417.1| ribonucleotide reductase small subunit RnrA [Aspergillus fumigatus
           Af293]
 gi|66851053|gb|EAL91379.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           fumigatus Af293]
 gi|159126856|gb|EDP51972.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           fumigatus A1163]
          Length = 405

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 94/332 (28%), Positives = 154/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 72  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERY 129

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 130 FISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMIENIHSETYSLLIDTYIK 189

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA WA+++              D +  F Q L  F  V E
Sbjct: 190 EPKQRTYLFDAIDTIPCIRKKAQWAMRWI------------SDKESTFAQRLVAFAAV-E 236

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +         +  
Sbjct: 237 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL-------NHRPD 289

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           ++    ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G +  F  + 
Sbjct: 290 KKVIEDIIVEAVAIEQEFLTDALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYFN-SP 348

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 349 NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 379


>gi|116191729|ref|XP_001221677.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
 gi|88181495|gb|EAQ88963.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
          Length = 409

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 100/352 (28%), Positives = 162/352 (46%), Gaps = 28/352 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M      + + A   + +  D+ +L        L P+KY   W+ Y  A  + W   E+ 
Sbjct: 56  MKKKETSAAV-APTIKADEADEPLLQENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEID 114

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  DL  W   N + DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q
Sbjct: 115 LSKDLHDWN--NKINDDEKYFISHILAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQ 172

Query: 121 AFEEAVHSHTFQYIITSLGLDE---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS T+  +I +   +      LFN    +P+I  KA+WAL++            
Sbjct: 173 IMMENIHSETYSLLIDTYIKEPAQRTHLFNAIDTIPAIRKKADWALRWI----------- 221

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
             D    F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F
Sbjct: 222 -TDQKSTFAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDF 279

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              + + +         +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++
Sbjct: 280 ACLLFSHLNN-------RPSKQIIEDIIVDAVRIEQEFLTEALPCALLGMNSNLMKQYIE 332

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F+A+R    +G E ++  + NPF +M E I L  + NFFE RV EYQ+   +
Sbjct: 333 FVADRLLVALGNEKVY-RSTNPFDFM-ENISLGGKTNFFEKRVGEYQKAGVM 382


>gi|149408710|ref|XP_001506085.1| PREDICTED: similar to 5,10-methenyltetrahydrofolate synthetase
           [Ornithorhynchus anatinus]
          Length = 394

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 92/350 (26%), Positives = 159/350 (45%), Gaps = 28/350 (8%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
              L  + +      V+D+ +L        + P++Y   W+ Y  A  + W   EV +  
Sbjct: 57  QEPLESVVSSWASPRVEDEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSK 116

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+  W+S   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   
Sbjct: 117 DIQHWES---LKPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAM 173

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E +HS  +  +I +   +  E   LFN    +P +  KA+WAL++               
Sbjct: 174 ENIHSEMYSLLIDTYIKEPKEREFLFNAIETLPCVKKKADWALRWIG------------- 220

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
             +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 221 DKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACL 280

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +   +         K  +++ + ++  A  +E  +  E +P   +G+N    +QY++F+A
Sbjct: 281 MFKHLV-------HKPSEERVKEIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVA 333

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +R   ++G   +FK  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 334 DRLLLELGFSKIFKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 381


>gi|310798394|gb|EFQ33287.1| ribonucleotide reductase [Glomerella graminicola M1.001]
          Length = 413

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 98/346 (28%), Positives = 162/346 (46%), Gaps = 27/346 (7%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
            P+     +    D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  
Sbjct: 66  KPVVVPGIKEQEMDEPLLQENGQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHD 125

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W   N + +DE+  I   L FFA+S+ +V  N+V      +  PE R +   Q   E +H
Sbjct: 126 WN--NKINEDEKYFISHILAFFAASDGIVNENLVERFSGEVQVPEARCFYGFQIMMENIH 183

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S T+  +I +   +  +   LFN    +P I  KA+WAL++              D    
Sbjct: 184 SETYSLLIDTYIKEPAQRTYLFNAIDTIPCIRKKADWALKWI------------SDEKSS 231

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + 
Sbjct: 232 FAQRLVAFAAV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYSH 290

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +K        +  +Q  + ++ +A  +E  +  E +P   +G+N+   +QY++F+A+R  
Sbjct: 291 LKN-------RPSKQVIQDIIVDAVQIEQEFLTEALPCALLGMNSNLMKQYIEFVADRLL 343

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             +G + ++K + NPF +M E I L  + NFFE RV +YQ+   + 
Sbjct: 344 VALGNDKVYK-SSNPFDFM-ENISLGGKTNFFEKRVADYQKAGVMN 387


>gi|119478853|ref|XP_001259462.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya
           fischeri NRRL 181]
 gi|119407616|gb|EAW17565.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya
           fischeri NRRL 181]
          Length = 405

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 94/332 (28%), Positives = 154/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 72  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERY 129

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 130 FISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMIENIHSETYSLLIDTYIK 189

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA WA+++              D +  F Q L  F  V E
Sbjct: 190 EPKQRTYLFDAIDTIPCIAKKAQWAMRWI------------SDKESTFAQRLVAFAAV-E 236

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +         +  
Sbjct: 237 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL-------NHRPD 289

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           ++    ++ EA  +E  +  E +P   +G+N+    QY++F+A+R    +G +  +  + 
Sbjct: 290 KKVVEDIIVEAVAIEQEFLTEALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYYN-SS 348

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 349 NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 379


>gi|121713826|ref|XP_001274524.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           clavatus NRRL 1]
 gi|119402677|gb|EAW13098.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           clavatus NRRL 1]
          Length = 405

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 93/332 (28%), Positives = 154/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 72  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDDERY 129

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 130 FISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMIENIHSETYSLLIDTYIK 189

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA WA+++              D +  F Q L  F  V E
Sbjct: 190 EPKQRAYLFDAIDTIPCINKKAQWAMRWI------------SDKESSFGQRLVAFAAV-E 236

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +         +  
Sbjct: 237 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNN-------RPD 289

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           ++    ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  + 
Sbjct: 290 KKVVEDIIVEAVAIEQEFLTDALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYYN-SP 348

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 349 NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 379


>gi|315041979|ref|XP_003170366.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
 gi|311345400|gb|EFR04603.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
          Length = 408

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 96/343 (27%), Positives = 157/343 (45%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++A   +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W 
Sbjct: 65  VKAKTPKELEAEEPLLQENPQRFVLFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN 124

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 125 --NRLNDDERFFISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSE 182

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D D  F 
Sbjct: 183 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKDSTFA 230

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 231 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL- 288

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 289 ------NHRPEPSAVEAIITEAVTIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 342

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 343 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 383


>gi|224129040|ref|XP_002328875.1| predicted protein [Populus trichocarpa]
 gi|222839305|gb|EEE77642.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 155/333 (46%), Gaps = 29/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  D+  W+    LT DE+ 
Sbjct: 6   EEPLLAENPDRFCMFPIQYPSIWEMYKKAEASFWTAEEVDLSSDIRHWE---NLTPDEKH 62

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ +   
Sbjct: 63  FISHVLAFFAASDGIVLENLAGRFMKEVQVSEARAFYGFQIAIENIHSEMYSLLLETYIK 122

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF+    VP +  KA WAL++              D  + F + L   +   E
Sbjct: 123 DSEEKNRLFHAIETVPCVAKKARWALRWI-------------DGSESFAERLVA-FACVE 168

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 169 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRKKLS------- 221

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++    
Sbjct: 222 EEQVKGIVKDAVDIEREFVVDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYNVA- 280

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 281 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 312


>gi|115387427|ref|XP_001211219.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
 gi|114195303|gb|EAU37003.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
          Length = 401

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 96/332 (28%), Positives = 156/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L +DER 
Sbjct: 71  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNEDERY 128

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +I +   
Sbjct: 129 FISHVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMIENIHSETYSLLIDTYIK 188

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA+WA+++ Q            D +  F Q L  F  V E
Sbjct: 189 EPKQRTYLFDAIDNIPCIAKKADWAIKWIQ------------DQESTFGQRLVAFAAV-E 235

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +         +  
Sbjct: 236 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNN-------RPS 288

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +Q    ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G    F ++ 
Sbjct: 289 KQVVEDIIVEAVAIEKEFLTDALPVALLGMNSKLMCQYIEFVADRLLVALGNNKYF-HST 347

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 348 NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 378


>gi|326472581|gb|EGD96590.1| ribonucleotide reductase small subunit RnrA [Trichophyton tonsurans
           CBS 112818]
          Length = 408

 Score =  277 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 94/343 (27%), Positives = 156/343 (45%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++    +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W 
Sbjct: 65  VKPKTPKELEAEEPLLQENPQRFVLFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN 124

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 125 --NRLNDDERFFISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSE 182

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D +  F 
Sbjct: 183 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKNSTFS 230

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 231 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL- 288

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 289 ------NYRPDPNAVEAIITEAVTIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 342

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 343 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 383


>gi|169779219|ref|XP_001824074.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           oryzae RIB40]
 gi|238499845|ref|XP_002381157.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           flavus NRRL3357]
 gi|83772813|dbj|BAE62941.1| unnamed protein product [Aspergillus oryzae]
 gi|220692910|gb|EED49256.1| ribonucleotide reductase small subunit RnrA, putative [Aspergillus
           flavus NRRL3357]
          Length = 405

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 96/332 (28%), Positives = 153/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L DDER 
Sbjct: 73  NEPLLQENPHRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWH--NRLNDDERF 130

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N++      +  PE R +   Q   E +H+ T+  +I +   
Sbjct: 131 FISRVLAFFAASDGIVNENLLERFSGEVQIPEARCFYGFQIMIENIHAETYSLLIDTYIK 190

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  +   LF+    +P I  KA+WA+++ Q            D +  F Q L  F  V E
Sbjct: 191 EPKQRTYLFDAIDTIPCIRKKADWAIRWIQ------------DQESTFGQRLVAFAAV-E 237

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   + + +            
Sbjct: 238 GIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLNNRPDP------ 291

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            Q    ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G    F  T 
Sbjct: 292 -QIVEDVIVEAVSIEKEFLTDALPCALLGMNSNLMCQYIEFVADRLLVALGNNKYFNAT- 349

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 350 NPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 380


>gi|224055741|ref|XP_002298630.1| predicted protein [Populus trichocarpa]
 gi|222845888|gb|EEE83435.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 156/333 (46%), Gaps = 29/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  D+  W+    LT DE+ 
Sbjct: 6   EEPLLAENPDRFCMFPIQYPSIWEMYKKAEASFWTAEEVDLSSDVGHWE---NLTPDEKH 62

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  NI     + +   E R +   Q   E +HS  +  ++ +   
Sbjct: 63  FISHVLAFFAASDGIVLENIAGRFMKEVQVSEARAFYGFQIAIENIHSEMYSLLLETYIK 122

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF+    VP +  KA WAL++              D  + F + L   +   E
Sbjct: 123 DSTEKNRLFHAIETVPCVAKKAEWALRWI-------------DGGESFAERLIA-FACVE 168

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 169 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRKKLS------- 221

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ EA  +E  +  +++P   VG+N     QY++F+A+R    +G   ++    
Sbjct: 222 EERVKGIVKEAVDIEREFVVDSLPCALVGMNGELMSQYIEFVADRLLGALGCGKVYNVA- 280

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 281 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 312


>gi|258567064|ref|XP_002584276.1| ribonucleoside-diphosphate reductase small chain [Uncinocarpus
           reesii 1704]
 gi|237905722|gb|EEP80123.1| ribonucleoside-diphosphate reductase small chain [Uncinocarpus
           reesii 1704]
          Length = 401

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 99/352 (28%), Positives = 160/352 (45%), Gaps = 27/352 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +  +    P +A   +    ++ +L        L PLKY   W+ Y  A  + W   E+ 
Sbjct: 49  IKPSAPEEPKKALSPKELEAEEPLLQENPQRFVLFPLKYHEIWQMYKKAEASFWTAEEID 108

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  DL  W  +  L DDER  I R L FFA+S+ +V  N+V      +  PE R +   Q
Sbjct: 109 LSKDLHDWNHR--LNDDERYFISRVLAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQ 166

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS T+  +I +   +  +   LF     +P I  KA+WA+++ Q          
Sbjct: 167 IMMENIHSETYSLLIDTYIKEPKQRTYLFEALDNIPCIRKKADWAIRWIQ---------- 216

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
             D D  F Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F
Sbjct: 217 --DKDSTFAQRLIAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDF 273

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              + + I+        +        ++ EA  +E  +  + +P   +G+N+    QY++
Sbjct: 274 ACLLFSHIR-------HRPTPAAVEAIITEAVEIEKEFLTDALPCALLGMNSKLMCQYIE 326

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F+A+R    +G +  + +  NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 327 FVADRLLVALGNKKFY-HATNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 376


>gi|302409182|ref|XP_003002425.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
 gi|261358458|gb|EEY20886.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
          Length = 414

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 161/351 (45%), Gaps = 27/351 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
               G   + A   +    D+ +L        L P+KY   W+ Y  A  + W   E+ +
Sbjct: 61  KREEGDKAVVAPGIKDFEADEPLLRENGQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDL 120

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N + DDE+  I   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 121 SKDLHDWN--NKINDDEKYFISHILAFFAASDGIVNENLVERFSAEVQVPEARCFYGFQI 178

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   +  +   LFN    +P I  KA+WAL +             
Sbjct: 179 MMENIHSETYSLLIDTYIKEPAQRTYLFNAIDTIPCIRKKADWALTWI------------ 226

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D    F   L   + V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 227 TDKKSTFATRLVA-FAVVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 285

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         +  +Q  + ++ +A  +E  +  E +P G +G+NA   +QY++F
Sbjct: 286 CLLFSHLNN-------RPSKQTVQDIVTDAVNIEQEFLTEALPCGLLGMNATLMKQYIEF 338

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +A+R    +G E ++K T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 339 VADRLLVALGNEKVYKAT-NPFDFM-ENISLGGKTNFFEKRVADYQKAGVM 387


>gi|50545856|ref|XP_500466.1| YALI0B03630p [Yarrowia lipolytica]
 gi|49646332|emb|CAG82692.1| YALI0B03630p [Yarrowia lipolytica]
          Length = 403

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 97/337 (28%), Positives = 161/337 (47%), Gaps = 27/337 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R +  D+ +L        L P++Y   W+ Y  A  + W   E+ +  D+  W+  N L 
Sbjct: 71  RESEKDEPLLKENHRRFVLFPIQYHEIWQMYKKAEASFWTAEEIDLGKDMGDWE--NRLN 128

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           +DER  I   L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I
Sbjct: 129 NDERFFISHVLAFFAASDGIVNENLVERFSGEVQAPEAKCFYGFQIMMENIHSETYSLLI 188

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA+WAL++              D +  F + L  F
Sbjct: 189 DTYIKDPKERTYLFNAIETIPCIKKKADWALKWI------------SDEESTFGERLIAF 236

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++F   FA I  L +   M G+    + I RDE LH +F   + + ++      
Sbjct: 237 AAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLEN----- 290

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             +  ++    ++ EA  +E  +  + +P G +G+NA    QY++F+A+R    +G   +
Sbjct: 291 --RPSKKIVEDVIVEAVGIEQEFLTDALPCGLLGMNAKLMCQYIEFVADRLLVALGNSKV 348

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +  + NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 349 YN-STNPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 383


>gi|46122063|ref|XP_385585.1| hypothetical protein FG05409.1 [Gibberella zeae PH-1]
          Length = 399

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 102/333 (30%), Positives = 163/333 (48%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N LT DE+
Sbjct: 65  EDEPILQENPQRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLTSDEQ 122

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+V      +  PE R +   Q   E +HS T+  +I +  
Sbjct: 123 YFISHILAFFAASDGIVNENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYI 182

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  +   LFN    +P I  KA+WA+++ Q            D +  F Q L  F  V 
Sbjct: 183 KDPAQRTYLFNAVDTIPCIRKKADWAIRWIQ------------DKNSTFAQRLVAFAAV- 229

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G++   + I RDE LH +F   + + +K        + 
Sbjct: 230 EGIFFSGAFASIFWLKKRGLMPGLSFSNELISRDEGLHTDFACLLHSHLK-------GRA 282

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            +Q  + ++ +A  +E  +  E +P   +G+N+   +QY++F+A+R    +G E ++K +
Sbjct: 283 SKQMIQDIITDAVSIEQEFLTEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYK-S 341

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV +YQ+   L
Sbjct: 342 TNPFDFM-ENISLGGKTNFFEKRVADYQKAGVL 373


>gi|302843870|ref|XP_002953476.1| hypothetical protein VOLCADRAFT_109884 [Volvox carteri f.
           nagariensis]
 gi|300261235|gb|EFJ45449.1| hypothetical protein VOLCADRAFT_109884 [Volvox carteri f.
           nagariensis]
          Length = 400

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 92/344 (26%), Positives = 159/344 (46%), Gaps = 29/344 (8%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
            +    ++   D + +L+   D   + P+KY   WE Y  A  + W   EV + DD+  W
Sbjct: 67  ELFTSPRKSMRDPEPLLDENPDRFCMFPIKYPKIWEMYKKAEASFWTAEEVDLGDDMKHW 126

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           +    L+D ER  I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS
Sbjct: 127 E---KLSDGERHFISHVLAFFAASDGIVLENLAIRFMKEVQLPEARAFYGFQVAIENIHS 183

Query: 129 HTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
             +  ++ +   D  E   LF+    VP I  KA WA+++  +             +  F
Sbjct: 184 EMYSLLLETYIKDPIEKHKLFHSIETVPCIKKKAQWAIKWIGS-------------ESSF 230

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
            + L  F  V EG++F   F  I  L +   M G+    + I RDE LH +F   +   +
Sbjct: 231 PERLVAFAAV-EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYGML 289

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
             +         + + + ++ EA  +E  +  + +P   +G+N+    QY++F+A+R   
Sbjct: 290 SKQL-------EESRIKEIICEAVDIENEFCTDALPVDLIGMNSRLMAQYIEFVADRLLV 342

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +G    +  T NPF +M  +I L+ + NFFE RV +YQ+   +
Sbjct: 343 ALGCSKAYNVT-NPFDFMD-MISLQGKTNFFEKRVGDYQKSGVM 384


>gi|255954081|ref|XP_002567793.1| Pc21g07530 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211589504|emb|CAP95650.1| Pc21g07530 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 400

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 97/365 (26%), Positives = 159/365 (43%), Gaps = 41/365 (11%)

Query: 2   ANNTGLSPIQAGEKRVNVD--------------DKRMLNARSDVNQLLPLKYGWAWEKYL 47
             N  L P+    ++                   + +L        + P+KY   W+ Y 
Sbjct: 35  KENASLKPVDTPIEKPTEKALENKPLTVKELEATEPLLQENPHRFVMFPIKYHEIWQMYK 94

Query: 48  SACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRH 107
            A  + W   E+ +  DL  W   N L DDER  I   L FFA+S+ +V  N+V      
Sbjct: 95  KAEASFWTAEEIDLSKDLHDWH--NRLNDDERYFISHVLAFFAASDGIVNENLVERFSAE 152

Query: 108 LSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQ 164
           +  PE R +   Q   E +HS T+  +I +   +  +   LF+    +P IT KANWA++
Sbjct: 153 VQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCITKKANWAIR 212

Query: 165 YTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQY 224
           +              D +  F   L  F  V EG++F   FA I  L +   M G+    
Sbjct: 213 WIN------------DRESTFASRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSN 259

Query: 225 QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 284
           + I RDE LH +F   + +        +  +   +    ++ EA  +E  +  + +P   
Sbjct: 260 ELISRDEGLHTDFACLLFSH-------MNHRPDPKVVEEIIVEAVGIEQEFLTDALPCAL 312

Query: 285 VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 344
           +G+N+    QY++F+A+R    +G +  +  + NPF +M E I L  + NFFE RV +YQ
Sbjct: 313 LGMNSKLMCQYIEFVADRLLVALGNKKYYN-SANPFDFM-ESISLAGKTNFFEKRVGDYQ 370

Query: 345 QGAEL 349
           +   +
Sbjct: 371 KAGVM 375


>gi|302497417|ref|XP_003010709.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
 gi|291174252|gb|EFE30069.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
          Length = 408

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 95/343 (27%), Positives = 156/343 (45%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++    +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W 
Sbjct: 65  VKPKTPKELEAEEPLLQENPQRFVLFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN 124

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 125 --NRLNDDERYFISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSE 182

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D D  F 
Sbjct: 183 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKDSTFA 230

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 231 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL- 288

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 289 ------NYRPDPSAVEAIITEAVTIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 342

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 343 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 383


>gi|307110551|gb|EFN58787.1| hypothetical protein CHLNCDRAFT_34102 [Chlorella variabilis]
          Length = 335

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 90/340 (26%), Positives = 156/340 (45%), Gaps = 29/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E+ +    + +L +  D   + P+KY   WE Y  A  + W   EV +  D+  W+    
Sbjct: 6   EQSLEDSQEPLLASNDDRFVMFPIKYRDIWEMYKKAEASFWTAEEVDLGSDVKDWE---R 62

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L+DDER  +   L FFA+S+ +V  N+     + +  PE R +   Q   E +HS  +  
Sbjct: 63  LSDDERHFVSHVLAFFAASDGIVNENLGARFMQEVQVPEARAFYGFQIAMENIHSEMYSL 122

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           ++ +   D  E   LF+    VP +  KA+WAL++                   F + L 
Sbjct: 123 LLEAYIKDPKEKDKLFHAIDTVPVVRKKAHWALKWIN-------------GSDLFSERLI 169

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
             +   EG++F   F  I  L +   M G+    + I RDE LH +F   +   I     
Sbjct: 170 A-FACVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYRHIHNRLS 228

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
                  +++   ++ +A  +E  +  + +P   +G+N+    QY++F+A+R    +G  
Sbjct: 229 -------EERVAEIVTQAVEIEKEFICDALPVDLIGMNSRLMGQYIEFVADRLLVALGNP 281

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++  + NPF WM E+I L+ + NFFE RV +YQ+   + 
Sbjct: 282 KVYNVS-NPFDWM-ELISLQGKTNFFEKRVGDYQKAGVMN 319


>gi|327298815|ref|XP_003234101.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
 gi|326464279|gb|EGD89732.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
          Length = 408

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 94/343 (27%), Positives = 156/343 (45%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++    +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W 
Sbjct: 65  VKPKTPKELEAEEPLLQENPQRFVLFPIKYREIWQMYKKAEASFWTAEEIDLSKDIHDWN 124

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 125 --NRLNDDERFFISHVLAFFAASDGIVNENLLERFSNEVQVPEARCFYGFQIMMENIHSE 182

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D +  F 
Sbjct: 183 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKNSTFA 230

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 231 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHL- 288

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 289 ------NYRPDPSAVEAIITEAVTIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 342

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 343 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 383


>gi|148705043|gb|EDL36990.1| ribonucleotide reductase M2 [Mus musculus]
          Length = 411

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 94/338 (27%), Positives = 156/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
             +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L 
Sbjct: 86  NPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALK 142

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 143 PDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLI 202

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P +  KA+WAL++                 +    +  V 
Sbjct: 203 DTYIKDPKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVA 249

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 250 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------ 303

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +
Sbjct: 304 -HKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKI 362

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           F+  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 363 FRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 398


>gi|291220709|ref|XP_002730368.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 402

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 101/352 (28%), Positives = 160/352 (45%), Gaps = 31/352 (8%)

Query: 5   TGLSPIQ---AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T + P++      K  N +D+ +L        + P+KY   W+ Y  A  + W   EV +
Sbjct: 63  TDVEPVKLEKRKSKPQNNEDEPLLRDNPRRFVIFPIKYHDIWQMYKKAEASFWTAEEVDL 122

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DLA W S   L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q 
Sbjct: 123 SKDLAHWAS---LKDDERHFISHVLAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQI 179

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS  +  +I +   D  E   LFN    +P +  KA WAL +             
Sbjct: 180 AIENIHSEMYSLLIDTYIRDPQEREYLFNAIETLPPVKRKAQWALNWINA---------- 229

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
              D     +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 230 ---DNATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA 286

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         K  QQ+   ++ +A  +E  +  + +P   +G+N    +QY++F
Sbjct: 287 CLMFSHLTN-------KPSQQRIIEIIRDAVKIEQEFLTDALPVSLIGMNKDLMKQYIEF 339

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G   ++   ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 340 VADRLLLDLGCNKIYN-KENPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 389


>gi|169613737|ref|XP_001800285.1| hypothetical protein SNOG_10001 [Phaeosphaeria nodorum SN15]
 gi|111061216|gb|EAT82336.1| hypothetical protein SNOG_10001 [Phaeosphaeria nodorum SN15]
          Length = 409

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 97/342 (28%), Positives = 157/342 (45%), Gaps = 28/342 (8%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
           A   +     + +L    +   L P+KY   W+ Y  A  + W   E+ +  DL  W  +
Sbjct: 61  APTIKEEEAHEPLLQENPNRFVLFPIKYHDVWQMYKKAEASFWTAEEIDLSKDLHDWNKR 120

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIV-LAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
             L DDER  I   L FFA+S+ +V  N+V       +  PE R +   Q   E +HS T
Sbjct: 121 --LNDDERFFISHVLAFFAASDGIVNENLVDERFSSEVQIPEARCFYGFQIMMENIHSET 178

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   +  +   LFN    +P I  KA+WAL++              D +  F  
Sbjct: 179 YSLLIDTYISEPRQRTYLFNAIDNIPCIRKKADWALKWI------------SDKNSTFAN 226

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F   + + +  
Sbjct: 227 RLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGMHTDFACLLFSLL-- 283

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                 T+  +   + ++ EA  +E  +  E +P   +G+N+    QY++F+A+R    +
Sbjct: 284 -----NTRPSKDAVKAIITEAVEIEQEFLTEALPCALLGMNSTLMCQYIEFVADRLLLAL 338

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           G   ++  T NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 339 GNTKVYNAT-NPFDFM-ENISLAGKTNFFEKRVGDYQKAGVM 378


>gi|159465835|ref|XP_001691128.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
 gi|158279814|gb|EDP05574.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
          Length = 394

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 163/350 (46%), Gaps = 30/350 (8%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
             + L  +     R  + ++ +L+   D   + P+KY   WE Y  A  + W   EV + 
Sbjct: 56  KGSNLRELFT-SPRKRMLEEPLLDENPDRFCMFPIKYPQIWEMYKKAEASFWTAEEVDLG 114

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
           DD+  W+    L+D ER  I   L FFA+S+ +V  N+ +   + +  PE R +   Q  
Sbjct: 115 DDMKHWE---KLSDGERHFISHVLAFFAASDGIVLENLAIRFMKEVQLPEARAFYGFQVA 171

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS  +  ++ S   D  E   LF+    VP I  KA WA+++  +           
Sbjct: 172 IENIHSEMYSLLLESYIKDPQEKHKLFHSIETVPCIKKKAQWAMKWIGS----------- 220

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
             D  F + L  F  V EG++F   F  I  L +   M G+    + I RDE LH +F  
Sbjct: 221 --DSVFSERLVAFAAV-EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 277

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            + + +        T+  + + + ++ EA  +E  +  E +P   +G+N+    QY+QF+
Sbjct: 278 MLFSML-------NTRIDETRVKQIIVEAVEIEQEFCTEALPVDLIGMNSRLMAQYIQFV 330

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           A+R    +G    +    NPF +M E+I L+ + NFFE RV +YQ+   +
Sbjct: 331 ADRLLVSLGCAKQYNVV-NPFEFM-EMISLQGKTNFFEKRVGDYQKNGVM 378


>gi|321476700|gb|EFX87660.1| hypothetical protein DAPPUDRAFT_306462 [Daphnia pulex]
          Length = 378

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 91/338 (26%), Positives = 156/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           R N  ++ +L +      L P++Y   W+ Y  A  + W   EV +  DL  W   + L 
Sbjct: 51  RDNDQNEPLLRSNPSRFVLFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLKDW---DNLQ 107

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +ER  +   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  +  +I
Sbjct: 108 PNERHFVSHVLAFFAASDGIVNENLVERFAQEVQVPEARCFYGFQIAMENIHSEMYSLLI 167

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA WA+++     +P               +  V 
Sbjct: 168 ETYIKDSAERTRLFNAVETMPCIAKKAEWAMKWIGNKDAP-------------YSERIVA 214

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  + P  
Sbjct: 215 FAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACVMFKHLVNKPP-- 272

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                +++   +++ A  +E  +  + +P   +G+N     QY++F+A+R   ++G   L
Sbjct: 273 -----KERIIEIINNAVKIEQEFLTDALPVEMIGMNCRLMRQYIEFVADRLLLELGCTKL 327

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  +ENPF +M   I L+ + NFFE +V EYQ+   + 
Sbjct: 328 YN-SENPFDFMEH-ISLEGKTNFFEKKVGEYQKAGVMN 363


>gi|4557845|ref|NP_001025.1| ribonucleoside-diphosphate reductase subunit M2 isoform 2 [Homo
           sapiens]
 gi|400979|sp|P31350|RIR2_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|36155|emb|CAA42181.1| small subunit ribonucleotide reductase [Homo sapiens]
 gi|251637|gb|AAA09577.1| ribonucleotide reductase R2 subunit [Homo sapiens]
 gi|12804875|gb|AAH01886.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|14029165|gb|AAK51163.1| ribonucleotide reductase M2 subunit [Homo sapiens]
 gi|20988810|gb|AAH30154.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|62702173|gb|AAX93099.1| unknown [Homo sapiens]
 gi|123981920|gb|ABM82789.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|123996753|gb|ABM85978.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|189053955|dbj|BAG36462.1| unnamed protein product [Homo sapiens]
 gi|261861600|dbj|BAI47322.1| ribonucleotide reductase M2 [synthetic construct]
          Length = 389

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 93/335 (27%), Positives = 156/335 (46%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 67  VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 123

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 124 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 183

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++                 +    +  V +  
Sbjct: 184 IKDPKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAFAA 230

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 231 VEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 283

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 284 PSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV 343

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 344 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 376


>gi|75076796|sp|Q4R7Q7|RIR2_MACFA RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|67969020|dbj|BAE00865.1| unnamed protein product [Macaca fascicularis]
          Length = 389

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 93/335 (27%), Positives = 156/335 (46%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 67  VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 123

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 124 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 183

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++                 +    +  V +  
Sbjct: 184 IKDPKEREFLFNAIETMPCVEKKADWALRWIG-------------DKEATYGERVVAFAA 230

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 231 VEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 283

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 284 PSEERVREIIINAVRVEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV 343

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 344 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 376


>gi|10432587|dbj|BAB13815.1| ribonucleotide reductase small subunit [Lentinula edodes]
          Length = 418

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 95/350 (27%), Positives = 157/350 (44%), Gaps = 27/350 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
                L     GE  +   ++ +L        L P++Y   W+ Y  A  + W   E+ +
Sbjct: 72  EELAALQKRFVGEVELPESEEPLLLESRRRFVLFPIQYHEIWQMYKKAEASFWTAEEMDL 131

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N L D ER  I R L FFA+S+ +V  N++      +   E R +   Q 
Sbjct: 132 SKDLHDWN--NRLNDSERFFISRVLAFFAASDGIVNENLLERFSNEVQVAEARCFYGFQI 189

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  +I +   D  E   LF+    +P I  KA WAL++             
Sbjct: 190 MMENIHSETYSLLIDTYIKDPVERDFLFDAIETIPCIKRKAEWALRWI------------ 237

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D    F + L  F  V EG++F   FA I  + +   M G+A   + I RDE +H +F 
Sbjct: 238 SDEHSVFGERLVAFAAV-EGIFFSGSFASIFWMKKRGLMPGLAFSNELISRDEGMHTDFA 296

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + ++        +        ++ EA  +E  +  + +P   +G+NA    QY++F
Sbjct: 297 CLLFSHLRR-------RPHPDTVERIIKEAVAIEQEFLTDALPVSLIGMNATLMCQYIEF 349

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +A+R    +G + L+  + NPF +M  +I L+ + NFFE RV++Y +   
Sbjct: 350 VADRLLVALGNKKLYN-STNPFDFMD-MISLQGKTNFFEKRVSDYSKAGV 397


>gi|146418573|ref|XP_001485252.1| hypothetical protein PGUG_02981 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390725|gb|EDK38883.1| hypothetical protein PGUG_02981 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 418

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 95/333 (28%), Positives = 157/333 (47%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L   +    + P+KY   W+ Y  A  + W   E+ +  D+  W   N L D+ER
Sbjct: 89  KEEPLLMENTRRFVMFPIKYHEIWKMYKKAEASFWTAEEIDLGKDMHDWN--NRLNDNER 146

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 147 YFISRILAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYI 206

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA+WAL++              D D  F + L  F  V 
Sbjct: 207 KDPKEADFLFNAIENIPCIKKKADWALRWIN------------DDDALFGERLVAFAAV- 253

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G++   + I RDE LH +F   + + ++          
Sbjct: 254 EGIFFSGSFASIFWLKKRGLMPGLSFSNELICRDEGLHTDFACLLFSHLQNRPDP----- 308

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    ++ EA  +E  +  + +P   +G+N     QY++F+A+R    +G + ++   
Sbjct: 309 --EIVEKIITEAVDIEKEFFTDALPISLLGMNCKLMCQYVEFVADRLLVALGNKKIYNVA 366

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 367 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 397


>gi|45184688|ref|NP_982406.1| AAL136Cp [Ashbya gossypii ATCC 10895]
 gi|44980034|gb|AAS50230.1| AAL136Cp [Ashbya gossypii ATCC 10895]
          Length = 422

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 97/337 (28%), Positives = 157/337 (46%), Gaps = 27/337 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +    ++ +L        L P+KY   W+ Y  A  + W   E+ +  D+  W   N +T
Sbjct: 91  KEQEKNEPLLMENKRRFVLFPIKYHDIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMT 148

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           ++ER  I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I
Sbjct: 149 ENERFFISRVLAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLI 208

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA WA+++ Q            D D  F + L  F
Sbjct: 209 DTYIKDPKEADHLFNAIETIPEIKEKAEWAIRWIQ------------DKDALFAERLVAF 256

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 257 AAV-EGIFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLNN----- 310

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K   +    ++ EA  +E  Y  + +P   +G+N+    QY++F+A+R    +G +  
Sbjct: 311 --KPDTEIVEKIITEAVEIEKRYFQDAIPVALLGMNSSLMNQYVEFVADRLLVALGNKKY 368

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +  + NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 369 YNVS-NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 403


>gi|294659365|ref|XP_461732.2| DEHA2G04268p [Debaryomyces hansenii CBS767]
 gi|199433907|emb|CAG90185.2| DEHA2G04268p [Debaryomyces hansenii]
          Length = 426

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 95/333 (28%), Positives = 155/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L   +    L P+KY   W+ Y  A  + W   E+ +  D   W     L ++ER
Sbjct: 100 KEEPLLIENTRRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLGKDTHDWNE--KLNNNER 157

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 158 YFISRILAFFAASDGIVNENLVENFSAEVQVPEAKCFYGFQIMMENIHSETYSLLIDTYI 217

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA+WAL++              D D  F + L  F  V 
Sbjct: 218 KDPKEADFLFNAIDNIPCIKKKADWALRWIN------------DDDALFGERLVAFAAV- 264

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + ++     +    
Sbjct: 265 EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLQNRPDAV---- 320

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  +  + +P   +G+N     QY++F+A+R    +G + ++  T
Sbjct: 321 ---IVERIITEAVTIEKEFFVDALPISLLGMNCNLMCQYVEFVADRLLVALGNKKVYNVT 377

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 378 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 408


>gi|293343290|ref|XP_002725449.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Rattus
           norvegicus]
 gi|293355176|ref|XP_002728627.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Rattus
           norvegicus]
          Length = 390

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 92/338 (27%), Positives = 157/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           + +++++ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L 
Sbjct: 65  KPSIEEEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALK 121

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 122 PDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLI 181

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P +  KA+WAL++                 +    +  V 
Sbjct: 182 DTYIKDSKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVA 228

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 229 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------ 282

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +
Sbjct: 283 -HKPSEQRVKEIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKI 341

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           FK  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 342 FKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|118089009|ref|XP_001231545.1| PREDICTED: similar to small subunit ribonucleotide reductase
           isoform 1 [Gallus gallus]
          Length = 392

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 91/352 (25%), Positives = 162/352 (46%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           +  T ++ +   +     +++ +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 53  SEGTPVTALCPPQVARGAEEEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDL 112

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W+S   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q 
Sbjct: 113 SKDLQHWES---LKPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQI 169

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS  +  +I +   D  E   LFN    +P +  KA+WA+++             
Sbjct: 170 AMENIHSEMYSLLIDTYIKDSKEREFLFNAIETLPCVKKKADWAIRWIG----------- 218

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
               +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 219 --DKKATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA 276

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +   +         K  +++ + ++  A L+E  +  E +P   +G+N    +QY++F
Sbjct: 277 CLMFKHLIR-------KPSEERVKEIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEF 329

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R   ++G   ++K  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 330 VADRLMLELGFRKIYKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 379


>gi|7106399|ref|NP_033130.1| ribonucleoside-diphosphate reductase subunit M2 [Mus musculus]
 gi|132626|sp|P11157|RIR2_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|22218698|pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|22218699|pdb|1H0O|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|52696260|pdb|1W68|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Oxidizing Conditions. A Fully Occupied
           Dinuclear Iron Cluster.
 gi|52696261|pdb|1W69|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Reducing Conditions. A Fully Occupied
           Dinuclear Iron Cluster And Bound Acetate.
 gi|157834262|pdb|1XSM|A Chain A, Protein R2 Of Ribonucleotide Reductase From Mouse
 gi|50720|emb|CAA33707.1| M2 ribonucleotide reductase [Mus musculus]
 gi|200768|gb|AAA40062.1| ribonucleotide reductase subunit M2 [Mus musculus]
 gi|26354034|dbj|BAC40647.1| unnamed protein product [Mus musculus]
 gi|54887418|gb|AAH85136.1| Ribonucleotide reductase M2 [Mus musculus]
 gi|74139292|dbj|BAE40793.1| unnamed protein product [Mus musculus]
 gi|74151119|dbj|BAE27683.1| unnamed protein product [Mus musculus]
 gi|74179887|dbj|BAE36508.1| unnamed protein product [Mus musculus]
 gi|74188932|dbj|BAE39238.1| unnamed protein product [Mus musculus]
 gi|74189151|dbj|BAE39331.1| unnamed protein product [Mus musculus]
 gi|74206394|dbj|BAE24918.1| unnamed protein product [Mus musculus]
 gi|74211991|dbj|BAE40165.1| unnamed protein product [Mus musculus]
          Length = 390

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 94/338 (27%), Positives = 156/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
             +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L 
Sbjct: 65  NPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALK 121

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 122 PDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLI 181

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P +  KA+WAL++                 +    +  V 
Sbjct: 182 DTYIKDPKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVA 228

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 229 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------ 282

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +
Sbjct: 283 -HKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKI 341

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           F+  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 342 FRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|289177074|ref|NP_001165948.1| ribonucleoside-diphosphate reductase subunit M2 B isoform 2 [Homo
           sapiens]
          Length = 423

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 99/349 (28%), Positives = 163/349 (46%), Gaps = 28/349 (8%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
             G S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  
Sbjct: 86  QAGRSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSK 145

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           DL  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   
Sbjct: 146 DLPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILI 202

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E VHS  +  +I +   D  +   LFN    +P +  KA+WAL++               
Sbjct: 203 ENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA------------- 249

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
             +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 250 DRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACL 309

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +   +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A
Sbjct: 310 MFQYLVN-------KPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVA 362

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +R   ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 363 DRLLVELGFSKVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 409


>gi|328855581|gb|EGG04707.1| hypothetical protein MELLADRAFT_49061 [Melampsora larici-populina
           98AG31]
          Length = 385

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 93/344 (27%), Positives = 157/344 (45%), Gaps = 28/344 (8%)

Query: 11  QAGEKRVNVD-DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
             G   +  D ++ +L        L P+KY   W  Y  A  + W   E+ +  D+  W+
Sbjct: 41  FVGNPDITCDAEEPLLKEDGHRFVLFPIKYHEIWASYKRAEASFWTAEEIDLSKDMHDWE 100

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDE+  IK  L FFA+S+ +V  N++      +   E R +   Q   E +HS 
Sbjct: 101 --NRLNDDEKHFIKHVLAFFAASDGIVNENLIERFSGEVQAAEARCFYGFQIMMENIHSE 158

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   +  E   LF+    +P I  KA+WAL++              D    F 
Sbjct: 159 VYSLLIDTYVREPIERSHLFDAIDTIPCIRKKADWALKWI------------SDKQSTFG 206

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + ++
Sbjct: 207 ERLIAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLE 265

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +      + ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 266 R-------RPHPDTVQAIISQAVEIEKEFLSDALPCKLIGMNADLMCQYIEFVADRLLVA 318

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G +  +   ENPF +M E+I L  + NFFE RV++Y +   + 
Sbjct: 319 LGNDKFYN-AENPFDFM-EMISLSGKTNFFEKRVSDYAKAGVMT 360


>gi|301772278|ref|XP_002921557.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Ailuropoda melanoleuca]
          Length = 393

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 94/337 (27%), Positives = 157/337 (46%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  
Sbjct: 69  PSVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKP 125

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 126 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 185

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++                 +    +  V +
Sbjct: 186 TYIKDSKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAF 232

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 233 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------- 285

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 286 HKPSEQRVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVF 345

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 346 RV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 380


>gi|71043760|ref|NP_001020911.1| ribonucleoside-diphosphate reductase subunit M2 [Rattus norvegicus]
 gi|77416595|sp|Q4KLN6|RIR2_RAT RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|68533806|gb|AAH99082.1| Ribonucleotide reductase M2 [Rattus norvegicus]
 gi|149051013|gb|EDM03186.1| rCG61374 [Rattus norvegicus]
          Length = 390

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 91/338 (26%), Positives = 157/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           + +++++ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L 
Sbjct: 65  KPSIEEEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALK 121

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 122 PDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLI 181

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P +  KA+WAL++                 +    +  V 
Sbjct: 182 DTYIKDSKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVA 228

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 229 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------ 282

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +Q+ + ++  +  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +
Sbjct: 283 -HKPSEQRVKEIITNSVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKI 341

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           FK  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 342 FKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|149728153|ref|XP_001502384.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase subunit
           M2 (Ribonucleotide reductase small subunit)
           (Ribonucleotide reductase small chain) [Equus caballus]
          Length = 425

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 92/337 (27%), Positives = 156/337 (46%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L  
Sbjct: 101 PSVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALKP 157

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 158 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 217

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++                 +    +  V +
Sbjct: 218 TYIKDSKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAF 264

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 265 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------- 317

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 318 HKPSEQRVKEIIINAVRIEQEFLTEALPVRLIGMNCALMKQYIEFVADRLLLELGFNKVF 377

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 378 RV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 412


>gi|312381384|gb|EFR27142.1| hypothetical protein AND_06323 [Anopheles darlingi]
          Length = 390

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 91/349 (26%), Positives = 161/349 (46%), Gaps = 29/349 (8%)

Query: 4   NTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD 63
           +T LS ++  E+  +   + +L        + P++Y   W+ Y  A  + W   EV +  
Sbjct: 54  STALSEVE-PEQPFDPSIEPLLMDNPRRFVIFPIQYPDIWQMYKKAEASFWTVEEVDLSK 112

Query: 64  DLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFE 123
           D+  W   + L   ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   
Sbjct: 113 DMKDW---DSLKPSERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAM 169

Query: 124 EAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           E VHS  +  +I +   D  E   LFN    +P +  KA+WA+ +  +            
Sbjct: 170 ENVHSEMYSLLIDTYIRDPKERDFLFNAIETLPCVKRKADWAMNWISS------------ 217

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
             +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   
Sbjct: 218 -KKANYGERIVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACL 276

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIA 300
           +   +         K  +++   ++ +A ++E  +  + +P   +G+N     QY++F+A
Sbjct: 277 MFKYLVQ-------KPSRKRVTDIIRDAVMIEQEFLTKALPVDMLGMNCELMSQYIEFVA 329

Query: 301 NRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +R   ++G E ++  T+NPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 330 DRLLVELGCEKVYN-TKNPFSFM-EFISLEGKTNFFEKKVGEYQKWGVM 376


>gi|296421312|ref|XP_002840209.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636423|emb|CAZ84400.1| unnamed protein product [Tuber melanosporum]
          Length = 397

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 100/332 (30%), Positives = 159/332 (47%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           D+ +L        L P+KY   W+ Y  A  + W+  E+ +  D+  W   + L DDER 
Sbjct: 66  DEPILTENKHRFVLFPIKYHEIWQMYKKAEASFWVAEEIDLSKDMHDW--SDRLNDDERY 123

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+V      +  PE R +   Q   E VHS T+  +I +   
Sbjct: 124 FISHVLAFFAASDGIVNENLVQRFSNEVQIPEARCFYGFQIMMENVHSETYSLLIDTYIK 183

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  +   LF+    +P I  KA+WA+++ +            D +  F Q L  F  V E
Sbjct: 184 DPKQRTYLFDAIDTIPCIKKKADWAIRWIE------------DRNSTFAQRLVAFAAV-E 230

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G++   + I RDE LH +F   + N +         +  
Sbjct: 231 GIFFSGSFASIFWLKKRGLMPGLSFSNELISRDEGLHTDFACLLFNHLNN-------RPS 283

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           QQ  + ++ EA  +E  +  E +P   +G+N+   +QY++F+A+R    +G    +  T 
Sbjct: 284 QQAVQDIIVEAVGIEQEFLTEALPCALLGMNSKLMKQYIEFVADRLLLSLGNPKFYNAT- 342

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV +YQ+   +
Sbjct: 343 NPFDFM-ESISLAGKTNFFEKRVGDYQKAGVM 373


>gi|74207686|dbj|BAE40088.1| unnamed protein product [Mus musculus]
          Length = 390

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 93/338 (27%), Positives = 156/338 (46%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
             +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L 
Sbjct: 65  NPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALK 121

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 122 PDERHFISHALAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLI 181

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P +  KA+WAL++                 +    +  + 
Sbjct: 182 DTYIKDPKEREYLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVMA 228

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +       
Sbjct: 229 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------ 282

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +
Sbjct: 283 -HKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKI 341

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           F+  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 342 FRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|164659270|ref|XP_001730759.1| hypothetical protein MGL_1758 [Malassezia globosa CBS 7966]
 gi|159104657|gb|EDP43545.1| hypothetical protein MGL_1758 [Malassezia globosa CBS 7966]
          Length = 397

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 95/345 (27%), Positives = 156/345 (45%), Gaps = 27/345 (7%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             GE  +  +++ +L        L P++Y   W+ Y  A  + W   E+ +  DL  W  
Sbjct: 60  FVGEVDLPEEEEPILKENKGRFVLFPIRYHEIWQMYKKAEASFWTAEEIDLSKDLYDWD- 118

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N +TD ER  +   L FFA+S+ +V  N+V      +   E R +   Q   E +HS T
Sbjct: 119 -NRMTDPERHFVSHVLAFFAASDGIVNENLVERFSAEVQATEARCFYGFQIMMENIHSET 177

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   +      LFN    VP +  KA+WAL++              D    F +
Sbjct: 178 YSLLIDTYIREPERRDFLFNAIETVPVVKQKADWALRWI------------SDHRASFSE 225

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G++   + I RDE LH +F   + + +K 
Sbjct: 226 RLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLSFSNELISRDEGLHTDFACLLFSHLKK 284

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +
Sbjct: 285 -------RAHPDTVNRIITEAVDIEQDFLTDALPVSLIGMNARLMCQYIEFVADRLLVAL 337

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           G    +  + NPF +M E I L+ + NFFE RV +Y +    + D
Sbjct: 338 GNPKHYN-STNPFDFM-ENISLQGKSNFFERRVGDYAKAGVARAD 380


>gi|320164906|gb|EFW41805.1| ribonucleotide reductase m2 polypeptide [Capsaspora owczarzaki ATCC
           30864]
          Length = 352

 Score =  272 bits (695), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 96/349 (27%), Positives = 154/349 (44%), Gaps = 29/349 (8%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           T    +  G  ++ + D+ +L        L P++Y   W+ Y  A  + W   EV +  D
Sbjct: 17  TAEEALVNGLSKLEL-DEPLLKPNPHRFVLFPIQYHDVWKMYKKAEASFWTAEEVDLSKD 75

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           L  W   + L  +ER  I   L FFA+S+ +V  N++L     +  PE R +   Q   E
Sbjct: 76  LNDW---DKLKSEERHFISHVLAFFAASDGIVNENLLLRFSTEVQIPEVRSFYCFQIAIE 132

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            +HS  +  +I     D  E   LFN    +P +  KA WAL++              D 
Sbjct: 133 NIHSEMYSLLIDMYIKDSAEREKLFNAIETLPCVAKKAQWALRWI------------SDR 180

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
              F   L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 181 RSTFAHRLIAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACML 239

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
              +     +            ++ +A  +E  +  + +P   +G+N    + Y++F+A+
Sbjct: 240 FGLLNNRPSN-------ADVLAIIKDAVAIEQEFLTDALPVALIGMNGGLMKTYIEFVAD 292

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           R    +G E  +K  ENPF +M  +I L+ + NFFE RV EYQ+   + 
Sbjct: 293 RLLVALGQEKHYKV-ENPFDFMD-LISLQGKTNFFERRVGEYQKPGVMS 339


>gi|115466138|ref|NP_001056668.1| Os06g0127900 [Oryza sativa Japonica Group]
 gi|55296211|dbj|BAD67929.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|113594708|dbj|BAF18582.1| Os06g0127900 [Oryza sativa Japonica Group]
 gi|186920368|gb|ACC95437.1| ribonucleotide diphosphate reductase small subunit 2 [Oryza sativa
           Japonica Group]
 gi|215706414|dbj|BAG93270.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222634884|gb|EEE65016.1| hypothetical protein OsJ_19968 [Oryza sativa Japonica Group]
          Length = 345

 Score =  272 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 87/333 (26%), Positives = 155/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   SD   + P++Y   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 20  EEPLLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 77

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            +   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 78  FVSHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 137

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D+ E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 138 DDVEKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 183

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 184 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 236

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++    
Sbjct: 237 ESRVQEIVADAVDIEREFVCDALPVALVGMNGELMSQYIEFVADRLLMALGCKKMYNVA- 295

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 296 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMS 327


>gi|73979721|ref|XP_540076.2| PREDICTED: similar to Ribonucleoside-diphosphate reductase M2 chain
           (Ribonucleotide reductase small chain) isoform 1 [Canis
           familiaris]
          Length = 394

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 91/337 (27%), Positives = 156/337 (46%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            + +++ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  
Sbjct: 70  PSAEEEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKP 126

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 127 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 186

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++                 +    +  V +
Sbjct: 187 TYIKDSKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAF 233

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 234 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------- 286

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 287 HKPSEQRVKEIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVF 346

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 347 RV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 381


>gi|225451453|ref|XP_002269951.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147804660|emb|CAN64484.1| hypothetical protein VITISV_012640 [Vitis vinifera]
          Length = 329

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 88/333 (26%), Positives = 156/333 (46%), Gaps = 29/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  D   W+    LT DE+ 
Sbjct: 6   EEPLLAPNPDRFCMFPIQYPEVWEMYKKAEASFWTAEEVDLSQDQRQWE---NLTSDEKH 62

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ S   
Sbjct: 63  FISHILAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLESYIK 122

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF+    +P +  KA WAL++              D  + F + L   +   E
Sbjct: 123 DPKEKNRLFHAIDTIPCVAKKAQWALRWI-------------DGSETFAERLLA-FACVE 168

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 169 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRNKLS------- 221

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ ++  +E  +  + +P   VG+N+    QY++F+A+R    +G   ++  + 
Sbjct: 222 EERVKAIVADSVDIEREFVCDALPCALVGMNSALMSQYIEFVADRLLGALGYGKMYNVS- 280

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 281 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 312


>gi|218197485|gb|EEC79912.1| hypothetical protein OsI_21460 [Oryza sativa Indica Group]
          Length = 345

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 87/333 (26%), Positives = 154/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   SD   + P++Y   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 20  EEPLLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 77

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            +   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 78  FVSHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 137

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 138 DGAEKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 183

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 184 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 236

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++    
Sbjct: 237 ESRVQEIVADAVDIEREFVCDALPVALVGMNGELMSQYIEFVADRLLMALGCKKMYNVA- 295

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 296 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMS 327


>gi|170089003|ref|XP_001875724.1| ribonucleotide reductase, beta subunit [Laccaria bicolor S238N-H82]
 gi|164648984|gb|EDR13226.1| ribonucleotide reductase, beta subunit [Laccaria bicolor S238N-H82]
          Length = 422

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 92/340 (27%), Positives = 156/340 (45%), Gaps = 27/340 (7%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             GE  +   ++ +L        L P++Y   W+ Y  A  + W   E+ +  DL  W  
Sbjct: 75  FVGEVDLPESEEPLLKESKRRFVLFPIQYNEIWQMYKKAEASFWTAEEMDLSKDLHDWN- 133

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N + D+ER  I   L FFA+S+ +V  N++      +   E R +   Q   E +HS T
Sbjct: 134 -NRMNDNERHFISHVLAFFAASDGIVNENLLERFSNEVQAAEARCFYGFQIMMENIHSET 192

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I S   D  +   LF+    +P I  KA WAL++              D +  F +
Sbjct: 193 YSLLIDSYIKDPAQREYLFDAIETIPCIKRKAEWALKWI------------SDQESTFAE 240

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  + +   M G+    + I RDE +H +F   + + +K 
Sbjct: 241 RLVAFAAV-EGIFFSGSFASIFWMKKRGLMPGLTFSNELISRDEGMHTDFACLLFSHLKR 299

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +   +  + ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +
Sbjct: 300 -------RPHPEVVKHIIVEAVKIEQEFLTDALPVKLIGMNADLMCQYIEFVADRLLVSL 352

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 347
           G E  +    NPF +M  +I L+ + NFFE RV++Y +  
Sbjct: 353 GNEKHYN-KTNPFDFMD-MISLQGKTNFFEKRVSDYSKAG 390


>gi|76630259|ref|XP_584910.2| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|297480610|ref|XP_002691527.1| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|296482361|gb|DAA24476.1| ribonucleotide reductase M2 polypeptide isoform 1 [Bos taurus]
          Length = 389

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 92/337 (27%), Positives = 155/337 (45%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L  
Sbjct: 65  PSVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE---ALKS 121

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 122 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 181

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++                      +  V +
Sbjct: 182 TYIKDSKEREFLFNAIETMPCVKKKADWALRWIG-------------DKAATYGERVVAF 228

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 229 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 281

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 282 HKPSEQRVKEIIVNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVF 341

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 342 RV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 376


>gi|50311465|ref|XP_455757.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644893|emb|CAG98465.1| KLLA0F15103p [Kluyveromyces lactis]
          Length = 401

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 102/333 (30%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L        L P+KY   WE Y  A  + W   E+ +  DL  W   N + ++ER
Sbjct: 74  KDEPLLVENKRRFVLFPIKYHEIWEAYKRAEASFWTAEEIDLSKDLHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRILAFFAASDGIVNENLVENFSAEVQAPEAKCFYGFQIMMENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WA+++ Q            D D  F + L  F  V 
Sbjct: 192 KDPKESEFLFNAIETIPQIKEKAEWAIRWIQ------------DDDALFGERLVAFAAV- 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPNP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R    +G +  F  T
Sbjct: 294 --EIVEKIITEAVEIEKRYFMDALPVSLLGMNADLMNQYVEFVADRLLVALGNKKYFNVT 351

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 352 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVI 382


>gi|297805560|ref|XP_002870664.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297316500|gb|EFH46923.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 333

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 156/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  D   W+  N L++DER 
Sbjct: 6   EEPILTPTPDRFCMFPIQYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NSLSNDERH 63

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 64  FIKHVLAFFAASDGIVLENLSTRFMSDVQISEARAFYGFQIAIENIHSEMYSLLLDTYIK 123

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     +P +T KA WA+++     S                +  V +   E
Sbjct: 124 DNKERDHLFRAIETIPCVTKKAEWAMKWINGSQS--------------FAERIVAFACVE 169

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 170 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLRTKLD------- 222

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ ++++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  + 
Sbjct: 223 EERLKSIVCDAVEIEREFVCDALPCALVGMNRELMSQYIEFVADRLLTALGCGKVYGVS- 281

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 282 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 313


>gi|316971821|gb|EFV55552.1| ribonucleotide reductase R2 subunit [Trichinella spiralis]
          Length = 366

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 98/347 (28%), Positives = 163/347 (46%), Gaps = 28/347 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           +P++     ++  ++ +L +      LLPL+Y   W  Y  A  + W   EV ++ D   
Sbjct: 33  TPMEQDAAAIDNCEEPLLRSNPKRFVLLPLEYPDIWAMYKKAEASFWTVEEVDLRKDAND 92

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W     L  DE+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VH
Sbjct: 93  W---AKLNKDEKHFISHVLAFFAASDGIVFENLVERFSQEIQVTEARFFYGFQIAIENVH 149

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL++              D    
Sbjct: 150 SEMYSLLIDTYIRDPVERDFLFNAIETIPCVKKKADWALRWI------------GDRQSP 197

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + 
Sbjct: 198 FCERLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSH 256

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +K        K  + + R ++ EA  +E  +  + +P   +G+N     QY++++A+R  
Sbjct: 257 LKK-------KPTEDRVRQIITEAVSIEQEFLTDALPVRLIGMNCVLMSQYIEYVADRLL 309

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            ++G   ++  +ENPF +M E+I L+ + NFFE RV EYQ+   +  
Sbjct: 310 VELGCSKVYN-SENPFDFM-EMISLEGKTNFFEKRVGEYQKAGVMAD 354


>gi|1710401|sp|P49730|RIR2_TOBAC RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleoside-diphosphate reductase R2
           subunit; AltName: Full=Ribonucleotide reductase small
           subunit
 gi|1044912|emb|CAA63194.1| ribonucleotide reductase R2 [Nicotiana tabacum]
          Length = 329

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 155/333 (46%), Gaps = 29/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L +  D   + P++Y   WE Y  A  + W   EV +  D   W++   LT  ER 
Sbjct: 6   EEPLLASSPDRFCMFPIQYPQIWEMYKKALASFWTAEEVDLSSDTRHWET---LTPGERH 62

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+     + +   E R +   Q   E +HS  +  ++ S   
Sbjct: 63  FITHVLAFFAASDGIVLENLAGRFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLESYIK 122

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF      P +  KA WAL++              D  + F + L   +   E
Sbjct: 123 DSDEKSRLFRAVETNPCVEKKAKWALRWI-------------DGSETFAERLVA-FACVE 168

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 169 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRTKL-------T 221

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ +A  +E  +  + +P   VG+N     +Y++F+A+R    +G + L+   +
Sbjct: 222 EERVKGIVADAVEIEREFVCDALPCALVGMNGDLMSKYIEFVADRLLDALGYDKLYN-AQ 280

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 281 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 312


>gi|148230557|ref|NP_001080772.1| ribonucleotide reductase M2 polypeptide [Xenopus laevis]
 gi|28839018|gb|AAH47975.1| Rrm2-prov protein [Xenopus laevis]
          Length = 386

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 95/346 (27%), Positives = 156/346 (45%), Gaps = 28/346 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           +P     K     D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  
Sbjct: 53  TPTSKVPKNPRFTDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDIQH 112

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W+S   L  DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +H
Sbjct: 113 WES---LKTDERYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIH 169

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL++                 Q 
Sbjct: 170 SEMYSLLIDTYIKDPKERGFLFNAIETLPCVKKKADWALRWI-------------SDKQA 216

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 217 TYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFRH 276

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +         K  +++   ++  A  +E  +  E +P   +G+N    +QY++F+A+R  
Sbjct: 277 LV-------HKPSEERVVQLITNAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLL 329

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++G   +FK + NPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 330 LELGFNKVFKAS-NPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 373


>gi|77748199|gb|AAI06683.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 96/334 (28%), Positives = 161/334 (48%), Gaps = 28/334 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W++   L  +E
Sbjct: 84  IQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWET---LKPEE 140

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 141 RYFISYVLAFFAASDGIVNENLVERFSQEVQVTEVRCFYGFQIAMENIHSEMYSLLIDTY 200

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA W+L++              D +  + + L  F  V
Sbjct: 201 IKDPKEREFLFNAIETLPCVKKKAEWSLRWI------------SDREAPYCERLVAFAAV 248

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 249 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVV-------HK 300

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + +FK 
Sbjct: 301 PSEQRVREIIIDAVKIEQEFLIEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK- 359

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +ENPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 360 SENPFDFM-ENISLEGKTNFFEKKVGEYQKMGVM 392


>gi|331245491|ref|XP_003335382.1| ribonucleoside-diphosphate reductase subunit M2 [Puccinia graminis
           f. sp. tritici CRL 75-36-700-3]
 gi|309314372|gb|EFP90963.1| ribonucleoside-diphosphate reductase subunit M2 [Puccinia graminis
           f. sp. tritici CRL 75-36-700-3]
          Length = 380

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/334 (27%), Positives = 150/334 (44%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           D + +L        L P+KY   W  Y  A  + W   E+ +  D+  W   N L  DE+
Sbjct: 46  DQEPLLKEDGHRFVLFPIKYHEIWASYKRAEASFWTAEEIDLSKDMHDWD--NKLNADEK 103

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             IK  L FFA+S+ +V  N++      +   E R +   Q   E +HS  +  +I +  
Sbjct: 104 HFIKHVLAFFAASDGIVNENLIERFSGEVQVAEARCFYGFQIMMENIHSEVYSLLIDTYV 163

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            +  E   LF+    +P I  KA+WAL +              D    F + L  F  V 
Sbjct: 164 REPTERAHLFDAIDTIPCIRKKADWALTWI------------SDKKSTFGERLIAFAAV- 210

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   ++        + 
Sbjct: 211 EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFTHLER-------RP 263

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                + ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G E  +  T
Sbjct: 264 HPDTVQAIIAQAVEIEKEFLSDALPCKLIGMNADLMCQYIEFVADRLLVALGNEKFYNAT 323

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E+I L  + NFFE RV++Y +   + 
Sbjct: 324 -NPFDFM-EMISLSGKTNFFEKRVSDYAKAGVMT 355


>gi|168031987|ref|XP_001768501.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680214|gb|EDQ66652.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 331

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 152/334 (45%), Gaps = 29/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
             + +L    +   + P+KY   WE Y  A  + W   EV +  D   W++   LTDDER
Sbjct: 6   QKEPILVENPNRFTMFPIKYPQVWEMYKKAEASFWTAEEVDLSADSKHWET---LTDDER 62

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  ++ +  
Sbjct: 63  HFISHVLAFFAASDGIVLENLAVRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLEAYI 122

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D+ E   LFN    +P +  KA+WAL++  +  S                +  + +   
Sbjct: 123 KDQAEKSRLFNAIETIPCVARKADWALKWIDSAGS--------------FAERILAFACV 168

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +F   +   +  +        
Sbjct: 169 EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLINKLS------ 222

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            +++   ++ EA  +E  +  E +    VG+N     +Y+ F+A+R    +G    +   
Sbjct: 223 -EERVYEIVCEAVEIEREFVCEALSCDLVGMNKILMSEYIDFVADRLLVSLGYRKKYN-A 280

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 281 LNPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 313


>gi|929959|gb|AAA74020.1| ribonuleotide reductase small subunit [Urechis caupo]
          Length = 399

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 88/334 (26%), Positives = 156/334 (46%), Gaps = 28/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +++ +L        + P++Y   W+ Y  A  + W   EV +  D++ W+    L  +E+
Sbjct: 75  EEEPLLRDNPRRFVVFPIQYNDIWQMYKKAEASFWTAEEVDLSKDISDWE---KLKSEEK 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             +   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +  
Sbjct: 132 HFVSHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGYQIAVENIHSEMYSLLIDTYV 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P +  KA+WAL++                +Q    +  V +   
Sbjct: 192 KDPTERDFLFNAIETMPCVKEKADWALRWIN-------------DEQSSFGERVVAFAAV 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K        K 
Sbjct: 239 EGIFFSGSFASIFWLKKRGVMPGLTFSNELISRDEGLHCDFACLMFSHLKN-------KP 291

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            Q++   ++ +A  +E ++  E +P   +G+N     QY++F+A+R   ++G   ++   
Sbjct: 292 SQERVYDIIRDAVRIEQSFLTEALPVNLIGMNCKLMAQYIEFVADRLLLELGCPKIWNV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M   I L+ + NFFE RV EYQ+   + 
Sbjct: 351 ENPFDFMD-NISLEGKTNFFEKRVGEYQKMGVMS 383


>gi|149248382|ref|XP_001528578.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146448532|gb|EDK42920.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 422

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 93/333 (27%), Positives = 155/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L        + P++Y   W+ Y  A  + W   E+ +  D+  WK  N L ++ER
Sbjct: 97  KDEPLLKENKRRYVMFPIRYHEIWQMYKKAEASFWTAEEIDLGKDMHDWK--NKLNENER 154

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 155 FFISRILAFFAASDGIVNENLVENFSAEVQIPEAKSFYGFQIMMENIHSETYSLLIDTYI 214

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA+WA+++                D     +  V +   
Sbjct: 215 KDPKEADFLFNAIDNIPQIKKKADWAIRWIN-------------DDNALFAERLVAFAAV 261

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + ++          
Sbjct: 262 EGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLENRPDP----- 316

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    ++ EA  +E  +  + +P   +G+N     QY++F+A+R    +G E ++K T
Sbjct: 317 --KIVEKIISEAVEIEKEFFTDALPVSLLGMNCKLMCQYVEFVADRLLVALGNEKIYKVT 374

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 375 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 405


>gi|118089007|ref|XP_419948.2| PREDICTED: similar to small subunit ribonucleotide reductase
           isoform 2 [Gallus gallus]
          Length = 384

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 90/335 (26%), Positives = 156/335 (46%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
            +++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  +E
Sbjct: 62  AEEEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKPEE 118

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 119 KYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTY 178

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WA+++                 +    +  V +  
Sbjct: 179 IKDSKEREFLFNAIETLPCVKKKADWAIRWIG-------------DKKATYGERVVAFAA 225

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 226 VEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIR-------K 278

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ + ++  A L+E  +  E +P   +G+N    +QY++F+A+R   ++G   ++K 
Sbjct: 279 PSEERVKEIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFRKIYKV 338

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 339 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 371


>gi|110763195|ref|XP_397443.3| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 isoform
           1 [Apis mellifera]
          Length = 384

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 89/352 (25%), Positives = 158/352 (44%), Gaps = 28/352 (7%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           N   +  +   E + N + + +L        + P+++   W+ Y  A  + W   EV + 
Sbjct: 46  NTKAIQNMYLKENKFNPELEPLLKENPRRFVVFPIQWPDIWQMYKKAEASFWTVEEVDLS 105

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+  W   N LT  E+  I   L FFA+S+ +V  N+V    + +   E R +   Q  
Sbjct: 106 KDVFDW---NNLTASEKHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQVA 162

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS  +  +I +   D  E   LFN    +P +  KA+WAL +              
Sbjct: 163 MENVHSEMYSLLIDTYIADAKERDFLFNAIENLPCVAKKAHWALNWIN------------ 210

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
             +     +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 211 -HESATFPERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 269

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   I  +          ++  +++ +A  +E  +  + +P   +G+N     QY++F+
Sbjct: 270 LMFKHIVQKPSC-------ERVTSIIKDAVKIEQEFLTDALPVEMIGMNCKLMCQYIEFV 322

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           A+R   ++G + ++  +ENPF +M   I L+ + NFFE +V EYQ+   ++ 
Sbjct: 323 ADRLLVELGCKKIY-MSENPFDFMEH-ISLEGKTNFFEKKVGEYQKWGVMQD 372


>gi|15232077|ref|NP_189342.1| TSO2 (TSO meaning 'ugly' in Chinese); oxidoreductase/
           ribonucleoside-diphosphate reductase/ transition metal
           ion binding [Arabidopsis thaliana]
 gi|75273949|sp|Q9LSD0|RIR2C_ARATH RecName: Full=Ribonucleoside-diphosphate reductase small chain C;
           AltName: Full=Ribonucleoside-diphosphate reductase TSO2
           subunit; AltName: Full=Ribonucleotide reductase small
           subunit C
 gi|9279629|dbj|BAB01087.1| ribonucleotide reductase [Arabidopsis thaliana]
 gi|17380726|gb|AAL36193.1| putative ribonucleotide reductase small subunit [Arabidopsis
           thaliana]
 gi|21436297|gb|AAM51287.1| putative ribonucleotide reductase small subunit [Arabidopsis
           thaliana]
 gi|332643740|gb|AEE77261.1| Ribonucleoside-diphosphate reductase small chain C [Arabidopsis
           thaliana]
          Length = 332

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 151/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+ Y   WE Y  A  + W   EV +  D   W+  N L D ER 
Sbjct: 6   EEPLLTPTPDRFCMFPIHYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NSLNDGERH 63

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 64  FIKHVLAFFAASDGIVLENLASRFMSDVQVSEARAFYGFQIAIENIHSEMYSLLLDTYIK 123

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     +P +  KA WA+++                  +   +  + +   E
Sbjct: 124 DNKERDHLFRAIETIPCVAKKAQWAMKWIDG--------------SQTFAERIIAFACVE 169

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +          L TK  
Sbjct: 170 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYT-------LLKTKLS 222

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ ++++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  T 
Sbjct: 223 EERVKSIVCDAVEIEREFVCDALPCALVGMNRDLMSQYIEFVADRLLGALGYGKVYGVT- 281

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 282 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMS 313


>gi|320580024|gb|EFW94247.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia angusta DL-1]
          Length = 408

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 97/333 (29%), Positives = 152/333 (45%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L D+ER
Sbjct: 80  KDEPLLVENKRRFVLFPIKYHEIWQMYKKAEASFWTAEEIDLSKDLHDWN--NRLNDNER 137

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             + R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 138 YFVSRVLAFFAASDGIVNENLVENFSAEVQVPEAKCFYGFQIMMENIHSETYSLLIDTYV 197

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WA+++              D +  F + L  F  V 
Sbjct: 198 KDPKEAEFLFNAIETIPCIKEKAEWAMRWIN------------DEEALFAERLVAFAAV- 244

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + +           
Sbjct: 245 EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLNN-------TP 297

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G +  +  T
Sbjct: 298 NNDIVLKIITEAVDIEKRYFTDALPVNLLGMNCSLMCQYVEFVADRLLLSLGCKKHYNAT 357

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 358 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 388


>gi|50286273|ref|XP_445565.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524870|emb|CAG58476.1| unnamed protein product [Candida glabrata]
          Length = 400

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 99/334 (29%), Positives = 155/334 (46%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +LN   D   L P+KY   W+ Y  A  + W   E+ +  DL  W   N L ++ER
Sbjct: 74  KDEPLLNDDPDRLTLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLHDWN--NRLNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V         PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEAVIPEAKAFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++              +++  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWI------------ANSEALFAERLVA-FAAI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K 
Sbjct: 239 EGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFAHLN-------HKP 291

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +    ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G + ++   
Sbjct: 292 DPEVVERIVTEAVEIEQRYFLDALPVALLGMNAQLMNQYVEFVADRLLVAFGNKKVYNV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|148232385|ref|NP_001085389.1| ribonucleotide reductase M2, gene 1 [Xenopus laevis]
 gi|48735122|gb|AAH72071.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 96/334 (28%), Positives = 161/334 (48%), Gaps = 28/334 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W++   L  +E
Sbjct: 84  IQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWET---LKPEE 140

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 141 RYFIAYVLAFFAASDGIVNENLVERFSQEVQVTEVRCFYGFQIAMENIHSEMYSLLIDTY 200

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA W+L++              D +  + + L  F  V
Sbjct: 201 IKDPKEREFLFNAIETLPCVKKKAEWSLRWI------------SDREAPYCERLVAFAAV 248

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 249 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVV-------HK 300

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + +FK 
Sbjct: 301 PSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK- 359

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +ENPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 360 SENPFDFM-ENISLEGKTNFFEKKVGEYQKMGVM 392


>gi|75224904|sp|Q6Y657|RIR2B_ARATH RecName: Full=Putative ribonucleoside-diphosphate reductase small
           chain B; AltName: Full=Ribonucleoside-diphosphate
           reductase R2B subunit; AltName: Full=Ribonucleotide
           reductase small subunit B
 gi|37729626|gb|AAO62422.1| ribonucleotide reductase small subunit [Arabidopsis thaliana]
          Length = 333

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 90/333 (27%), Positives = 154/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P++Y   WE Y  A  + W   EV +  D   W+  N LT+DER 
Sbjct: 6   EEPILTPTPDRFCMFPIQYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NSLTNDERH 63

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 64  FIKHVLAFFAASDGIVLENLSTRFMSDVQISEARAFYGFQIAIENIHSEMYSLLLDTYIK 123

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     +P +T KA WA+++     S                +  V +   E
Sbjct: 124 DNKERDHLFRAIETIPCVTKKAEWAMKWINGSQS--------------FAERIVAFACVE 169

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 170 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLIYSLLRTKLD------- 222

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + + ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  + 
Sbjct: 223 EDRLKAIVCDAVEIEREFVCDALPCALVGMNRELMSQYIEFVADRLLAALGCAKVYGVS- 281

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 282 NPFDWM-ELISLQGKTNFFEKRVGEYQKASIMS 313


>gi|326437649|gb|EGD83219.1| ribonucleotide reductase M2 B [Salpingoeca sp. ATCC 50818]
          Length = 408

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 90/337 (26%), Positives = 160/337 (47%), Gaps = 28/337 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
              +  + +L        +LP+++   W  Y  A  + W   EV +  DL  W+   GL 
Sbjct: 80  DEEIAAEPLLRENPSRFVILPIQHRQVWSMYKKAVASFWTAEEVDLSRDLDHWR---GLK 136

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           D E+  IK  L FFA+S+ +V  N+V      +  PE R +   Q   E +HS  +  +I
Sbjct: 137 DTEQHFIKHVLAFFAASDGIVNENLVERFMCEVQLPEARCFYGFQIMIENIHSEMYSLLI 196

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P++  KA WA+++              D  +    +  V 
Sbjct: 197 DTYINDPQEKHMLFNAVETLPAVKRKAEWAMRWI-------------DHKRASFAERVVA 243

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+ +  + I RDE LH +F   + + +  + P  
Sbjct: 244 FAAVEGIFFSGSFAAIFWLKKRGLMPGLTQSNELISRDEGLHCDFACLMFSMLHKKPP-- 301

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                +++   ++ +A  +E  +  E +P   +G+N+    +Y++F+++R    +G + +
Sbjct: 302 -----KERVIGIIMDAVEIEQEFLTEALPVSLLGMNSTLMREYIEFVSDRLLVSLGYDKV 356

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +  T NPFP+M E I ++ + NFFE RV+EYQ+   +
Sbjct: 357 YNAT-NPFPFM-ENISIEGKTNFFERRVSEYQKSGVM 391


>gi|297818266|ref|XP_002877016.1| hypothetical protein ARALYDRAFT_484491 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322854|gb|EFH53275.1| hypothetical protein ARALYDRAFT_484491 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 329

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 151/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+ Y   WE Y  A  + W   EV +  D   W+  N L D ER 
Sbjct: 3   EEPLLTPTPDRFCMFPIHYPQIWEMYKKAEASFWTAEEVDLSQDNRDWE--NNLNDGERH 60

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 61  FIKHVLAFFAASDGIVLENLASRFMSDVQVSEARAFYGFQIAIENIHSEMYSLLLDTYIK 120

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     +P +  KA WA+++                  +   +  + +   E
Sbjct: 121 DNKERDHLFRAIETIPCVAKKAQWAMKWIDG--------------SQTFAERIIAFACVE 166

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +          L TK  
Sbjct: 167 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYT-------LLKTKLS 219

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ ++++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++  T 
Sbjct: 220 EERVKSIVCDAVEIEREFVCDALPCALVGMNRDLMSQYIEFVADRLLGALGYGKVYGVT- 278

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 279 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMS 310


>gi|68481406|ref|XP_715342.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|68481537|ref|XP_715277.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436893|gb|EAK96248.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436961|gb|EAK96315.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|238882096|gb|EEQ45734.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           albicans WO-1]
          Length = 413

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 91/332 (27%), Positives = 154/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        + P++Y   W  Y  A  + W   E+ +  DL  W   N L ++ER 
Sbjct: 89  EEPLLVENKRRYVMFPIRYHEIWNFYKKAEASFWTAEEIDLSKDLDDWN--NKLNENERY 146

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N++      +  PE + +   Q   E +HS T+  +I +   
Sbjct: 147 FISRVLAFFAASDGIVGENLIENFSTEVQLPEAKSFYGFQIMMENIHSETYSLLIETYIK 206

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P I  KA+WA+++ Q              D+    +  V +   E
Sbjct: 207 DPQEADYLFNAIANIPCIQKKADWAIKWIQ-------------DDEALYGERLVAFAAVE 253

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +   ++        +  
Sbjct: 254 GIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFAHLQN-------RPS 306

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + ++  T 
Sbjct: 307 PEIVERIITEAVDVEKEYFTDALPVSLLGMNCNLMCQYIEFVADRLLLALGNKKVYNVT- 365

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 366 NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 396


>gi|254572986|ref|XP_002493602.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|238033401|emb|CAY71423.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|328354568|emb|CCA40965.1| ribonucleoside-diphosphate reductase subunit M2 [Pichia pastoris
           CBS 7435]
          Length = 400

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 97/333 (29%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L        L PLKY   W+ Y  A  + W   E+ +  DL  W   N + D+E+
Sbjct: 74  KDEPLLVENKRRFVLFPLKYHDIWQMYKQAEASFWTAEEIDLGKDLHDWN--NRMNDNEK 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSAEVQLPEAKCFYGFQIMMENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA+WA+++              D D  F + L  F  V 
Sbjct: 192 KDPKESEFLFNAIETIPCIKEKADWAMRWI------------SDDDALFAERLVAFAAV- 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + +         + 
Sbjct: 239 EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHLNN-------RA 291

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            ++    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + ++   
Sbjct: 292 SEEIVEKIITEAVEIEKRYFTDALPVSLLGMNCSLMCQYVEFVADRLLVALGNKKVYNVN 351

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 352 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 382


>gi|241166485|ref|XP_002409876.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
 gi|215494664|gb|EEC04305.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
          Length = 376

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 93/337 (27%), Positives = 153/337 (45%), Gaps = 28/337 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
            +   D+ +L        + P+ Y   W  Y  A  + W   EV +  DL  W   +GL 
Sbjct: 51  ELEKQDEPLLRENPRRFVMFPIVYEDIWRMYKKAEASFWTVEEVDLGKDLPHW---DGLK 107

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  +  +I
Sbjct: 108 PEERHFISHILAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQMAIENVHSEMYSLLI 167

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA+WAL +                      +  V 
Sbjct: 168 DTYIKDPSERDRLFNAVETMPCIKRKADWALNWI-------------SNRSATFGERIVA 214

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   + + +       
Sbjct: 215 FAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFSHLVN----- 269

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  Q + R ++ +A ++E  +  + +P   +G+N    ++Y++F+A+R   ++G E +
Sbjct: 270 --KPSQARVRQIICDAVVIEQEFLTDALPVALIGMNCELMKRYIEFVADRLLVELGCEKV 327

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +  +ENPF +M   I L+ + NFFE RV EYQ+   +
Sbjct: 328 YN-SENPFDFMEH-ISLEGKTNFFEKRVGEYQKAGVM 362


>gi|302696699|ref|XP_003038028.1| hypothetical protein SCHCODRAFT_12788 [Schizophyllum commune H4-8]
 gi|300111725|gb|EFJ03126.1| hypothetical protein SCHCODRAFT_12788 [Schizophyllum commune H4-8]
          Length = 377

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 93/335 (27%), Positives = 153/335 (45%), Gaps = 27/335 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +  +D+ +L        L P++Y   W  Y  A  + W   E+ +  D+  W     L D
Sbjct: 57  IRAEDEPLLRESQRRFVLFPIQYDDIWAMYKQAQASFWTSEEITLAYDMRDW--TERLDD 114

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  IK  L FFA+S+ +V  N+V      +   E R +   Q   E +HS T+  +I 
Sbjct: 115 NERNFIKHVLAFFAASDGIVNENLVERFSNEVQAAEARCFYGFQIMMENIHSETYSLLID 174

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LF     +P I  KA+WAL++              D    F + L  F 
Sbjct: 175 TYIKDPQERDHLFAAIETIPCIKRKADWALRWI------------SDKSSTFAERLVAFA 222

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++F   FA I  L +   M G+    + I RDE +H  F   + + ++       
Sbjct: 223 AV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGMHTEFACLLFSHLR------- 274

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            +      + ++ EA  +E  +  + +P   +G+NA    QY++F+A+R  + +G   ++
Sbjct: 275 HRPHPSVVQRIVKEAVAIEHEFLSDALPVSLIGMNAALMRQYIEFVADRLLYSLGQNKIY 334

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
             T NPF +M  +I L+ + NFFE RV+EY +   
Sbjct: 335 NAT-NPFDFMD-MISLQGKTNFFEKRVSEYAKANV 367


>gi|296809816|ref|XP_002845246.1| ribonucleotide reductase [Arthroderma otae CBS 113480]
 gi|238842634|gb|EEQ32296.1| ribonucleotide reductase [Arthroderma otae CBS 113480]
          Length = 405

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 96/343 (27%), Positives = 156/343 (45%), Gaps = 30/343 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++A   +    ++ +L        L P+KY    E Y  A  + W   E+ +  D+  W 
Sbjct: 65  VKAKTPKELEAEEPLLQENPQRFVLFPIKYH---EMYKKAEASFWTAEEIDLSKDIHDWN 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L DDER  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS 
Sbjct: 122 --NRLNDDERFFISHVLAFFAASDGIVNENLLERFSGEVQVPEARCFYGFQIMMENIHSE 179

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   ++ +   LF     +P I  KA+WA+++ Q            D D  F 
Sbjct: 180 TYSLLIDTYIKEQKQRTYLFEAIDTIPCIRKKADWAIRWIQ------------DKDSTFA 227

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           Q L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + + 
Sbjct: 228 QRLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLN 286

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    
Sbjct: 287 -------YRPDPTAVEAIITEAVSIEQEFLTDALPCALLGMNAKLMCQYIEFVADRLLVA 339

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  +  T NPF +M   I L  + NFFE RV +YQ+   +
Sbjct: 340 LGNKKFYN-TTNPFDFMD-NISLAGKTNFFEKRVGDYQKAGVM 380


>gi|327261309|ref|XP_003215473.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 1 [Anolis carolinensis]
          Length = 394

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 93/336 (27%), Positives = 154/336 (45%), Gaps = 28/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N  D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  D
Sbjct: 71  NAQDEPLLRDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKPD 127

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 128 EKYFISHILAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLIDT 187

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WA+++                      +  V + 
Sbjct: 188 YIKDPKEREYLFNAIETLPCVKRKADWAMRWIG-------------DKHATYGERVVAFA 234

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         
Sbjct: 235 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------H 287

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   ++K
Sbjct: 288 KPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK 347

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 348 -AENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 381


>gi|241951066|ref|XP_002418255.1| ribonucleoside-diphosphate reductase small chain 1, putative;
           ribonucleotide reductase r2 subunit 1, putative;
           ribonucleotide reductase small subunit 1, putative
           [Candida dubliniensis CD36]
 gi|223641594|emb|CAX43555.1| ribonucleoside-diphosphate reductase small chain 1, putative
           [Candida dubliniensis CD36]
          Length = 413

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 154/332 (46%), Gaps = 27/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        + P++Y   W  Y  A  + W   E+ +  DL  W   N L ++ER 
Sbjct: 89  EEPLLVENKRRYVMFPIRYHEIWNFYKKAEASFWTAEEIDLSKDLDDWN--NKLNENERY 146

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            + R L FFA+S+ +V  N++      +  PE + +   Q   E +HS T+  +I +   
Sbjct: 147 FVSRVLAFFAASDGIVGENLIENFSTEVQLPEAKSFYGFQIMMENIHSETYSLLIETYIK 206

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P I  KA+WA+++ Q              D+    +  V +   E
Sbjct: 207 DPQEADYLFNAIANIPCIQKKADWAIKWIQ-------------DDEALYGERLVAFAAVE 253

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +   ++        +  
Sbjct: 254 GIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFAHLQN-------RPS 306

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + ++  T 
Sbjct: 307 PEIVEKIITEAVDVEKEYFTDALPVSLLGMNCNLMCQYIEFVADRLLLALGNKKVYNVT- 365

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 366 NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 396


>gi|255711354|ref|XP_002551960.1| KLTH0B03938p [Lachancea thermotolerans]
 gi|238933338|emb|CAR21522.1| KLTH0B03938p [Lachancea thermotolerans]
          Length = 403

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 98/333 (29%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N + ++ER
Sbjct: 76  KEEPLLMENKRRFVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLHDWN--NRMNENER 133

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R + FFA+S+ +V  N+V      + +PE + +   Q   E +HS T+  +I +  
Sbjct: 134 FFISRVIAFFAASDGIVNENLVENFSAEVQSPEAKCFYGFQIMMENIHSETYSLLIDTYI 193

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WA+++ Q            D D  F + L  F  V 
Sbjct: 194 KDPKESDFLFNAIETIPQIKEKAEWAIRWIQ------------DEDALFAERLVAFAAV- 240

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 241 EGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 295

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R    +G +  +  T
Sbjct: 296 --AIIERIITEAVEIEQRYFRDALPVSLLGMNADLMNQYVEFVADRLLVALGNQKFYNVT 353

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            NPF +M E I L  + NFFE RV++YQ+   +
Sbjct: 354 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVM 384


>gi|52077136|dbj|BAD46182.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|52077275|dbj|BAD46317.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|186920364|gb|ACC95435.1| ribonucleotide diphosphate reductase small subunit 1 [Oryza sativa
           Japonica Group]
          Length = 339

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 88/333 (26%), Positives = 154/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   S+   + P++Y   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  EEPLLAESSERFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 132 DGAEKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++    
Sbjct: 231 EARVREIVADAVDIEREFVCDALPVALVGMNGDLMSQYIEFVADRLLMALGCKKMYNVA- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 290 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMS 321


>gi|254586079|ref|XP_002498607.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
 gi|238941501|emb|CAR29674.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
          Length = 412

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 97/334 (29%), Positives = 152/334 (45%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N +++ ER
Sbjct: 87  KDEPLLVENKRRFVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDLDDWN--NKMSEGER 144

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 145 YFISRVLAFFAASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYS 204

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WA+++ Q              D     +  V +   
Sbjct: 205 RDTEESEFLFNAIENIPPIKEKAEWAIRWIQ-------------DDTALYAERLVAFAAV 251

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K        + 
Sbjct: 252 EGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDFACLLFAHLKN-------RP 304

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R    +G E  +  T
Sbjct: 305 SPDIVERIITEAVSIEKRYFEDALPVALLGMNAALMNQYVEFVADRLLVALGNEKYYNVT 364

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 365 -NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 396


>gi|328771482|gb|EGF81522.1| hypothetical protein BATDEDRAFT_16297 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 336

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 103/345 (29%), Positives = 164/345 (47%), Gaps = 27/345 (7%)

Query: 9   PIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALW 68
           P++   +   V ++ +L      + L P+KY   W  Y  A  + W   EV +  D   W
Sbjct: 2   PLELPSESTLVQNEPILTPDPRRSVLFPIKYPAVWRMYKKAEASFWTAEEVDLSKDTLDW 61

Query: 69  KSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHS 128
           + +  LTDDER  I R L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS
Sbjct: 62  EER--LTDDERYFISRVLAFFAASDGIVNENLVERFSQDVHIPEARYFYDFQIMIENIHS 119

Query: 129 HTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEF 185
             +  +I +   D  E   LF+    VP I  KA+WAL++              D    F
Sbjct: 120 EMYSLLIDTYIKDRKERAFLFDAIDTVPCIRKKADWALRWI------------SDKKSSF 167

Query: 186 LQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQI 245
            + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +
Sbjct: 168 GERLVAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFTLL 226

Query: 246 KIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCH 305
                    K      + ++HEA  +E  ++ E++P   +G+NA   +QY++F+A+R   
Sbjct: 227 NN-------KPTDSVIQQIIHEAVTIEQEFSTESLPVALIGMNANLMKQYIEFVADRLFI 279

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ++G+   +    NPF +M  +I L+ + NFFE RV EYQ+   + 
Sbjct: 280 ELGMPKKYGVG-NPFDFMD-MISLQGKTNFFEKRVGEYQKSGVMN 322


>gi|45360749|ref|NP_989048.1| ribonucleotide reductase M2, gene 1 [Xenopus (Silurana) tropicalis]
 gi|38174078|gb|AAH61353.1| ribonucleotide reductase M2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 378

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 98/339 (28%), Positives = 161/339 (47%), Gaps = 28/339 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   + D+ +L        +LP++Y   W+ Y  A  + W   EV +  DL  W+    L
Sbjct: 52  KDPRIQDEPLLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWE---AL 108

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 109 KPEERYFISYVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL 168

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D  E   LFN    +P +  KA WAL++              D +  F + +  
Sbjct: 169 IDTYIKDPKEREFLFNAIETLPCVKKKAEWALRWI------------SDREAPFCERIVA 216

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 217 FAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHVV----- 270

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  +Q+ R ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G + 
Sbjct: 271 --HKPSEQRVREIIIDAVKIEQEFLTEALPVELIGMNCKLMKQYIEFVADRLLLELGFKK 328

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +FK +ENPF +M E I L+ + NFFE +V EYQ+   + 
Sbjct: 329 IFK-SENPFDFM-ENISLEGKTNFFEKKVAEYQKMGVMS 365


>gi|156387377|ref|XP_001634180.1| predicted protein [Nematostella vectensis]
 gi|156221260|gb|EDO42117.1| predicted protein [Nematostella vectensis]
          Length = 341

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 93/343 (27%), Positives = 157/343 (45%), Gaps = 28/343 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
              + R N +D+ +L        +LP++Y   W+ Y  A  + W   EV +  D   +  
Sbjct: 11  SRAKSRFNTEDEPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDF-- 68

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L DDER+ +   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  
Sbjct: 69  -AKLNDDERMFVSHVLAFFAASDGIVNENLVECFSQEVQIPEARCFYGFQIAIENIHSEM 127

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I SL  D+ E   LFN    +P +  KA+WAL +                 +    
Sbjct: 128 YSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWIN-------------PQRASFG 174

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 175 ERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVN 234

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  ++  R ++ +A ++E  +    +P   +G+N     QY++F+A+R    +
Sbjct: 235 -------KPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVAL 287

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             + ++   ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 288 NCQKVYNV-ENPFDFM-ENISLEGKTNFFEKRVGEYQKSGVMS 328


>gi|168015485|ref|XP_001760281.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688661|gb|EDQ75037.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 330

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 152/334 (45%), Gaps = 29/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L    +   + P+KY   WE Y  A  + W   EV +  D   W+    LTD+ER
Sbjct: 5   QEEPILMENPNRFTMFPIKYPQVWEMYKKAEASFWTAEEVDLSADSKHWE---ALTDNER 61

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  ++ +  
Sbjct: 62  HFISHVLAFFAASDGIVLENLAIRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLEAYI 121

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P +T KA WAL++  +  S                +  + +   
Sbjct: 122 KDHAEKNRLFNAIETIPCVTKKAEWALKWIHSAGS--------------FAERILAFACV 167

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +F   +   +  +        
Sbjct: 168 EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLNNKLS------ 221

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            + +   ++ EA ++E  +  E +    VG+N     +Y+ F+A+R    +G    +  +
Sbjct: 222 -EDRVYEIVCEAVVIEQEFVCEALSCDLVGMNKTLMSEYIDFVADRLLVSLGYPKKYN-S 279

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 280 HNPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 312


>gi|212723480|ref|NP_001131892.1| hypothetical protein LOC100193273 [Zea mays]
 gi|194692834|gb|ACF80501.1| unknown [Zea mays]
 gi|195624040|gb|ACG33850.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 156/332 (46%), Gaps = 28/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER  
Sbjct: 15  EPLLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVDLSADARHWDE--ALSPDERHF 72

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   D
Sbjct: 73  ISHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIRD 132

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   LF     VP++  KA+WA+++              D  + F + L   +   EG
Sbjct: 133 DVEKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVEG 178

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         +
Sbjct: 179 IFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDVLRSKLD-------E 231

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            + RT++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++  T N
Sbjct: 232 ARVRTIVADAVDIEREFVCDALPVSLVGMNGDLMSQYIEFVADRLLMALGCKKMYNVT-N 290

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 291 PFDWM-ELISLQGKTNFFEKRVGDYQKASVMN 321


>gi|327261313|ref|XP_003215475.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 3 [Anolis carolinensis]
          Length = 391

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 92/337 (27%), Positives = 153/337 (45%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
               D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  
Sbjct: 67  PRRTDEPLLRDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKP 123

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 124 DEKYFISHILAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLID 183

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA+++                      +  V +
Sbjct: 184 TYIKDPKEREYLFNAIETLPCVKRKADWAMRWIG-------------DKHATYGERVVAF 230

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 231 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV------- 283

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   ++
Sbjct: 284 HKPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIY 343

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           K  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 344 K-AENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 378


>gi|170032272|ref|XP_001844006.1| ribonucleoside-diphosphate reductase small chain [Culex
           quinquefasciatus]
 gi|167872122|gb|EDS35505.1| ribonucleoside-diphosphate reductase small chain [Culex
           quinquefasciatus]
          Length = 391

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 90/343 (26%), Positives = 157/343 (45%), Gaps = 28/343 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++AG+   +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W+
Sbjct: 60  LKAGQAPFDPSIEPLLKDNPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLGDWE 119

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L   E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 120 ---KLKSGEKHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENVHSE 176

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  E   LFN    +P +  KA+WA+ +  +                  
Sbjct: 177 MYSLLIDTYIRDPKEREYLFNAIETLPCVKKKADWAMNWISS-------------KHANF 223

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   + 
Sbjct: 224 GERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFRYLV 283

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   K  +++   ++ EA ++E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 284 Q-------KPSKERVLEIIREAVVIEQEFLTKALPVDLLGMNCELMSQYIEFVADRLLLE 336

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G E ++  T+NPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 337 LGNEKIYN-TKNPFSFM-EFISLEGKTNFFEKKVGEYQKWGVM 377


>gi|18079279|ref|NP_525111.1| ribonucleoside diphosphate reductase small subunit [Drosophila
           melanogaster]
 gi|12644287|sp|P48592|RIR2_DROME RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|10727628|gb|AAF58599.2| ribonucleoside diphosphate reductase small subunit [Drosophila
           melanogaster]
 gi|15292183|gb|AAK93360.1| LD41588p [Drosophila melanogaster]
 gi|220946286|gb|ACL85686.1| CG8975-PA [synthetic construct]
 gi|220955972|gb|ACL90529.1| RnrS-PA [synthetic construct]
          Length = 393

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 87/344 (25%), Positives = 156/344 (45%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 62  MEKSVTPFDPSLEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWH 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 ---RLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSE 178

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 179 MYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISS-------------KSANF 225

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 226 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 285

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +  +++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 286 Q-------RPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVE 338

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   + 
Sbjct: 339 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVGEYQRMGVVS 380


>gi|321263777|ref|XP_003196606.1| ribonucleoside-diphosphate reductase [Cryptococcus gattii WM276]
 gi|317463083|gb|ADV24819.1| Ribonucleoside-diphosphate reductase, putative [Cryptococcus gattii
           WM276]
          Length = 401

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 94/341 (27%), Positives = 157/341 (46%), Gaps = 27/341 (7%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             G+      D+ +L   +    L P+KY   W+ Y  A  + W   E+ +  DL  W+ 
Sbjct: 63  FVGDLDCEEKDEPLLKETNARFVLFPIKYHEIWQMYKKAQASFWTAEEINLAPDLHDWE- 121

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L D+ER  I+  L FFA+S+ +V  N+V      +   E + +   Q   E +H+ T
Sbjct: 122 -NKLNDNERYFIEHVLAFFAASDGIVNENLVERFSAEVQAAEAKSFYGFQIMMENIHAET 180

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D      LF+    +P I  KA+WAL++              D    F +
Sbjct: 181 YSLLIDTYIKDTARRNFLFDAMDTIPCIRKKADWALRWI------------SDKRSCFGE 228

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   ++ 
Sbjct: 229 RLIAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFTHLRR 287

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +
Sbjct: 288 -------RPHPDTIARIIKEAVSIEQEFLTDALPVSLIGMNAKLMCQYIEFVADRLLVAL 340

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           G E ++  + NPF +M E+I L+ + NFFE+RV+ Y +   
Sbjct: 341 GNEKIWN-STNPFDFM-EMISLQGKANFFESRVSAYSKSGV 379


>gi|327261311|ref|XP_003215474.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 2 [Anolis carolinensis]
          Length = 390

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 93/336 (27%), Positives = 154/336 (45%), Gaps = 28/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N  D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L  D
Sbjct: 67  NAQDEPLLRDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---LKPD 123

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +
Sbjct: 124 EKYFISHILAFFAASDGIVNENLVERFSQEIQVTEARCFYGFQIAMENIHSEMYSLLIDT 183

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P +  KA+WA+++                      +  V + 
Sbjct: 184 YIKDPKEREYLFNAIETLPCVKRKADWAMRWIG-------------DKHATYGERVVAFA 230

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         
Sbjct: 231 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------H 283

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   ++K
Sbjct: 284 KPSEERVREIITNAVRIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK 343

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 344 -AENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|224046583|ref|XP_002198998.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 362

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 100/346 (28%), Positives = 167/346 (48%), Gaps = 28/346 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S   A E   ++D++ +L        + P++Y   W+ Y  A  + W   EV +  DL 
Sbjct: 28  MSSSSAAENGSDLDEEPLLRKNHRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLP 87

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E V
Sbjct: 88  HW---NKLKADEKYFISHVLAFFAASDGIVNENLVARFSQEVQIPEARCFYGFQILIENV 144

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I +   D  +   LFN    +P +  KA+WAL++ +            D + 
Sbjct: 145 HSEMYSLLIDTYIKDPKKRDFLFNAIETMPCVKKKADWALKWIE------------DRES 192

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F + +  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + +
Sbjct: 193 TFGERVVAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFH 251

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            +         +  +++   ++  A  +E  +  E +P G +G+N    +QY++F+A+R 
Sbjct: 252 YLVN-------RPSEERVCEIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRL 304

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 305 LMELGFSKVFNV-ENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 348


>gi|298707394|emb|CBJ30029.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 380

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 91/348 (26%), Positives = 152/348 (43%), Gaps = 28/348 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S ++  E    +  + +L        L P++    W+ Y  A    W   E+ +  D  
Sbjct: 46  VSEMRRKEMEGTLKPEPLLVENPGRFVLFPIQDNEVWQMYKKAEACFWTAEELDLAHDHK 105

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W+   GLTDDER  +K  L FFA+S+ +V  N+       +   E R +   Q   E +
Sbjct: 106 DWE---GLTDDERHFVKHVLAFFAASDGIVNENLASNFSSEIQLSEARCFYGFQIAIENI 162

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I +   D  E   LFN    VP +  KA WAL++              D   
Sbjct: 163 HSEVYSLLIDTYVKDAAEKTHLFNAMETVPCVRRKARWALRW-------------CDPKL 209

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V +   EG++F   F  +  L +   M G+    + I RDE LH +F   +  
Sbjct: 210 ASYAERLVAFAAVEGIFFSGSFCAVFWLKKRGLMPGLCFSNELISRDEGLHTDFACLLFR 269

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           ++  + P        ++   ++ +A  +E  +    +P   +G+N+    QY++F A+R 
Sbjct: 270 KLVNKLPV-------ERVAEIICDAVDIEKEFITSALPVELIGMNSALMRQYIEFCADRL 322

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             ++G E  +  + NPF WM E+I L+ + NFFE RV EY +      
Sbjct: 323 LMELGCEKKYN-STNPFDWM-EMISLQGKTNFFEKRVGEYSKSGVGVD 368


>gi|198420293|ref|XP_002130242.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase subunit
           M2 (Ribonucleotide reductase small subunit)
           (Ribonucleotide reductase small chain) [Ciona
           intestinalis]
          Length = 393

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 88/333 (26%), Positives = 153/333 (45%), Gaps = 28/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +++ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+    L  +ER
Sbjct: 72  NEEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDMVHWE---ALKPNER 128

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +  
Sbjct: 129 KFISHVLAFFAASDGIVNENLVERFAQEVQITEARFFYGFQIAIENIHSEMYSLLINTYI 188

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P +  KA WAL++                 +    +  + +   
Sbjct: 189 RDTHEREFLFNAIETLPCVRKKAEWALKWI-------------SDSESTYAERIIAFASV 235

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K 
Sbjct: 236 EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HKP 288

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            + +   ++ +A  +E  +  + +P   +G+N    +QY++F+A+R   ++G   +FK  
Sbjct: 289 SEARVVEIVKDAVTIEQEFLTDALPVALIGMNNKLMKQYIEFVADRLLVELGCSKVFKV- 347

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ENPF +M E+I L+ + NFFE RV EYQ+   +
Sbjct: 348 ENPFDFM-ELISLEGKTNFFEKRVGEYQKAGVM 379


>gi|89268988|emb|CAJ81953.1| ribonucleotide reductase m2 polypeptide [Xenopus (Silurana)
           tropicalis]
 gi|89269815|emb|CAJ81580.1| ribonucleotide reductase m2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 386

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 93/339 (27%), Positives = 156/339 (46%), Gaps = 28/339 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   + D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L
Sbjct: 60  KDPRIQDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWES---L 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 117 KAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLL 176

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D  E   LFN    +P +  KA+WAL++                 Q    +  V
Sbjct: 177 IDTYIKDPKEREYLFNAIETLPCVKKKADWALRWI-------------SDKQATYGERVV 223

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 224 AFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVN---- 279

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  +++   ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   
Sbjct: 280 ---KPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNK 336

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +FK T NPF +M E I L+ + NFFE +V EYQ+   + 
Sbjct: 337 VFKAT-NPFDFM-ENISLEGKTNFFEKKVGEYQKMGVMS 373


>gi|56118690|ref|NP_001007890.1| ribonucleotide reductase M2, gene 2 [Xenopus (Silurana) tropicalis]
 gi|51258920|gb|AAH80161.1| ribonucleotide reductase M2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 386

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 93/339 (27%), Positives = 156/339 (46%), Gaps = 28/339 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   + D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L
Sbjct: 60  KDPRIQDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWES---L 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 117 KAEEKYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIHSEMYSLL 176

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D  E   LFN    +P +  KA+WAL++                 Q    +  V
Sbjct: 177 IDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIG-------------DKQATYGERVV 223

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 224 AFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVN---- 279

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  +++   ++ +A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   
Sbjct: 280 ---KPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNK 336

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +FK T NPF +M E I L+ + NFFE +V EYQ+   + 
Sbjct: 337 VFKAT-NPFDFM-ENISLEGKTNFFEKKVGEYQKMGVMS 373


>gi|148234092|ref|NP_001079369.1| ribonucleotide reductase M2 B (TP53 inducible) [Xenopus laevis]
 gi|27371032|gb|AAH41209.1| MGC52676 protein [Xenopus laevis]
          Length = 386

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 94/346 (27%), Positives = 159/346 (45%), Gaps = 28/346 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
           +P     K   ++D+ +L        + P++Y   W+ Y  A  + W   EV +  DL  
Sbjct: 53  TPKSKAPKNPRLEDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQH 112

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W+S   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +H
Sbjct: 113 WES---LKKEEKYFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAMENIH 169

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E   LFN    +P +  KA+WAL +                 Q 
Sbjct: 170 SEMYSLLIDTYVKDPKEREYLFNAIETLPCVKKKADWALHWIG-------------DKQA 216

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 217 TFGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKH 276

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           +         K  +++   ++ +A  +E  +  E +P   +G+N    +QY++F+A+R  
Sbjct: 277 LIR-------KPSEERVVELITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLL 329

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++G + +FK T NPF +M E I L+ + NFFE +V EYQ+   + 
Sbjct: 330 LELGFKKVFKAT-NPFDFM-ENISLEGKTNFFEKKVGEYQKMGVMS 373


>gi|195333568|ref|XP_002033462.1| GM20395 [Drosophila sechellia]
 gi|195582581|ref|XP_002081105.1| GD25870 [Drosophila simulans]
 gi|194125432|gb|EDW47475.1| GM20395 [Drosophila sechellia]
 gi|194193114|gb|EDX06690.1| GD25870 [Drosophila simulans]
          Length = 393

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 87/344 (25%), Positives = 156/344 (45%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 62  MEKSVTPFDPSLEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWH 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 ---RLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSE 178

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 179 MYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISS-------------KSANF 225

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 226 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 285

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +  +++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 286 Q-------RPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVE 338

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   + 
Sbjct: 339 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVAEYQRMGVVS 380


>gi|72008642|ref|XP_780110.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           isoform 1 [Strongylocentrotus purpuratus]
 gi|115928579|ref|XP_001179668.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           [Strongylocentrotus purpuratus]
          Length = 412

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 101/354 (28%), Positives = 167/354 (47%), Gaps = 30/354 (8%)

Query: 2   ANNTGLSPIQAGEKRV--NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
           A +  + P  +G+K V  N +D+ +L   +    + P++Y   W+ Y  A  + W   EV
Sbjct: 66  AKSKLVKPENSGKKVVSFNKEDEPLLRENARRFVIFPIQYHDIWQFYKKAEASFWTAEEV 125

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            +  DL  W     L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   
Sbjct: 126 DLSKDLDHW---ANLKDEERHFISHVLAFFAASDGIVNENLVERFSQEVQVAEARCFYGF 182

Query: 120 QAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTT 176
           Q   E +HS  +  +I +   D  +   LFN    +P +T KA WAL +  +  S  F T
Sbjct: 183 QIAIENIHSEMYSLLIDTYIKDSVQRDFLFNAVETLPCVTKKAQWALNWIGS-DSADFGT 241

Query: 177 GTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLN 236
                         V +   EG++F   FA I  L +   M G+    + I RDE LH +
Sbjct: 242 ------------RIVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCD 289

Query: 237 FGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           F   +   +         K  ++  + ++ EA  +E  +  + +P   +G+NA   ++Y+
Sbjct: 290 FACLMFKHLNN-------KPDEEHVQGIIKEAVAIEQEFLTDALPCSLIGMNAVLMKRYI 342

Query: 297 QFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +F+A+R   ++G   ++K  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 343 EFVADRLLVELGCGKIWKV-ENPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 394


>gi|195485577|ref|XP_002091148.1| GE13485 [Drosophila yakuba]
 gi|194177249|gb|EDW90860.1| GE13485 [Drosophila yakuba]
          Length = 393

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 87/344 (25%), Positives = 156/344 (45%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 62  MEKSVTPFDPSLEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWH 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 ---RLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSE 178

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 179 MYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISS-------------KSANF 225

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 226 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 285

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +  +++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 286 Q-------RPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVE 338

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   + 
Sbjct: 339 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVGEYQRMGVVS 380


>gi|168049349|ref|XP_001777126.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671569|gb|EDQ58119.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 325

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 91/335 (27%), Positives = 152/335 (45%), Gaps = 29/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++ + +L        + P+KY   WE Y  A  + W   EV +  DL  W+    LTD+E
Sbjct: 1   MEQEPILAENPGRFCMFPIKYPQVWEMYKKAEASFWTAEEVDLSADLKHWE---ALTDNE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  ++ + 
Sbjct: 58  RHFISHVLAFFAASDGIVLENLAVRFMKEIQIPEARAFYGFQIAIENIHSEMYSLLLEAY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D+ E   LFN    +P +T KA WAL++  +  S                +  + +  
Sbjct: 118 IKDQSEKHRLFNAIETIPCVTRKAEWALKWIDSSGS--------------FAERILAFAC 163

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G+    + I RDE LH +F   +   +  +       
Sbjct: 164 VEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYTLLNNKLS----- 218

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             + +   ++ EA  +E  +  E +    VG+N     +Y+ F+A+R    +G    +  
Sbjct: 219 --EDRVHEIVCEAVDIEREFVCEALSCDLVGMNKIMMSEYIDFVADRLLVSLGYNKRYN- 275

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 276 ARNPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 309


>gi|58260896|ref|XP_567858.1| ribonucleoside-diphosphate reductase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134116993|ref|XP_772723.1| hypothetical protein CNBK0970 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255341|gb|EAL18076.1| hypothetical protein CNBK0970 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229939|gb|AAW46341.1| ribonucleoside-diphosphate reductase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 401

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 94/341 (27%), Positives = 157/341 (46%), Gaps = 27/341 (7%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             G+      D+ +L   +    L P+KY   W+ Y  A  + W   E+ +  DL  W+ 
Sbjct: 63  FVGDLDCEEKDEPLLKETNARFVLFPIKYHEIWQMYKKAQASFWTAEEINLAPDLHDWE- 121

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L D+ER  I+  L FFA+S+ +V  N+V      +   E + +   Q   E +H+ T
Sbjct: 122 -NKLNDNERYFIEHVLAFFAASDGIVNENLVERFSAEVQAAEAKSFYGFQIMMENIHAET 180

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D      LF+    +P I  KA+WAL++              D    F +
Sbjct: 181 YSLLIDTYIKDTARRNFLFDAIDTIPCIRKKADWALRWI------------SDKRSCFGE 228

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   ++ 
Sbjct: 229 RLIAFAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFTHLRR 287

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +        ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +
Sbjct: 288 -------RPHPDTIARIIKEAVTIEQEFLTDALPVSLIGMNAKLMCQYIEFVADRLLVAM 340

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           G E ++  + NPF +M E+I L+ + NFFE+RV+ Y +   
Sbjct: 341 GNEKIWN-STNPFDFM-EMISLQGKANFFESRVSAYSKSGV 379


>gi|225432510|ref|XP_002279943.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 340

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 93/341 (27%), Positives = 155/341 (45%), Gaps = 29/341 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
                  +++ +L   S    + P++Y   WE Y  A  + W   EV +  D+  W+S  
Sbjct: 10  KRPDEEQEEEPILMKNSQRFCMFPIRYRQLWEMYKKAEASFWTAEEVDLSHDVQQWES-- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L++ E+  I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS  + 
Sbjct: 68  -LSNSEKHFISHVLAFFAASDGIVLENLAARFLHDIQIPEARAFYGFQIAMENIHSEMYS 126

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            ++ +   D  E   LFN    +  +  KA WAL + Q+                   + 
Sbjct: 127 LLLETYIKDSKEKHRLFNAIESISCVAGKAKWALDWIQS--------------STLFAER 172

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            + +   EG++F   F  I  L +   M G+    + I RDE LH +F   + + ++ + 
Sbjct: 173 LIAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQL 232

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
           P        QK   ++HEA  +E  +  E +P   +G+NA    QY++F+A+R    +G 
Sbjct: 233 PW-------QKVHHIVHEAVEIETQFVCEALPCALIGMNATLMSQYIKFVADRLLVALGY 285

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           E  +   ENPF WM E I L+ + NFFE RV +YQ+ + + 
Sbjct: 286 ERKYNV-ENPFDWM-EFISLQGKANFFERRVGDYQKASIMS 324


>gi|156387375|ref|XP_001634179.1| predicted protein [Nematostella vectensis]
 gi|156221259|gb|EDO42116.1| predicted protein [Nematostella vectensis]
          Length = 384

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 92/344 (26%), Positives = 156/344 (45%), Gaps = 28/344 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
              + R N +D+ +L        +LP++Y   W+ Y  A  + W   EV +  D   +  
Sbjct: 54  SRAKSRFNTEDEPLLRENPHRFVILPIQYTEIWQMYKKAEASFWTAEEVDLSKDSHDF-- 111

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L D ER+ +   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  
Sbjct: 112 -AKLNDHERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEM 170

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I SL  D+ E   LFN    +P +  KA+WAL +                 +    
Sbjct: 171 YSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWIN-------------PQRASFG 217

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 218 ERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVN 277

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  ++  R ++ +A ++E  +    +P   +G+N     QY++F+A+R    +
Sbjct: 278 -------KPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVAL 330

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
             + ++   ENPF +M E I L+ + NFFE RV EYQ+   +  
Sbjct: 331 NCQKVYN-AENPFDFM-ENISLEGKTNFFEKRVGEYQKSGVMSD 372


>gi|300676950|gb|ADK26821.1| ribonucleotide reductase M2 [Zonotrichia albicollis]
          Length = 390

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 92/340 (27%), Positives = 157/340 (46%), Gaps = 28/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +R   +++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   
Sbjct: 63  AERPGTEEEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES--- 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  
Sbjct: 120 LKPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSL 179

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  E   LFN    +P +  KA+WA+ +                 +    +  
Sbjct: 180 LIDTYIKDSQEREFLFNAIETLPCVKKKADWAMCWIG-------------DKKATYGERV 226

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 227 VAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL----- 281

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A L+E  +  E +P   +G+N    +QY++F+A+R   ++G  
Sbjct: 282 --IHKPSEERVREIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFN 339

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++K  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 340 KIYK-AENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|189501948|ref|YP_001957665.1| hypothetical protein Aasi_0535 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497389|gb|ACE05936.1| hypothetical protein Aasi_0535 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 355

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 152/332 (45%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   L P+++   WE Y  A  + W   E+ +  DL  W     L D ER  
Sbjct: 34  EPILQENKNRFVLFPIEHHDIWEFYKKAEASFWTAEEIDLGQDLKDW---ANLNDGERHF 90

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 91  ISHVLAFFAASDGIVNENLAENFVAEVQYTEAKFFYGFQIAVENIHSETYSLLIDTYIKD 150

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +  +  KA+WAL++ +  S                 +  V +   EG
Sbjct: 151 PQERDKLFNAIDTLDCVKKKADWALRWIEQAS---------------FAERLVAFAAVEG 195

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G++   + I RDE LH +F   +             K  +
Sbjct: 196 IFFSGSFCSIFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLYANHLQ------NKLPE 249

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ R ++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G   ++  T N
Sbjct: 250 ERVREIITDAVAIEKEFVTDALPVKLIGMNADLMSQYIEFVADRLLLELGCSKVYNAT-N 308

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E+I L+ + NFFE RV EYQ+   +K
Sbjct: 309 PFDFM-EMISLQGKTNFFEKRVGEYQKAGVMK 339


>gi|242076364|ref|XP_002448118.1| hypothetical protein SORBIDRAFT_06g021460 [Sorghum bicolor]
 gi|241939301|gb|EES12446.1| hypothetical protein SORBIDRAFT_06g021460 [Sorghum bicolor]
          Length = 339

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 154/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  EEPLLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 132 DGAEKDRLFRAIETVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++    
Sbjct: 231 ESRVREIVADAVDIEREFVCDALPVALVGMNGALMSQYIEFVADRLLMALGHKKMYNVA- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 290 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 321


>gi|156545974|ref|XP_001606963.1| PREDICTED: similar to ENSANGP00000013211 [Nasonia vitripennis]
          Length = 388

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 89/341 (26%), Positives = 153/341 (44%), Gaps = 28/341 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
               +   + +L        L P+++   W  Y  A  + W   EV +  D+A W   N 
Sbjct: 59  TPAFDPQLEPLLKENPGRFVLFPIQWPDIWHMYKKAEASFWTVEEVDLSKDMADW---NR 115

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  
Sbjct: 116 LNDNERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQVAIENIHSEMYSL 175

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KANWAL +                D     +  
Sbjct: 176 LIDTYISDASQRQFLFNAIETLPCVAKKANWALNWI-------------SHDSATFAERV 222

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           + +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   I     
Sbjct: 223 IAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHIVQ--- 279

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++  +++ +A  +E  +  + +P   +G+N     QY++F+A+R   ++G  
Sbjct: 280 ----KPSEERVISIIKDAVTIEQEFLTDALPVEMIGMNCRLMCQYIEFVADRLLGELGCP 335

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            ++  +ENPF +M   I L+ + NFFE +V EYQ+   ++ 
Sbjct: 336 KVYN-SENPFDFMEH-ISLEGKTNFFEKKVGEYQKWGVMQD 374


>gi|212274629|ref|NP_001130908.1| hypothetical protein LOC100192012 [Zea mays]
 gi|195636980|gb|ACG37958.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 90/333 (27%), Positives = 152/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            + +L   SD   + P++Y   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  QEPLLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMSDVQAAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 132 DGTEKDRLFRAIETVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++    
Sbjct: 231 ESRVREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYNVA- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 290 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 321


>gi|326917964|ref|XP_003205263.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Meleagris gallopavo]
          Length = 353

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 94/339 (27%), Positives = 161/339 (47%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  + + ++ +L        + P+++   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 26  ENGLKLHEEPLLRKNPRRFVIFPIQHPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 82

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 83  LKPDEKYFISHILAFFAASDGIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSL 142

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +                    +  
Sbjct: 143 LIDTYIKDPEKRDFLFNAIETMPCVKKKADWALKWIE-------------DRHSTFGERV 189

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   + + +     
Sbjct: 190 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVN--- 246

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               +  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 247 ----RPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLMELGFS 302

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F + ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 303 KVF-HAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 339


>gi|266918|sp|P07201|RIR2_SPISO RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit;
           AltName: Full=p41
 gi|10342|emb|CAA38919.1| M2 (small) subunit of ribonucleotide reductase [Spisula
           solidissima]
          Length = 384

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 93/349 (26%), Positives = 157/349 (44%), Gaps = 28/349 (8%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           T L        + +   + +L        +LP++Y   W+ Y  A  + W   EV +  D
Sbjct: 45  TPLKQEIKPVVKKSQQVEPLLADNPRRFVVLPIQYHDIWKMYKKAEASFWTAEEVDLSKD 104

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +A W+S   L  +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E
Sbjct: 105 MAHWES---LKKEEKHFISHVLAFFAASDGIVNENLVERFSKEVQVTEARCFYGFQIAME 161

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            +HS  +  +I +   D  E   LFN    +P +  KA+WA+++                
Sbjct: 162 NIHSEMYSLLIDTYIKDPQERDFLFNAIETMPCVKEKADWAMRWIN-------------D 208

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
           D     +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 209 DSSSYAERVVAFAAVEGIFFSGSFASIFWLKKRGIMPGLTFSNELISRDEGLHCDFACLM 268

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
            + +         K  Q++   ++ EA  +E  +  E +P   +G+N     QY++F+A+
Sbjct: 269 FSHLVN-------KPSQERIHQIIDEAVKIEQVFLTEALPCRLIGMNCDLMRQYIEFVAD 321

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           R   ++  + L+   ENPF +M   I L+ + NFFE RV EYQ+   + 
Sbjct: 322 RLLLELKCDKLYN-KENPFDFMEH-ISLEGKTNFFEKRVGEYQKMGVMS 368


>gi|242095388|ref|XP_002438184.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
 gi|241916407|gb|EER89551.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
          Length = 339

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 155/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  EEPLLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVDLSSDARHWDE--ALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D+ E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 132 DDAEKDRLFRAIDTVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +   ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYELLRSKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++  T 
Sbjct: 231 EARVREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGCKKMYNAT- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV +YQ+ + + 
Sbjct: 290 NPFDWM-ELISLQGKTNFFEKRVGDYQKASVMN 321


>gi|194690416|gb|ACF79292.1| unknown [Zea mays]
 gi|194704028|gb|ACF86098.1| unknown [Zea mays]
 gi|195619132|gb|ACG31396.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
 gi|223943167|gb|ACN25667.1| unknown [Zea mays]
          Length = 339

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 90/333 (27%), Positives = 152/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            + +L   SD   + P++Y   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  QEPLLAESSDRFSMFPIRYPQIWEFYKKAVASFWTAEEVDLSADARHWD--AALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMSDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++              D  + F + L   +   E
Sbjct: 132 DGTEKDRLFRAIETVPAVRRKADWAMRWI-------------DGGERFAERLVA-FACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYDLLRGKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G   ++    
Sbjct: 231 ESRVREIVADAVDIEREFVCDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYNVA- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L+ + NFFE RV EYQ+ + + 
Sbjct: 290 NPFDWM-ELISLQGKTNFFEKRVGEYQKASVMS 321


>gi|312889900|ref|ZP_07749444.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
 gi|311297432|gb|EFQ74557.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
          Length = 343

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 92/344 (26%), Positives = 159/344 (46%), Gaps = 30/344 (8%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
               R++ +++ +L    D   +LP+ Y   WE Y     + W   E+ + DD+  W   
Sbjct: 15  NTVTRMSQENELLLRENKDRFVILPINYPQIWEMYKKHEASFWTAEEIDLSDDMKDW--- 71

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
           N L D ER  I   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS T+
Sbjct: 72  NNLNDGERHFISHILAFFAASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETY 131

Query: 132 QYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             +I +   D  E   LF+    VP +  K  WAL++ +  +                 +
Sbjct: 132 ALLIDTYIKDTTEKNRLFHAIETVPCVKKKGEWALKWIENGT---------------FAE 176

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
             V +   EG++F   F  I  L +   M G+    + I RDE +H  F   + + +  +
Sbjct: 177 RLVAFAAVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCEFACLLYSMLSNK 236

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                    ++   T++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G
Sbjct: 237 LS-------KEAVTTIIADAVEIEKEFVTDALPVNLIGMNAKLMSQYIEFVADRWLQELG 289

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            + L+ +  NPF +M E+I L+ + NFFE RV +YQ+   L  D
Sbjct: 290 YDKLY-HATNPFDFM-EMISLQGKTNFFEKRVGDYQKSGVLNND 331


>gi|255530602|ref|YP_003090974.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
 gi|255343586|gb|ACU02912.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
          Length = 324

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 93/334 (27%), Positives = 154/334 (46%), Gaps = 30/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +++ +L    D   LLP+KY   WE Y  +  + W   E+ + DD   W   + L D ER
Sbjct: 3   EEEVLLKENKDRFVLLPIKYPEIWEMYKKSEASFWTAEEIDLSDDQKHW---DNLNDGER 59

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FF++S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I +  
Sbjct: 60  HFISHILAFFSASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLIDTYI 119

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LF+    VP +  KA WAL++    S                 +  V +   
Sbjct: 120 KDPDEKDRLFHAIETVPCVKKKAEWALRWIDNGS---------------FAERLVAFAAV 164

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE  H  F   +   +K +        
Sbjct: 165 EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGSHCEFACLLYGMLKNKLS------ 218

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            Q++   ++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G   ++  T
Sbjct: 219 -QEQVHGIIRDAVEIEKEFVTDALPVALIGMNAKLMSQYIEFVADRWLQELGYSKIYNAT 277

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E+I L+ + NFFE RV +YQ+   L 
Sbjct: 278 -NPFDFM-EMISLQGKTNFFEKRVGDYQKSGVLT 309


>gi|195119943|ref|XP_002004488.1| GI19586 [Drosophila mojavensis]
 gi|193909556|gb|EDW08423.1| GI19586 [Drosophila mojavensis]
          Length = 393

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 88/340 (25%), Positives = 154/340 (45%), Gaps = 28/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
               +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W     
Sbjct: 66  AAPFDPSLEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDW---AR 122

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LTD+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  +  
Sbjct: 123 LTDNERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSV 182

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  E   LFN    +P++  KA+WAL +  +                   +  
Sbjct: 183 LIDTYIRDPQERDYLFNAVETMPAVKRKADWALSWISS-------------KAANFGERI 229

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   +     
Sbjct: 230 IAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVMMFRHLVQ--- 286

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               +  +++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   ++G+ 
Sbjct: 287 ----RPSRERIIEIISDAVTIEQEFLTDALPVNLIGMNCALMSQYIEFVADRLLVELGVG 342

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++  T+NPF +M E+I L  + NFFE +V EYQ+     
Sbjct: 343 KIYN-TKNPFTFM-EMISLDGKTNFFEKKVGEYQRMGVTS 380


>gi|118087248|ref|XP_418364.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 353

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 98/342 (28%), Positives = 165/342 (48%), Gaps = 28/342 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
            A E  +   ++ +L        + P+++   W+ Y  A  + W   EV +  DL  W  
Sbjct: 23  SAAENGLKPHEEPLLRKNPRRFVIFPIQHPDIWKMYKQAQASFWTAEEVDLSKDLPHW-- 80

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  
Sbjct: 81  -NKLKADEKYFISHVLAFFAASDGIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEM 139

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   LFN    +P +  KA+WAL++ +            D +  F +
Sbjct: 140 YSLLIDTYIKDPEKRDFLFNAIETMPCVKKKADWALKWIE------------DRESTFGE 187

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            +  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +  
Sbjct: 188 RVVAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVN 246

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++
Sbjct: 247 -------RPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLMEL 299

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           G   +F + ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 300 GFSKVF-HAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 339


>gi|302783485|ref|XP_002973515.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
 gi|302787555|ref|XP_002975547.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300156548|gb|EFJ23176.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300158553|gb|EFJ25175.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
          Length = 347

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 93/346 (26%), Positives = 160/346 (46%), Gaps = 30/346 (8%)

Query: 8   SPIQAGEKRVN-VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           SPI     R+    ++ +L        + P++Y   WE Y  A  + W   EV +  D  
Sbjct: 9   SPIVDDGSRIKAPKEEPILADNPQRFCMFPIRYPRVWEMYKKAEASFWTAEEVDLSQDAK 68

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W+S   LTD+E+  +   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +
Sbjct: 69  HWES---LTDNEKHFVSHVLAFFAASDGIVLENLAVRFMKEIQIPEARAFYGFQIAIENI 125

Query: 127 HSHTFQYIITSLGLDEG---ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  ++ +   D     +LFN    +P +  KA+WAL++  +  S            
Sbjct: 126 HSEMYSLLLETYIKDNEVKAKLFNAIETIPCVAKKADWALRWIDSSQS------------ 173

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V +   EG++F   F  I  L +   M G+    + I RDE LH +F   + +
Sbjct: 174 --FAERIVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYS 231

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            + ++         +++ + ++ +A  +E  +  E +    VG+NA    QY+ F+A+R 
Sbjct: 232 LLNVKLD-------EKRVKEIVSDAVEIERQFVCEALSCDLVGMNARLMSQYIDFVADRL 284

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
              +G   LF    NPF WM  +I L+ + NFFE RV EYQ+ + +
Sbjct: 285 MVVLGYNKLFN-AINPFDWMD-LISLQGKTNFFEKRVGEYQKASVM 328


>gi|322491821|emb|CBZ27094.1| ribonucleoside-diphosphate reductase small chain,putative
           [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 392

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 92/352 (26%), Positives = 159/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P+    +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 52  APGAEVLPVDKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 111

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W     L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 112 GNDMKDW---AALNDGERHFIKHVLAFFAGSDGIVVENLAQRFMSDVKVPEARAFYGFQL 168

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 169 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQRKAEWAVRWIGS---------- 218

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 219 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 274

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 275 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 328

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 329 VADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 378


>gi|297831106|ref|XP_002883435.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
 gi|297329275|gb|EFH59694.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
          Length = 341

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 99/348 (28%), Positives = 160/348 (45%), Gaps = 29/348 (8%)

Query: 6   GLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDL 65
            L   Q  +   +   + +L A++    + P++Y   WE Y  A  + W   EV +  D+
Sbjct: 3   SLKESQRRDMDEDESKEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDV 62

Query: 66  ALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEA 125
             W+    LTD E+  I   L FFA+S+ +V  N+       +  PE R +   Q   E 
Sbjct: 63  QQWE---ALTDSEKHFISHVLAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMEN 119

Query: 126 VHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           +HS  +  ++ +   D  E   LFN    +P I+ KA W L + Q+              
Sbjct: 120 IHSEMYSLLLETFLKDSKEKDRLFNAIETIPCISKKAKWCLDWIQS-------------P 166

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
             F   L   +   EG++F   F  I  L +   M G+    + I RDE LH +F   + 
Sbjct: 167 MSFAVRLVA-FACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLY 225

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
           + ++ + P        +K   ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R
Sbjct: 226 SLLQKQLPL-------EKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADR 278

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
               +G E  +K  ENPF WM E I L+ + NFFE RV EYQ+ + + 
Sbjct: 279 LLVTLGCERRYK-AENPFDWM-EFISLQGKTNFFEKRVGEYQKASVMS 324


>gi|224048725|ref|XP_002196356.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Taeniopygia
           guttata]
          Length = 390

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 91/339 (26%), Positives = 157/339 (46%), Gaps = 28/339 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           +R   +++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W+S   L
Sbjct: 64  ERPGTEEEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWES---L 120

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +
Sbjct: 121 KPEEKYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLL 180

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D  E   LFN    +P +  KA+WA+ +                 +    +  V
Sbjct: 181 IDTYIKDSKEREFLFNAIETLPCVKKKADWAMCWIG-------------DKKATYGERVV 227

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 228 AFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL------ 281

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  +++ + ++  A L+E  +  E +P   +G+N    +QY++F+A+R   ++G   
Sbjct: 282 -IHKPSEERVKEIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNK 340

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ++K  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 341 IYK-AENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 377


>gi|302833193|ref|XP_002948160.1| hypothetical protein VOLCADRAFT_101784 [Volvox carteri f.
           nagariensis]
 gi|300266380|gb|EFJ50567.1| hypothetical protein VOLCADRAFT_101784 [Volvox carteri f.
           nagariensis]
          Length = 354

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 95/335 (28%), Positives = 152/335 (45%), Gaps = 28/335 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           D+ +L    +   L P++Y   WE Y  A  + W   EV    DL  +     L ++ER 
Sbjct: 24  DEAVLRENPNRFTLFPIRYPDLWEFYKRAVASFWTVEEVDFTGDLYDFDH--KLKEEERR 81

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E VHS  +  ++     
Sbjct: 82  FIKYVLAFFAASDGIVMENLSARFMSEVQVPEARAFYGFQIAMENVHSEMYSVLLDHYVR 141

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN  + + ++  KA+WAL++  + +S                +  V +   E
Sbjct: 142 DPAERRQLFNAIQTIATVGKKADWALRWISSSNS--------------FAERLVAFACVE 187

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G+ F   F  I  L +   M G++     I RDE LH +F   +   +K           
Sbjct: 188 GIHFSGSFCAIFWLKKRLLMPGLSFSNCLISRDEGLHCDFACCLYGHLKNRLS------- 240

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++   ++ EA  LE  +  E +    +G+NA    QY++F+A+R    +G +  +  T 
Sbjct: 241 RERVVKIVDEAVRLEDEFCTEALSCELLGMNADLMRQYIRFVADRLLVSLGYDKYYN-TV 299

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           NPF WM E+I L+ + NFFE RV EYQ+   +  D
Sbjct: 300 NPFDWM-EMISLQGKANFFERRVGEYQRACVMAGD 333


>gi|158286793|ref|XP_308927.4| AGAP006818-PA [Anopheles gambiae str. PEST]
 gi|157020637|gb|EAA04227.4| AGAP006818-PA [Anopheles gambiae str. PEST]
          Length = 400

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 89/340 (26%), Positives = 155/340 (45%), Gaps = 28/340 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
                +   + +L        + P++Y   W+ Y  A  + W   EV +  D+  W++  
Sbjct: 72  ESAPFDPSIEPLLRDNPRRFVIFPIQYPDIWQMYKKAEASFWTVEEVDLSKDMKDWET-- 129

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L   ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  + 
Sbjct: 130 -LKPSERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENVHSEMYS 188

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  E   LFN    +P +  KA+WAL +  +              +    + 
Sbjct: 189 LLIDTYIRDSKEREFLFNAIETLPCVKRKADWALNWISS-------------KKANFGER 235

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +    
Sbjct: 236 VVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKYLVQ-- 293

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
                K  +++   ++ +A L+E  +  + +P   +G+N     QY++F+A+R   ++G 
Sbjct: 294 -----KPSKERVTEIIRDAVLIEQEFLTKALPVDMLGMNCDLMSQYIEFVADRLLLELGC 348

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           E ++ +T+NPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 349 EKIY-HTKNPFSFM-EFISLEGKTNFFEKKVGEYQKWGVM 386


>gi|145349720|ref|XP_001419276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144579507|gb|ABO97569.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 329

 Score =  265 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 153/332 (46%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L+       + P++Y   WE Y  A  + W   EV + DD+  W++   LT DE+  
Sbjct: 8   EPLLDENDQRFTMFPIQYPQVWEMYKKAEASFWTAEEVDLSDDMKHWET---LTKDEKHF 64

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I     D
Sbjct: 65  VSHVLAFFAASDGIVLENLGVRFMGEVQIPEARAFYGFQIAIENIHSEMYSLLIDQYIKD 124

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LF     +P +  KA+WAL++  +  S                +  + +   EG
Sbjct: 125 PVEKDHLFRAIDTIPCVKKKADWALKWIDSSDS--------------FAERLLAFACIEG 170

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   + + +         K  +
Sbjct: 171 IFFSGSFCSIYWLKKRGLMPGLTFSNELISRDEGLHRDFACLLFSMLNN-------KPSE 223

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++ EA  +E  +  +++P   VG+NA     Y++++A+     +GL   +  T N
Sbjct: 224 ETIRKIVTEAVEIEKEFVCDSLPCALVGMNAGMMSDYIEYVADHLFCSLGLAKEYN-TTN 282

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF WM E+I L+ + NFFE RV EYQ+   + 
Sbjct: 283 PFDWM-ELISLQGKTNFFEKRVGEYQKAGVMN 313


>gi|149637725|ref|XP_001508783.1| PREDICTED: similar to Ribonucleotide reductase M2 B (TP53
           inducible) [Ornithorhynchus anatinus]
          Length = 401

 Score =  265 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 95/343 (27%), Positives = 162/343 (47%), Gaps = 28/343 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           +  E  +   ++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W  
Sbjct: 71  EPTENGLQPCEEPLLRKSSRRFVIFPIQYPEIWKMYKQAQASFWTAEEVDLSKDLPHW-- 128

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  
Sbjct: 129 -NKLKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEM 187

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   LFN    +P +  KA+W+L++                 Q    
Sbjct: 188 YSLLIDTYIKDPKKREFLFNAIETMPFVKKKADWSLRWIA-------------DRQSTFG 234

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 235 ERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVK 294

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  + K + ++ +A  +E  +  E +P G +G+N    +QY++F+A+R   ++
Sbjct: 295 -------KPSEDKVKEIIIDAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLVEL 347

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           G   +F +++NPF +M E I L+ + NFFE RV+EYQ+ A + 
Sbjct: 348 GFSKVF-HSDNPFDFM-ENISLEGKTNFFEKRVSEYQRFAVMS 388


>gi|294890631|ref|XP_002773236.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239878288|gb|EER05052.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 350

 Score =  265 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 93/332 (28%), Positives = 152/332 (45%), Gaps = 28/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            + +L        + P+KY   WE Y     + W   E+ +  DL  W+    L+D++R 
Sbjct: 14  KEDLLKENPHRYVMFPIKYLAIWEMYKKHEASFWTAEEIDLSQDLRDWE---NLSDNDRH 70

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   
Sbjct: 71  FISHVLAFFAASDGIVLENLSAKFSGEVQCPEARAFYGFQIAMENIHSETYSLLIDNYIK 130

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   +F     VPS+  KA WAL +                D  F + L   +   E
Sbjct: 131 DPAEKDKIFRAIETVPSVRKKAEWALSWIN-------------DDNCFSERLIA-FACVE 176

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G+ F   F  I  L +   M G+    + I RDE LH +F   + N +       +T+  
Sbjct: 177 GILFSGSFCAIYWLKKRGLMPGLTFSNELISRDEGLHADFACLLYNMM------HYTRLP 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            ++   ++  A  +E  +  E++P   +G+N+    +Y++F+A+R    +G   L+  T 
Sbjct: 231 DERVHEIVRGAVDVERVFISESLPVSLIGMNSQLMCRYIEFVADRLLVALGHPKLYNAT- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF WM ++I L+ + NFFE RV EYQ+G  +
Sbjct: 290 NPFDWM-KMISLQGKTNFFEKRVGEYQKGGVM 320


>gi|156386903|ref|XP_001634150.1| predicted protein [Nematostella vectensis]
 gi|156221230|gb|EDO42087.1| predicted protein [Nematostella vectensis]
          Length = 384

 Score =  265 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 92/343 (26%), Positives = 157/343 (45%), Gaps = 28/343 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
              + R N +D+ +L        +LP++Y   W+ Y  A  + W   EV +  D   +  
Sbjct: 54  SRAKSRFNTEDEPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDF-- 111

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L DDER+ +   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  
Sbjct: 112 -AKLNDDERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEM 170

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I SL  D+ E   LFN    +P +  KA+WAL +                 +    
Sbjct: 171 YSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWIN-------------PQRASFG 217

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 218 ERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVN 277

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  ++  R ++ +A ++E  +    +P   +G+N     QY++F+A+R    +
Sbjct: 278 -------KPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVAL 330

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             + ++   ENPF +M E I L+ + NF+E RV EYQ+   + 
Sbjct: 331 NCQKVYNV-ENPFDFM-ENISLEGKTNFYEKRVGEYQKSGVMS 371


>gi|301774462|ref|XP_002922647.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Ailuropoda melanoleuca]
          Length = 387

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 98/339 (28%), Positives = 159/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 60  ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 116

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 117 LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 176

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +               +    +  
Sbjct: 177 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIE-------------DRKSTFGERV 223

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 224 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 280

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 281 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 336

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV EYQ+ A +
Sbjct: 337 KVF-QAENPFDFM-ENISLEGKTNFFEKRVAEYQRFAVM 373


>gi|195436539|ref|XP_002066225.1| GK22247 [Drosophila willistoni]
 gi|194162310|gb|EDW77211.1| GK22247 [Drosophila willistoni]
          Length = 395

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 88/335 (26%), Positives = 154/335 (45%), Gaps = 28/335 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W     LTD+
Sbjct: 72  DPSLEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDW---ARLTDN 128

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  +  +I +
Sbjct: 129 ERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSILIDT 188

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P++  KA+WAL +  +                   +  + + 
Sbjct: 189 YIRDPQERDYLFNAVETMPAVKRKADWALSWISS-------------KAANFGERIIAFA 235

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   FA I  L +   M G+    + I RDE LH +F + +   +         
Sbjct: 236 AVEGIFFSGSFASIFWLKKRGLMPGLTFSNEMISRDEGLHCDFAVLMFQHLVQ------- 288

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           +  +++   ++ +A  +E  +    +P   +G+N     QY++F+A+R   ++G+  ++ 
Sbjct: 289 RPSRERIIEIIRDAVQIEQEFLTVALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN 348

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            T+NPF +M E+I L  + NFFE +V EYQ+   +
Sbjct: 349 -TKNPFSFM-EMISLDGKTNFFEKKVGEYQRMGVV 381


>gi|256421019|ref|YP_003121672.1| ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
 gi|256035927|gb|ACU59471.1| Ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
          Length = 323

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 94/337 (27%), Positives = 161/337 (47%), Gaps = 30/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +N++++ +L    D   LLP+ Y   WEKY     + W   E+ +  D+  W   N L D
Sbjct: 1   MNLENELLLKENKDRFVLLPINYPKVWEKYKQHEASFWTAEEIDLSADMKDW---NNLND 57

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            ER  I   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I 
Sbjct: 58  GERHFITHVLAFFAASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLID 117

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LF+    VP++T KA WAL++ +  +                 +  V +
Sbjct: 118 TYVKDPVEKDRLFHAIETVPAVTKKAKWALRWIENGN---------------FAERLVAF 162

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   F  I  L +   M G+    + I RDE LH  F   +   ++   P   
Sbjct: 163 AAVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCEFACLLYGMLENRLP--- 219

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               +++  T++ +A  +E  +  + +P   +G+N+    +Y++F+A+R   ++G   +F
Sbjct: 220 ----EEQVHTIIRDAVAIEKEFITDALPVALIGMNSKLMSEYIEFVADRWLSELGYTKIF 275

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NPF +M E+I L+ + NFFE RV +YQ+   + 
Sbjct: 276 N-TANPFDFM-EMISLQGKTNFFEKRVGDYQKAGVMS 310


>gi|323450429|gb|EGB06310.1| hypothetical protein AURANDRAFT_65685 [Aureococcus anophagefferens]
          Length = 349

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 84/331 (25%), Positives = 149/331 (45%), Gaps = 27/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        L P+++   W+ Y  A  + W   E+ +  D+  W     L D ER  
Sbjct: 29  EPLLTEDPHRFVLFPIEHDDVWQMYKKAEASFWTAEEIDLCHDIKDWDQ--KLNDKERHF 86

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 87  IKHVLAFFAASDGIVNENLAQNFATEVQWAEARCFYGFQIAIENIHSEVYSLLIDTYIRD 146

Query: 142 ---EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
              + E       +P +T KA WAL++              D D+    +  + +   EG
Sbjct: 147 AKEKHECLTAIDTMPCVTKKAQWALRW-------------CDPDRASFAERIIAFAAVEG 193

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  +  L +   M G++   + I RDE +H +F   + ++++ + P        
Sbjct: 194 IFFSGSFCAVFWLKKRGLMPGLSFSNELISRDEGMHCDFACLLYSKLRNKLPV------- 246

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +    ++ +A  +E  +    +P   +G+N+ +  QY++F A+R    +G   L++ T N
Sbjct: 247 ETINALIGDAVTIEKEFVVSALPVELIGMNSRTMCQYIEFCADRLLLALGCPKLYEAT-N 305

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM E+I L+ + NFFE RV EY +    
Sbjct: 306 PFDWM-ELISLQGKTNFFEKRVGEYAKSGVG 335


>gi|20178418|ref|NP_619839.1| CPXV051 protein [Cowpox virus]
 gi|20153036|gb|AAM13497.1|AF482758_48 CPXV051 protein [Cowpox virus]
          Length = 333

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 153/337 (45%), Gaps = 29/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN+  + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT 
Sbjct: 11  VNLVMEPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTP 67

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +E+  IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I 
Sbjct: 68  NEKHFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLID 127

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA ++    +S                +  V +
Sbjct: 128 TYVKDSNEKNYLFNAIETMPCVKKKADWAQKWIHDSASYG--------------ERLVAF 173

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 174 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 226

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               ++  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++
Sbjct: 227 HPPSEETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIY 286

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 NVT-NPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 321


>gi|330804590|ref|XP_003290276.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
 gi|325079602|gb|EGC33194.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
          Length = 335

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 91/334 (27%), Positives = 153/334 (45%), Gaps = 28/334 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
            + ++ +L    D   L P+KY   W  Y  A  + W   E+ +  DL  W S   L D+
Sbjct: 3   QIIEEPILKENKDRFVLFPIKYPDIWSMYKQAEASFWTAEEIDLAPDLNDWSS--KLNDN 60

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +
Sbjct: 61  ERHFISNVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDT 120

Query: 138 LG---LDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
                  + +LFN    +P I  KA+WAL++     S                +  V + 
Sbjct: 121 YIKDNEQKSKLFNAIDTIPCIKKKADWALKWINNSDS--------------FAERLVAFA 166

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   F  I  L +   M G+    + I RDE LH NF   +  ++  +      
Sbjct: 167 AVEGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCNFACLLYTKLINKLES--- 223

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
               +    ++ +A + E  +  +++P   +G+N+ S  QY++F A+R    +G + ++ 
Sbjct: 224 ----KTLEAIIRDAVVCEKEFICDSLPVDLIGMNSRSMSQYIEFCADRLLVSLGYKKIYN 279

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
            + NPF WM E+I L+++ NFFE +V EY +   
Sbjct: 280 AS-NPFDWM-EMISLQRKTNFFEGKVAEYAKTGV 311


>gi|83649535|ref|YP_437970.1| ribonucleotide reductase subunit beta [Hahella chejuensis KCTC
           2396]
 gi|83637578|gb|ABC33545.1| Ribonucleotide reductase, beta subunit [Hahella chejuensis KCTC
           2396]
          Length = 405

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 133/344 (38%), Positives = 189/344 (54%), Gaps = 5/344 (1%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
             +      VN DDKR++N  +D+NQL P KY WAWE +L+A  NHW P ++ M  D+  
Sbjct: 67  EEVPQKLDPVNPDDKRVVNGMTDINQLAPFKYPWAWEFFLNANKNHWTPLDINMSQDVYD 126

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           +     LT +E+ + +  L +  +S+ L   NI LA+   +S PE + Y  RQ +EE++H
Sbjct: 127 YHH--KLTLEEKHVYENVLAYLTTSDILAMRNIGLAVMEKMSAPELQIYQARQVYEESLH 184

Query: 128 SHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           + T+Q+ I ++GLD+ E++N YR  P+I  K     +    L  P      +D  + F+ 
Sbjct: 185 TWTYQHCIETIGLDQSEIYNRYRVTPAIYRKIKMGNERISALLRPDINLRNRDDLETFVM 244

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
               F  +FEG WFY GF+ I +L R   M G  EQ QYIMRDE +H  FGI V+ QI  
Sbjct: 245 AYIFFAGIFEGCWFYNGFSPIFALQRRGLMKGTGEQLQYIMRDEVMHCAFGIRVVKQIIK 304

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           E          +  +T+  EA   E  YAH  + +  +G  A    +  +FIANRR  Q+
Sbjct: 305 EEGVTLDP---KAIKTLWEEAEAAETGYAHFLLKEPILGYTAEDHIEQFRFIANRRAKQL 361

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
            L+  F    N  PW+ E   ++KEKNFFETRVTEYQ GA L+W
Sbjct: 362 KLDEPFPGAGNALPWLDEQASMRKEKNFFETRVTEYQTGASLQW 405


>gi|256081213|ref|XP_002576867.1| ribonucleoside-diphosphate reductase small chain [Schistosoma
           mansoni]
 gi|238662153|emb|CAZ33104.1| ribonucleoside-diphosphate reductase small chain, putative
           [Schistosoma mansoni]
          Length = 365

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 96/338 (28%), Positives = 159/338 (47%), Gaps = 28/338 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +  ++ + +L        L P++Y   W  Y  A  + W   EV +  D   W+S   L 
Sbjct: 37  KSEIELEPLLKPNPHRFVLFPIEYHDVWHFYKKAVASFWTVEEVDLSKDFIHWES---LK 93

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
             ER  I   L FFA+S+ +V  N++    + +  PE R +   Q   E +HS  +  +I
Sbjct: 94  VGERHFISYVLAFFAASDGIVLENLLERFSQEVQIPEVRCFYGMQIAIENIHSEMYSLLI 153

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +  +  KA WAL +              D+   F + L  F
Sbjct: 154 DTYIKDSKERDFLFNAISNLTCVAKKAQWALDWI------------GDSKSTFAERLVAF 201

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
             V EG++F   FA I  L +   M G++   + I RDE LH +F   +   I  + P  
Sbjct: 202 AAV-EGVFFSGSFAAIFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLFKHIIKKPP-- 258

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                +++  +++ EA L+E  +  E +P   +G+N     QY++FIA+R   ++G E +
Sbjct: 259 -----KERVESIIREAVLIEQEFLSEALPVSLIGMNCKLMCQYIEFIADRLLVELGYEKM 313

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           + +++NPF +M E I ++ + NFFE RV EYQ+   + 
Sbjct: 314 Y-HSDNPFDFM-ENISIEGKTNFFEKRVGEYQRAGVMS 349


>gi|18859327|ref|NP_571525.1| ribonucleoside-diphosphate reductase subunit M2 [Danio rerio]
 gi|292624782|ref|XP_002665783.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Danio rerio]
 gi|3914657|sp|P79733|RIR2_DANRE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase protein R2 class
           I; AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|1695831|gb|AAB37103.1| ribonucleotide reductase protein R2 class I [Danio rerio]
 gi|27881838|gb|AAH44355.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|56207929|emb|CAI21240.1| ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|182889152|gb|AAI64707.1| Rrm2 protein [Danio rerio]
          Length = 386

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 91/341 (26%), Positives = 156/341 (45%), Gaps = 28/341 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
             K+  V+++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W   +
Sbjct: 58  KAKKGAVEEEPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHW---D 114

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  + 
Sbjct: 115 SLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYS 174

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  E   LFN    +P +  KA+WAL +                      + 
Sbjct: 175 LLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIG-------------DKNARYGER 221

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +    
Sbjct: 222 VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIN-- 279

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
                K  ++  + ++  A  +E  +  + +P   +G+N    +QY++F+A+R   ++G 
Sbjct: 280 -----KPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGF 334

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           + +++  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 335 DKVYRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 373


>gi|49899161|gb|AAH75746.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
          Length = 386

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 91/341 (26%), Positives = 157/341 (46%), Gaps = 28/341 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
             K+  V+++ +L        + P++Y   W+ Y  A  + W   EV +  DL  W   +
Sbjct: 58  KAKKGAVEEEPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHW---D 114

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L D+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  + 
Sbjct: 115 SLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYS 174

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  E   LFN    +P +  KA+WAL +                      + 
Sbjct: 175 LLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIG-------------DKNARYGER 221

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +    
Sbjct: 222 VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL---- 277

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
               +K  ++  + ++  A  +E  +  + +P   +G+N    +QY++F+A+R   ++G 
Sbjct: 278 ---ISKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGF 334

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           + +++  ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 335 DKVYRV-ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 373


>gi|195401438|ref|XP_002059320.1| GJ18335 [Drosophila virilis]
 gi|194142326|gb|EDW58732.1| GJ18335 [Drosophila virilis]
          Length = 394

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 87/344 (25%), Positives = 157/344 (45%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++    + +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 63  MEKIAAQFDPTVEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDW- 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               LTD+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 --ARLTDNERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSE 179

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 180 MYSVLIDTYIRDPHQRDYLFNAIETMPAVKRKADWALSWISS-------------KAANF 226

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 227 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 286

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +  +++   ++ +A  +E  +  + +P   +G+N     +Y++F+A+R   +
Sbjct: 287 Q-------RPCRERIIEIISDAVTIEQEFLTDALPVNLIGMNCALMSEYIEFVADRLLVE 339

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G+  L+  T+NPF +M E+I L  + NFFE +V EYQ+     
Sbjct: 340 LGVGKLYN-TKNPFTFM-EMISLDGKTNFFEKKVGEYQRMGVTS 381


>gi|154337607|ref|XP_001565036.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           braziliensis MHOM/BR/75/M2904]
 gi|134062075|emb|CAM45178.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 392

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 90/340 (26%), Positives = 155/340 (45%), Gaps = 28/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +  N +++ +         L P++Y   W KY    +  W   E+ + +D+  W     
Sbjct: 64  AEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDLGNDMKDW---VA 120

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q   E +HS T+  
Sbjct: 121 LNDGERHFIKHVLAFFAGSDGIVVENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSV 180

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           ++ +   D  E   L +  + +P I  KA WA+++  +                F + L 
Sbjct: 181 LLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS-------------SASFQERLI 227

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
            F  V EG++F   F  +  L +   M G+    + I RDE LH +F   +       N 
Sbjct: 228 GFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------NS 280

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G E
Sbjct: 281 HIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLLVSLGEE 340

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 341 KHYNATQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 378


>gi|291244313|ref|XP_002742041.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 463

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 91/344 (26%), Positives = 162/344 (47%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           +     +    ++ +L    D   + P+KY   W+ Y  A  + W   EV +  DL  W 
Sbjct: 131 LTQATTKDLEAEETLLKPNIDRFVVFPIKYQDIWKYYKKAQASFWTVEEVDLGKDLPDW- 189

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L ++ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 190 --VKLKEEERRFISHVLAFFAASDGIVLENLVQRFSQEVQVAEARCFYGFQIAMENVHSE 247

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   ++ E   LF+    +P +  KA+WA+++ Q+             +  F 
Sbjct: 248 MYSLLIDAYIKEQEEKTRLFHAIDNMPCVKKKADWAIEWIQS------------EESSFG 295

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F  V EG++F   FA I    +   + G+    + I RDE LH +F   + + + 
Sbjct: 296 ERLVAFAAV-EGIFFSGAFASIFWFKKRGLLPGLTFSNELISRDEGLHCDFACLIFSHLT 354

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   K  +++ R ++ +A  +E  + +E +P G +G+N      Y++F+A+R   +
Sbjct: 355 -------YKPSKERIRNIITQAVDIEKEFWNEALPVGLIGMNVTLMNYYVEFVADRLLLE 407

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  + ++ + ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 408 LNCDKVY-HRENPFDFM-ENISLEGKTNFFEKRVGEYQKANVMS 449


>gi|223996990|ref|XP_002288168.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975276|gb|EED93604.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 335

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 93/351 (26%), Positives = 157/351 (44%), Gaps = 30/351 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S  +  E      ++ +L        L P+K    W+ Y  A  + W   E+ + +DL 
Sbjct: 1   MSDHRRAESEGRHAEEPLLKENPGRFVLFPIKEPEIWKMYKKAEASFWTAEEIDLAEDLK 60

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W+S   L+ +ER  +   L FFA+S+ +V  N+       +++ E R +   Q   E +
Sbjct: 61  DWES---LSINERHFVSHVLAFFAASDGIVNENLTGNFSTEVTSAEARCFYGFQIAVENI 117

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS T+  +I +   D  E   L N    VP +  KANWAL++                + 
Sbjct: 118 HSETYSLLIDTYIKDAQEKDHLLNAIETVPCVQKKANWALRWCDA------------GNA 165

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
            F +    F  V EG++F   F  I  L +   M G+    + I RDE LH +F   + +
Sbjct: 166 SFAERCIAFAAV-EGIFFSGSFCAIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLIYS 224

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           ++  + P       + +   ++  A  +E  +  + +P   +G+N+    QY++F A+R 
Sbjct: 225 KLVNQLP-------ESRIEEIITNAVEIEKEFVSDALPVELIGMNSKLMCQYIEFCADRL 277

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL--KWD 352
              +G +  +    NPF WM E+I L+ + NFFE RV EY +      K D
Sbjct: 278 LGALGCKKHY-MAVNPFEWM-EMISLQGKTNFFEKRVGEYAKSGVGVNKDD 326


>gi|302678465|ref|XP_003028915.1| hypothetical protein SCHCODRAFT_83117 [Schizophyllum commune H4-8]
 gi|300102604|gb|EFI94012.1| hypothetical protein SCHCODRAFT_83117 [Schizophyllum commune H4-8]
          Length = 331

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 92/333 (27%), Positives = 154/333 (46%), Gaps = 27/333 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
             ++ +L        L P++Y   W+ Y  A  + W   E+ +  DL  W+  N + D+E
Sbjct: 4   ASEEPLLKESIRRFVLFPIQYPEIWQMYKKAEASFWTAEEMDLSKDLHDWQ--NRMNDNE 61

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N++      +  PE R +   Q   E +HS T+  +I + 
Sbjct: 62  RHFISHVLAFFAASDGIVNENLLERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTY 121

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             +  E   LFN    +P +  KA WAL++              D    F   L  F  V
Sbjct: 122 IREAAEREHLFNAVETIPCVARKAQWALRWIN------------DDRSSFGIRLVAFAAV 169

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE +H +F   +   ++        +
Sbjct: 170 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELITRDEGMHTDFACLLFAHLRR-------R 221

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
                 R ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +G E ++  
Sbjct: 222 PHPDVVRRIIMEAVTIEQEFLTDALPVSLIGMNSTLMCQYIEFVADRLLVALGNEKVYNV 281

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           T NPF +M  +I L+ + NFFE RV++Y+  A 
Sbjct: 282 T-NPFDFMD-MISLQGKTNFFEKRVSDYKMAAV 312


>gi|15229476|ref|NP_189000.1| RNR2A (RIBONUCLEOTIDE REDUCTASE 2A); ribonucleoside-diphosphate
           reductase [Arabidopsis thaliana]
 gi|27735240|sp|P50651|RIR2A_ARATH RecName: Full=Ribonucleoside-diphosphate reductase small chain A;
           AltName: Full=Ribonucleoside-diphosphate reductase R2A
           subunit; Short=AtRNR2; Short=Protein R2at; AltName:
           Full=Ribonucleotide reductase small subunit A
 gi|13937232|gb|AAK50108.1|AF372971_1 AT3g23580/MDB19_7 [Arabidopsis thaliana]
 gi|9294514|dbj|BAB02776.1| ribonucleotide reductase [Arabidopsis thaliana]
 gi|23505945|gb|AAN28832.1| At3g23580/MDB19_7 [Arabidopsis thaliana]
 gi|332643258|gb|AEE76779.1| Ribonucleoside-diphosphate reductase small chain A [Arabidopsis
           thaliana]
          Length = 341

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 97/334 (29%), Positives = 157/334 (47%), Gaps = 29/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L A++    + P++Y   WE Y  A  + W   EV +  D+  W+    LTD E+
Sbjct: 17  SEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWE---ALTDSEK 73

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +  
Sbjct: 74  HFISHILAFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFI 133

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I+ KA W L + Q+                F   L   +   
Sbjct: 134 KDSKEKDRLFNAIETIPCISKKAKWCLDWIQS-------------PMSFAVRLVA-FACV 179

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +F   + + ++ + P      
Sbjct: 180 EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPL----- 234

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +K   ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R    +G E  +K  
Sbjct: 235 --EKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-A 291

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF WM E I L+ + NFFE RV EYQ+ + + 
Sbjct: 292 ENPFDWM-EFISLQGKTNFFEKRVGEYQKASVMS 324


>gi|79160106|gb|AAI08038.1| Rrm2b protein [Danio rerio]
          Length = 349

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 106/352 (30%), Positives = 167/352 (47%), Gaps = 31/352 (8%)

Query: 5   TGLSPIQAGEKRVN---VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T ++  Q G K V+   V+D+ +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 10  TVITGYQNGHKDVDPNSVEDEPLLRENPKRFVIFPIQYPDIWKMYKQAQASFWTVEEVDL 69

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   +GL  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q 
Sbjct: 70  SKDLTHW---DGLKSEEKHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQI 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +   D  E   LFN  + +P +  KA+WALQ+             
Sbjct: 127 LIENVHSEMYSMLINTYIRDLKERDYLFNAVQTMPCVRRKADWALQWI------------ 174

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F + L  F  V EG++F   FA I  L R   M G+    + I RDE LH NF 
Sbjct: 175 SDTNSTFGERLVAFAAV-EGIFFSGSFAAIYWLKRRGLMPGLTYSNELISRDEGLHCNFA 233

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         K    +   ++ +A  +E  +  E +P   +G+N    +QY++F
Sbjct: 234 CLMYSYLVK-------KPSVDRVNDIIAKAVSIEQEFLTEALPVNLIGMNCSLMKQYIEF 286

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +GL   +  +ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 VADRLLTDLGLPKAY-CSENPFDFM-ESISLEGKTNFFEKRVAEYQRLGVMS 336


>gi|146090952|ref|XP_001466403.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           infantum JPCM5]
 gi|321399462|emb|CBZ08664.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania infantum JPCM5]
          Length = 392

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 95/361 (26%), Positives = 164/361 (45%), Gaps = 37/361 (10%)

Query: 2   ANNTGLSPIQAGE---------KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNN 52
           A +  + P+ AG          K  N +++ +         L P++Y   W KY    + 
Sbjct: 43  AEDLVMKPVAAGTEVLTADKVAKGTNAEEEPLQQENPLRYVLFPIQYHDIWRKYKEQESC 102

Query: 53  HWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPE 112
            W   E+ + +D+  W +   L D ER  IK  L FFA S+ +V  N+       +  PE
Sbjct: 103 IWTVEEIDLGNDMKDWAT---LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPE 159

Query: 113 CRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTL 169
            R +   Q   E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  + 
Sbjct: 160 ARAFYGFQLMMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS- 218

Query: 170 SSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMR 229
                          F + L  F  V EG++F   F  +  L +   M G+    + I R
Sbjct: 219 ------------SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISR 265

Query: 230 DESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNA 289
           DE LH +F   +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA
Sbjct: 266 DEGLHTDFACLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNA 319

Query: 290 PSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
               QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFFE +V EYQ+   +
Sbjct: 320 ELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVM 377

Query: 350 K 350
            
Sbjct: 378 S 378


>gi|326797773|ref|YP_004315592.1| ribonucleoside-diphosphate reductase [Sphingobacterium sp. 21]
 gi|326548537|gb|ADZ76922.1| Ribonucleoside-diphosphate reductase [Sphingobacterium sp. 21]
          Length = 323

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 89/335 (26%), Positives = 156/335 (46%), Gaps = 30/335 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           ++ +++ +L    D   +LP+ Y   W+ Y     + W   E+ +  DL  W     L D
Sbjct: 1   MSQENEVLLRENKDRFVILPINYPAIWDMYKKHEASFWTAEEIDLSGDLKDW---ANLND 57

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            ER  I   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I 
Sbjct: 58  GERHFISHVLAFFAASDGIVNENLAINFMSEVQLPEARSFYGFQIAMENIHSETYALLID 117

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LF+    V  +  KA WAL++ +  S                 +  V +
Sbjct: 118 TYVKDPVEKDRLFHAIETVECVKKKAEWALRWIENGS---------------FAERLVAF 162

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   F  I  L +   M G+    + I RDE LH  F   + + ++ + P   
Sbjct: 163 AAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCEFACLLYSMLEAKLP--- 219

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               +++ + ++ +A  +E  +  + +P   +G+NA   +QY++F+A+R   ++G    +
Sbjct: 220 ----KERVQEIIIDAVEIEKEFITDALPVKLIGMNADLMKQYIEFVADRWLVELGNSKYY 275

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
             T NPF +M E+I L+ + NFFE RV +YQ+   
Sbjct: 276 NAT-NPFDFM-ELISLQGKTNFFEKRVGDYQKSGV 308


>gi|2465173|emb|CAA71741.1| ribonucleotide reductase (Class I) [Trypanosoma brucei brucei]
          Length = 337

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 158/333 (47%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W   E+ + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKKAESSIWTVEEIDLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|156087150|ref|XP_001610982.1| ribonucleoside-diphosphate reductase small subunit [Babesia bovis
           T2Bo]
 gi|154798235|gb|EDO07414.1| ribonucleoside-diphosphate reductase small subunit, putative
           [Babesia bovis]
          Length = 339

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 98/333 (29%), Positives = 164/333 (49%), Gaps = 29/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L    + N L P+KY   WE Y  A  + W   E+ +  DL  W +   LT+ E 
Sbjct: 19  SEEFILVEDPNRNGLYPIKYPDFWEWYKKAQASFWTSEEIDLSSDLKDWGT---LTEGEH 75

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             IK  L FFA+S+ +V  N+ L   + +  PE + +   Q   E +HS T+  +I    
Sbjct: 76  HFIKNVLAFFAASDGIVLENLALRFLKDVKLPEAKFFYCFQITVENIHSETYSLLIEQYI 135

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            DE E   LF     + ++  KA WA ++                D++   +  V Y   
Sbjct: 136 RDEAEKDRLFRAIETIDAVRDKAIWAAKWMN--------------DEKSFAERIVAYAAV 181

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +FG  + +++K + P      
Sbjct: 182 EGIFFSGSFCAIFWLKKRGLMPGLTFSNELIARDEGLHADFGCFIYSKLKHKLPA----- 236

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +  + ++ EA  +E  +  +++P   +G+N+    QY++F+A+R    +G+ P++K T
Sbjct: 237 --ECVQQIIKEAVAVERVFVCDSLPTDLIGMNSMLMAQYIEFVADRLLQALGVPPVYK-T 293

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +NPF WM E+I ++ + NFFE RV EYQ+   L
Sbjct: 294 KNPFEWM-ELISVQGKTNFFEKRVGEYQKSGIL 325


>gi|157126966|ref|XP_001654749.1| ribonucleoside-diphosphate reductase small chain [Aedes aegypti]
 gi|15638625|gb|AAL05057.1|AF411297_1 ribonucleotide reductase 2 [Aedes aegypti]
 gi|82469974|gb|ABB77235.1| ribonucleotide reductase small subunit R2 [Aedes aegypti]
 gi|108873070|gb|EAT37295.1| ribonucleoside-diphosphate reductase small chain [Aedes aegypti]
          Length = 397

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 161/352 (45%), Gaps = 28/352 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A N   +  +  +   +   + +L        + P++Y   W+ Y  A  + W   EV 
Sbjct: 57  LAKNELSAAQKREQTPFDPSIEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVD 116

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  DLA W+    L   E+  I   L FFA+S+ +V  N+V    + +   E R +   Q
Sbjct: 117 LSKDLADWE---KLKSGEKHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQ 173

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E VHS  +  +I +   D  E   LFN    +P +  KA+WAL +  +         
Sbjct: 174 IAMENVHSEMYSLLIDTYIRDSKEREYLFNAIDNLPCVKKKADWALNWISS--------- 224

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
                +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F
Sbjct: 225 ----KKANFGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDF 280

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              +   +         K  Q++   ++ EA L+E  +  + +P   +G+N     QY++
Sbjct: 281 ACLMFKYLVQ-------KPSQERVIEIIREAVLIEQEFLTKALPVDLLGMNCDLMSQYIE 333

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F+A+R   ++G++ ++  T+NPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 334 FVADRLLLELGIDKIYN-TKNPFSFM-EFISLEGKTNFFEKKVGEYQKWGVM 383


>gi|4894211|gb|AAD32302.1| ribonucleotide reductase small subunit [Glycine max]
          Length = 339

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 89/342 (26%), Positives = 155/342 (45%), Gaps = 29/342 (8%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
            G  +   + + +L  +S    + P++Y   WE Y  A  + W   EV +  D+  W++ 
Sbjct: 7   NGVDKARDEQEPILMEQSQRFCMFPIRYKQIWEMYKKAEASFWTAEEVDLSYDVQHWET- 65

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
             L+  E+  I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +
Sbjct: 66  --LSVSEKHFITHVLAFFAASDGIVLENLAARFLSDVQIPEARAFYGFQIAMENIHSEMY 123

Query: 132 QYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQD 188
             ++ +   D  E   LFN    +P +  KA WAL +  + +S                +
Sbjct: 124 SLLLETYIKDSREKHKLFNAIENLPCVARKAEWALSWIHSSTS--------------FAE 169

Query: 189 LFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIE 248
             V +   EG++F   F  I  L +   M G+    + I RDE LH +F   + + ++  
Sbjct: 170 RLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRK- 228

Query: 249 NPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 308
                      +   ++HEA  +E  +  + +P   +G+N+    QY++F+A+R    +G
Sbjct: 229 ------PLISDQVHKLVHEAVEIETEFVCDALPCALIGMNSVLMSQYIKFVADRLLVALG 282

Query: 309 LEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            +  +   ENPF WM E I L+ + NFFE RV +YQ+ + + 
Sbjct: 283 YQRKYNV-ENPFDWM-EFISLQGKANFFERRVGDYQKASVMS 322


>gi|110636874|ref|YP_677081.1| ribonucleoside-diphosphate reductase 1 subunit beta [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110279555|gb|ABG57741.1| ribonucleoside-diphosphate reductase 1, beta subunit [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 324

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 153/332 (46%), Gaps = 29/332 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    +   L P+K+   W  Y     + W   E+ +  DL  W     L D ER 
Sbjct: 5   EEPLLKENKNRFVLFPIKHDDIWAMYKQEEASFWTAEEIDLSQDLIDW---ANLNDGERH 61

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+ +     +  PE + +   Q   E +HS T+  +I +   
Sbjct: 62  FISHVLAFFAASDGIVNENLAVNFLEKVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIK 121

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    VP +  KA+WAL++    S                 +  + +   E
Sbjct: 122 DPKEKDRLFNAIDTVPCVKKKADWALRFIDNGS---------------FIENIIAFAAVE 166

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  +  L +   M G++   + I RDE LH +F   +  +          K  
Sbjct: 167 GIFFSGSFCSVFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLYTKYIN------NKLP 220

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            ++   ++ EA  +E  +  +++P   +G+NA   +QY++F+A+R    +G+   F  T 
Sbjct: 221 AERVIQIILEAVEIEKEFVTDSLPVDLIGMNARLMQQYIEFVADRLLVALGVPKQFNAT- 279

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E+I L+ + NFFE RV+EYQ+   +
Sbjct: 280 NPFDFM-EMISLQGKTNFFEKRVSEYQKSGVM 310


>gi|55742360|ref|NP_001007164.1| ribonucleoside-diphosphate reductase subunit M2 B [Danio rerio]
 gi|29561808|emb|CAD87804.1| novel protein similar to vertebrate ribonucleotide reductase M2 B
           (TP53 inducible) (RRM2B) [Danio rerio]
          Length = 349

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 105/352 (29%), Positives = 167/352 (47%), Gaps = 31/352 (8%)

Query: 5   TGLSPIQAGEKRVN---VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           T ++  Q G K V+   V+D+ +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 10  TVITGYQNGHKDVDPNSVEDEPLLRENPKRFVIFPIQYPDIWKMYKQAQASFWTVEEVDL 69

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   +GL  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q 
Sbjct: 70  SKDLTHW---DGLKSEEKHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQI 126

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +   D  E   LFN  + +P +  KA+WALQ+             
Sbjct: 127 LIENVHSEMYSMLINTYIRDLKERDYLFNAVQTMPCVRRKADWALQWI------------ 174

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F + L  F  V EG++F   FA I  L +   M G+    + I RDE LH NF 
Sbjct: 175 SDTNSTFGERLVAFAAV-EGIFFSGSFAAIYWLKKRGLMPGLTYSNELISRDEGLHCNFA 233

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +         K    +   ++ +A  +E  +  E +P   +G+N    +QY++F
Sbjct: 234 CLIYSYLVK-------KPSVDRVNDIIAKAVSIEQEFLTEALPVNLIGMNCSLMKQYIEF 286

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +GL   +  +ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 VADRLLTDLGLPKAY-CSENPFDFM-ESISLEGKTNFFEKRVAEYQRLGVMS 336


>gi|281200507|gb|EFA74725.1| ribonucleotide reductase small subunit [Polysphondylium pallidum
           PN500]
          Length = 335

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 160/331 (48%), Gaps = 28/331 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   L P+KY   W+ Y  A  + W   E+ +  D+  W+  N L D+ER 
Sbjct: 6   EEPILKENKDRFVLFPIKYADIWQMYKKAEASFWTAEEIDLAGDIGDWE--NKLNDNERH 63

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   
Sbjct: 64  FITNVLAFFAASDGIVNENLATKFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDTYIK 123

Query: 141 D---EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D   +  +F+    +P++  KA+WAL++                 + F + L  F  V E
Sbjct: 124 DSETKRNIFHAIDTIPAVKKKADWALRWI-------------SNSKSFAERLVAFAAV-E 169

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +++ +  +      
Sbjct: 170 GIFFSGSFCSIFWLKKRGLMHGLTFSNELISRDEGLHCDFACLLYQKLQNKLDNNT---- 225

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
                T++ +A   E  +  E++P   +G+N+ S  QY++F A+R    +G + ++  + 
Sbjct: 226 ---IETIIRDAVACEKEFITESLPVDLIGMNSRSMSQYIEFCADRLLLSLGYKKIYN-SS 281

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           NPF WM E+I L+++ NFFE +V+EYQ+   
Sbjct: 282 NPFDWM-EMISLQRKTNFFEGKVSEYQKSGV 311


>gi|194883840|ref|XP_001976005.1| GG22616 [Drosophila erecta]
 gi|190659192|gb|EDV56405.1| GG22616 [Drosophila erecta]
          Length = 393

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 87/342 (25%), Positives = 154/342 (45%), Gaps = 28/342 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 62  MERSVTPFDPSLEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWH 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 ---RLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENVHSE 178

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 179 MYSVLIDTYIRDPNQREYLFNAIETMPAVKRKADWALSWISS-------------KSANF 225

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 226 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 285

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +   ++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 286 Q-------RPKHERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVE 338

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   
Sbjct: 339 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVAEYQRMGV 378


>gi|94986920|ref|YP_594853.1| ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731169|emb|CAJ54531.1| Ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 333

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 139/337 (41%), Positives = 191/337 (56%), Gaps = 5/337 (1%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
            VN  DKR++N ++D+NQLLP +Y WAW+ +L A  NHW P E+ M  D+  +     LT
Sbjct: 2   PVNASDKRIVNGKTDINQLLPFRYPWAWDFFLKANQNHWTPLEISMSQDVYDYNHT--LT 59

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +ER +    L +  +S+ L   NI LA+   ++ PE + Y  RQ +EEA+H+ T+Q+ I
Sbjct: 60  TNERHVFDNVLAYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEEALHTWTYQHCI 119

Query: 136 TSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            SLGL++ E++N YR VP I  K   + +  + +         KD   EF+     F  +
Sbjct: 120 ESLGLEQSEIYNRYRVVPEIYGKILLSNKRLEQVLRSDINLSDKDNLHEFIMSYIFFAAI 179

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
           FEG WFY GF+ I SL R   M G AEQ+QYI+RDE LH  FGI VI  +  E       
Sbjct: 180 FEGCWFYNGFSPIFSLQRRGLMKGTAEQFQYILRDEVLHCTFGITVIKGLIEEENITLDP 239

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
                 R +  E    EIAYA+  + +  +G NA       +FIANRR  Q+G++  F  
Sbjct: 240 T---AVRQLWDEVEAAEIAYANYILHEPIIGYNADLHIGQFRFIANRRSRQLGMKEPFPG 296

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +N  PW+ E  +L+KEKNFFETRVTEYQ G  LKWD
Sbjct: 297 AKNVLPWLDEQSNLRKEKNFFETRVTEYQTGGGLKWD 333


>gi|167519412|ref|XP_001744046.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778008|gb|EDQ91624.1| predicted protein [Monosiga brevicollis MX1]
          Length = 329

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 94/339 (27%), Positives = 160/339 (47%), Gaps = 28/339 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
              +  + +L A      +LP+++   W+ Y  A  + W   EV +  DL  W   N L 
Sbjct: 4   PEEIQAEPLLRANPRRFVILPIQHDAIWKMYKKAEASFWTVEEVDLGRDLVDW---NKLN 60

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DE+  IK  L FFA+S+ +V  N+V      +  PE R +   Q   E +HS  +  +I
Sbjct: 61  KDEQFFIKHVLAFFAASDGIVNENLVERFMTEVQLPEARCFYGFQIAIENIHSEMYSRLI 120

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P++  KA WA+++                D+    +  V 
Sbjct: 121 ETYVNDSAEKDSLFNAIETLPAVRRKAEWAMRWI-------------SHDKASFGERVVA 167

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K      
Sbjct: 168 FAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLMFSMLKK----- 222

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             +  +++   ++ +A  +E  +    +P G +G+NA   +QY++F+++R    +G E +
Sbjct: 223 --RPSKERVTGIIMDAVEIEQDFLTNALPCGLLGMNATLMKQYIEFVSDRLLVALGCEKI 280

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           F  +ENPF +M E I ++ + NFFE RV EYQ+   +  
Sbjct: 281 FN-SENPFDFM-ESISIEGKTNFFEKRVGEYQKAGVMAD 317


>gi|322493026|emb|CBZ28311.1| ribonucleoside-diphosphate reductase small chain,putative
           [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 388

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 92/352 (26%), Positives = 158/352 (44%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 48  APGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 107

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W     L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 108 GNDMKDW---AALNDGERHFIKHVLAFFAGSDGIVVENLAQRFMSDVKVPEARAFYGFQL 164

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 165 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQRKAEWAVRWIGS---------- 214

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 215 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 270

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 271 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 324

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 325 VADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 374


>gi|149279601|ref|ZP_01885730.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter
           sp. BAL39]
 gi|149229637|gb|EDM35027.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter
           sp. BAL39]
          Length = 324

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 153/334 (45%), Gaps = 30/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
           +++ +L    D   LLP+KY   WE Y  +  + W   E+ + DD   W   + L D ER
Sbjct: 3   EEEVLLKENKDRFVLLPIKYPEIWEMYKKSEASFWTAEEIDLSDDQKHW---DNLNDGER 59

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FF++S+ +V  N+ +     +  PE R +   Q   E +HS T+  +I +  
Sbjct: 60  HFISHILAFFSASDGIVNENLAVNFMSEVQLPEARCFYGFQIMMENIHSETYALLIDTYI 119

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LF+    VP +  KA WAL++                      +  V +   
Sbjct: 120 KDPEEKDRLFHAIETVPCVKKKAEWALRWIDN---------------GNFAERLVAFAAV 164

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE  H  F   + + +K +        
Sbjct: 165 EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGSHCEFACLLYSMLKNKLS------ 218

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            ++    ++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G   ++ + 
Sbjct: 219 -EEHVHGIIRDAVEIEKEFVTDALPVALIGMNAKLMSQYIEFVADRWLQELGYTKIY-HA 276

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E+I L+ + NFFE RV +YQ+   L 
Sbjct: 277 TNPFDFM-EMISLQGKTNFFEKRVGDYQKSGVLT 309


>gi|90660281|gb|ABD97395.1| ribonucleotide reductase small subunit [Cowpox virus]
          Length = 333

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 152/337 (45%), Gaps = 29/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN+  + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT 
Sbjct: 11  VNLVMEPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTP 67

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I 
Sbjct: 68  DEKYFIKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLID 127

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA ++                D     +  + +
Sbjct: 128 TYVKDSNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAF 173

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 174 TAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 226

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               ++  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++
Sbjct: 227 HPPSEETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIY 286

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 NVT-NPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 321


>gi|195027582|ref|XP_001986661.1| GH20400 [Drosophila grimshawi]
 gi|193902661|gb|EDW01528.1| GH20400 [Drosophila grimshawi]
          Length = 393

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 88/352 (25%), Positives = 159/352 (45%), Gaps = 31/352 (8%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A  T +  + A     +   + +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 57  AKGTIMEKVAAP---FDPSIEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDL 113

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+  W     LTD+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q 
Sbjct: 114 SKDMTDW---VRLTDNERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQI 170

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +   D  +   LFN    +P++  KA+WAL +  +          
Sbjct: 171 AMENVHSEMYSVLIDTYIRDPHQRDYLFNAIETMPAVKRKADWALSWISS---------- 220

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                    +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 221 ---KAANFGERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFA 277

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
           + +   +         +  +++   ++ +A  +E  +  + +P   +G+N     +Y++F
Sbjct: 278 VMMFQHLVQ-------RPSRERIIEIVSDAVTIEQEFLTDALPVNLIGMNCALMSEYIEF 330

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R   ++G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+     
Sbjct: 331 VADRLLVELGVGKIYN-TKNPFTFM-EMISLDGKTNFFEKKVGEYQRMGVTS 380


>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase
           Subunit R2
          Length = 332

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 93/335 (27%), Positives = 156/335 (46%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 10  VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 66

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 67  RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 126

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++                 +    +  V +  
Sbjct: 127 IKDPKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAFAA 173

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +   +         K
Sbjct: 174 VEGIFFSGSFASIFWLKKRGPMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HK 226

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 227 PSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRV 286

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 319


>gi|300709535|ref|YP_003735349.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
 gi|299123218|gb|ADJ13557.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
          Length = 330

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 161/331 (48%), Positives = 229/331 (69%), Gaps = 4/331 (1%)

Query: 23  RMLN--ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            ++N  +  D N++LP+ Y WA E Y +   N+W P EVPM DD+  W++ + L+ +ER 
Sbjct: 2   PLINTESHHDPNKILPIDYDWAREYYKAGVANNWTPEEVPMADDVHQWEN-DELSSEERQ 60

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +++ NLGFF+++ESL ANNIVLA+Y H++ PECRQYLLRQA+EEA+H+ TF Y   SLG 
Sbjct: 61  LVEWNLGFFSTAESLTANNIVLAVYDHVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGF 120

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           D   L+ MY  +P+I AK  + +  TQ +  P F   + +  +EFL+DL  FYV+ EG++
Sbjct: 121 DPEYLYGMYDRIPAIEAKDEFVVDLTQVIDDPDFEISSDEDVREFLRDLVGFYVIMEGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY GFA +L L R  KMVG+ EQ++YIMRDESLHLNFG+D+IN ++ EN  +WT  F+ +
Sbjct: 181 FYAGFAMMLGLKRQGKMVGVGEQFEYIMRDESLHLNFGVDLINTVREENSGIWTDVFEAE 240

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              +L EA  LE  YA E  P+  +G+      +Y++++A+RR  Q+G+EP++  T+NPF
Sbjct: 241 IEGLLREAVELERTYAREACPEEVLGMGPAQFAEYVEYVADRRLDQLGMEPVYD-TDNPF 299

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           PWM+E +DL KEKNFFET V EYQ G  L+W
Sbjct: 300 PWMAEQVDLNKEKNFFETNVAEYQSGGSLEW 330


>gi|255079598|ref|XP_002503379.1| predicted protein [Micromonas sp. RCC299]
 gi|226518645|gb|ACO64637.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 95/332 (28%), Positives = 156/332 (46%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L+   D   + P+KYG  WE Y  A  + W   EV + DD+  W   N L +DE+  
Sbjct: 15  EPLLDPNDDRFTMFPIKYGDIWEMYKKAEASFWTAEEVDLSDDMVHW---NKLNNDEKHF 71

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I +   D
Sbjct: 72  IKHILAFFAASDGIVLENLGVRFMGEVQFPEARAFYGFQIAIENIHSEMYSLLIDAYVKD 131

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LF   + +P I  KA+WA ++ ++ +                 +  + +   EG
Sbjct: 132 AQEKTYLFQAIQNIPCIAKKADWAFKWIESSAD--------------FAERLIAFACIEG 177

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   + + I         K  +
Sbjct: 178 IFFSGSFCSIYWLKKRGLMPGLTFSNELISRDEGLHRDFACLLYSYINK-------KPNE 230

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
              R ++ EA  +E  +  + +P   VG+NA    +Y++F+A+    Q+G+   +    N
Sbjct: 231 SVVRQIVKEAVEIEKEFVCDALPCALVGMNADLMSEYIEFVADHLLGQLGMSKEYNAA-N 289

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF WM E+I L+ + NFFE RV EYQ+   + 
Sbjct: 290 PFDWM-ELISLQGKTNFFEKRVGEYQKSGVMN 320


>gi|301117384|ref|XP_002906420.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
 gi|262107769|gb|EEY65821.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
          Length = 379

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 86/346 (24%), Positives = 160/346 (46%), Gaps = 28/346 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S  +  E    +  +  L    +   L P++    W+ Y  A  + W   E+ +  DL 
Sbjct: 45  MSEFKRKEMNGEIPIEPFLVENPNRFVLFPIQEHEVWQMYKKAEASFWTAEELDLVHDLK 104

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   + LTD+ER  IK  L FFA+S+ +V  N+ +     +  PE R +   Q   E +
Sbjct: 105 DW---SKLTDNERHFIKHVLAFFAASDGIVNENLAMNFSNEVQVPEARCFYGFQIAIENI 161

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I +   D  E   L      +P +T KA+WA+++              D   
Sbjct: 162 HSEVYSLLIDTYIKDAIEKDHLLRAIETIPCVTKKAHWAIKW-------------CDPRV 208

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  + +   EG++F   F  I  L +   M G++   + I RDE +H +F   + +
Sbjct: 209 SSYPERLLAFAAVEGIFFSGSFCSIFWLKKRGLMPGLSFSNELISRDEGMHTDFACLLYS 268

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
           ++  + P       + +   ++ +A  +E  +  +++P   +G+N+    QY++F+A+R 
Sbjct: 269 KLVTKLP-------ESRVHEIVRDAVTIEHEFVRDSLPVELIGMNSGLMCQYIEFVADRL 321

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            + +G+  ++ + +NPF WM  +I L+ + NFFE RV EY +    
Sbjct: 322 LYSLGVSKIY-HAKNPFDWMD-MISLQGKTNFFEKRVGEYSKAGVG 365


>gi|73544537|ref|XP_848163.1| ribonucleoside-diphosphate reductase small chain [Leishmania major
           strain Friedlin]
 gi|321438516|emb|CBZ12275.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania major strain Friedlin]
          Length = 388

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 160/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 48  AAGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 107

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W +   L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 108 GNDMKDWAT---LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQL 164

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 165 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS---------- 214

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 215 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 270

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 271 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 324

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  ++ T+ PF +M E+I L+ + NFFE RV EYQ+   + 
Sbjct: 325 VADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFFEKRVGEYQKAGVMS 374


>gi|226528734|ref|NP_001150842.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
 gi|195642302|gb|ACG40619.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 87/333 (26%), Positives = 150/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L   SD   + P+++   WE Y  A  + W   EV +  D   W     L+ DER 
Sbjct: 14  EEPLLAESSDRFSMFPIRFPQIWEFYKKAVASFWTAEEVGLSADARHWDE--ALSPDERH 71

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  ++ +   
Sbjct: 72  FISHVLAFFAASDGIVLENLASRFMTDVQVAEARAFYGFQIAIENIHSEMYSLLLETYIR 131

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LF     VP++  KA+WA+++                      +  V +   E
Sbjct: 132 DHVEKDRLFRAIDTVPAVRRKADWAMRWIDGGER--------------FAERIVAFACVE 177

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +   ++ +         
Sbjct: 178 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYELLRNKLD------- 230

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + + R ++ +A  +E  +  + +P   VG+N     QY++F+A+R    +G + ++  T 
Sbjct: 231 EARVREIVADAVDIEREFVCDALPVALVGMNGDLMSQYIEFVADRLLMALGCKKMYNVT- 289

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF WM E+I L  + NFFE RV +YQ+ + + 
Sbjct: 290 NPFDWM-ELISLMGKTNFFEKRVGDYQKASVMN 321


>gi|311748425|ref|ZP_07722210.1| ribonucleoside-diphosphate reductase, beta subunit [Algoriphagus
           sp. PR1]
 gi|126576938|gb|EAZ81186.1| ribonucleoside-diphosphate reductase, beta subunit [Algoriphagus
           sp. PR1]
          Length = 326

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 88/335 (26%), Positives = 153/335 (45%), Gaps = 29/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           +  + +L+   +   L P+++   WE Y  A  + W   E+ +  D+  WKS   L D E
Sbjct: 1   MQQEPILSENKNRFVLFPIQHADIWEYYKKAEASFWTAEEIDLGQDMVDWKS---LNDGE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I + 
Sbjct: 58  RHFISHVLAFFAASDGIVNENLAEHFVAEVQYTEAKFFYGFQIAMENIHSETYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +  +  KA+WAL++                   F + L  F  V
Sbjct: 118 IKDPSERDKLFNAIEHIDCVKKKADWALRWIDN--------------GNFQERLIAFAAV 163

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G+    + I RDE LH +F   +  +           
Sbjct: 164 -EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACHLYTKHV------VNP 216

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             ++  R ++ +A  +E  +  + +P   +G+N+    QY++F+A+R   ++  E ++  
Sbjct: 217 LPKETVREIIIDAVKIEKEFVTDALPVRLIGMNSDLMCQYIEFVADRLLLELDCEKVWN- 275

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           + NPF +M  +I L+ + NFFE RV +YQ+   +K
Sbjct: 276 STNPFDFMD-MISLQGKTNFFEKRVGDYQKAGVMK 309


>gi|56713400|gb|AAW23440.1| ribonucleoside-diphosphate reductase [Vaccinia virus]
 gi|56713684|gb|AAW23722.1| ribonucleoside-diphosphate reductase [Vaccinia virus]
 gi|88854075|gb|ABD52493.1| ribonucleoside-diphosphate reductase subunit [Vaccinia virus]
 gi|167412519|gb|ABZ79953.1| ribonucleotide reductase small subunit [Vaccinia virus GLV-1h68]
          Length = 319

 Score =  262 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|154340038|ref|XP_001565976.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           braziliensis MHOM/BR/75/M2904]
 gi|134063294|emb|CAM45500.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 388

 Score =  262 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 90/340 (26%), Positives = 155/340 (45%), Gaps = 28/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +  N +++ +         L P++Y   W KY    +  W   E+ + +D+  W     
Sbjct: 60  AEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDLGNDMKDW---VA 116

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q   E +HS T+  
Sbjct: 117 LNDGERHFIKHVLAFFAGSDGIVVENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSV 176

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           ++ +   D  E   L +  + +P I  KA WA+++  +                F + L 
Sbjct: 177 LLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS-------------SASFQERLI 223

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
            F  V EG++F   F  +  L +   M G+    + I RDE LH +F   +       N 
Sbjct: 224 GFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------NS 276

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G E
Sbjct: 277 HIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLLVSLGEE 336

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 337 KHYNATQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 374


>gi|3914640|sp|O15910|RIR2_TRYBB RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2411479|gb|AAB70705.1| ribonucleotide reductase small subunit [Trypanosoma brucei]
 gi|261335314|emb|CBH18308.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei gambiense DAL972]
          Length = 337

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 158/333 (47%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W   E+ + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKEAESSIWTVEEIDLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|56404698|sp|O57175|RIR2_VACCA RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2772676|gb|AAB96415.1| ribonucleotide reductase, small subunit [Vaccinia virus]
 gi|47088360|gb|AAT10430.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|160857924|emb|CAM58212.1| ribonucleotide reductase small subunit [Vaccinia virus Ankara]
          Length = 319

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|255551489|ref|XP_002516790.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
 gi|223543878|gb|EEF45404.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
          Length = 342

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 88/331 (26%), Positives = 152/331 (45%), Gaps = 29/331 (8%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
            +L  ++    + P++Y   WE Y  A  + W   EV +  D+  W++   L+  E+  I
Sbjct: 21  PILKEQNQRFCMFPIRYKSLWEMYKKAEASFWTAEEVDLSQDVQQWET---LSVSEKHFI 77

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
              L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +   D 
Sbjct: 78  SHVLAFFAASDGIVLENLAARFLNDIQVPEARAFYGFQIAMENIHSEMYSLLLETYIKDS 137

Query: 143 GE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGM 199
            E   LFN    +P +  KA WAL +  +                   +  V +   EG+
Sbjct: 138 REKNRLFNAIETIPCVARKAKWALDWIHS--------------SSLYAERLVAFACVEGI 183

Query: 200 WFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQ 259
           +F   F  I  L +   M G+    + I RDE LH +F   + + ++ +          Q
Sbjct: 184 FFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLQW-------Q 236

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
           K + ++HEA  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +   ENP
Sbjct: 237 KVQQIVHEAVEIETEFVCDALPCALIGMNSTLMSQYIKFVADRLLVALGYQRKYNV-ENP 295

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           F WM E I L+ + NFFE RV +YQ+ + + 
Sbjct: 296 FDWM-EFISLQGKANFFERRVGDYQKASVMS 325


>gi|213511642|ref|NP_001133495.1| Ribonucleoside-diphosphate reductase subunit M2 [Salmo salar]
 gi|209154228|gb|ACI33346.1| Ribonucleoside-diphosphate reductase subunit M2 [Salmo salar]
          Length = 387

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 153/333 (45%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        + P+KY   W+ Y  A  + W   EV +  D   W   + L D+ER 
Sbjct: 67  EEPLLKENPRRFVIFPIKYHDIWQMYKKAEASFWTAEEVDLSKDTQHW---DSLKDEERY 123

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I +   
Sbjct: 124 FISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIK 183

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P +  KA+WAL +              + +  F + +  F  V E
Sbjct: 184 DPKERDYLFNAIETLPCVKRKADWALNWI------------GNKNAGFGERVVAFAAV-E 230

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +   +         K  
Sbjct: 231 GIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLV-------HKPS 283

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           ++    ++  A  +E  +  + +P   +G+N     QY++F+A+R   ++G + +++  E
Sbjct: 284 KETVTKLIRNAVEIEQEFLTKALPVKLIGMNCDLMTQYIEFVADRLMLELGFDKIYRV-E 342

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 343 NPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 374


>gi|255037048|ref|YP_003087669.1| Ribonucleoside-diphosphate reductase [Dyadobacter fermentans DSM
           18053]
 gi|254949804|gb|ACT94504.1| Ribonucleoside-diphosphate reductase [Dyadobacter fermentans DSM
           18053]
          Length = 331

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 84/334 (25%), Positives = 148/334 (44%), Gaps = 29/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
             + +L        L P+K+   WE Y     + W   E+ +  D+  W+    L+D ER
Sbjct: 7   RQEPLLTEDPLRFVLFPIKHSDIWEMYKRHEASFWTAEEIDLSQDMKDWE---NLSDGER 63

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+ +     +   E + +   Q   E +HS T+  +I +  
Sbjct: 64  HFISHVLAFFAASDGIVNENLAVNFLSEVQYAEAKCFYGFQIAMENIHSETYSLLIDTYI 123

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   L      +P +  KA+WAL++  +                   +  + +   
Sbjct: 124 KDSAEKDRLLRAIETIPCVQKKADWALKWIDS---------------PVFAERIIAFAAV 168

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G++   + I RDE LH  F   +  +  +       + 
Sbjct: 169 EGIFFSGSFCSIFWLKKRGLMPGLSFSNELISRDEGLHCEFACLLYTKHIL------NQL 222

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            Q++   ++ +A  +E  +  E +P   +G+NA   +QY+++IA+    ++G    F  +
Sbjct: 223 PQERVIEIMLDAVEIEKEFVSEALPVSLIGMNADLMKQYIEYIADFWLERLGCPKQFG-S 281

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E+I L  + NFFE RV EYQ+   + 
Sbjct: 282 ANPFDFM-ELISLPGKTNFFEKRVGEYQKAGVMS 314


>gi|74025550|ref|XP_829341.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
 gi|70834727|gb|EAN80229.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
 gi|261335315|emb|CBH18309.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei gambiense DAL972]
          Length = 337

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 158/333 (47%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W   E+ + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKEAESSIWTVEEIDLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|327403795|ref|YP_004344633.1| Ribonucleoside-diphosphate reductase [Fluviicola taffensis DSM
           16823]
 gi|327319303|gb|AEA43795.1| Ribonucleoside-diphosphate reductase [Fluviicola taffensis DSM
           16823]
          Length = 324

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 86/335 (25%), Positives = 157/335 (46%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
            + + +L+   +   L P+++   W  Y  A  + W   E+ +  DL  W++   L+DDE
Sbjct: 2   ANAEPILSENKNRFVLFPIQHEDIWSFYKKAEASFWTAEEIDLSPDLIDWET--KLSDDE 59

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I + 
Sbjct: 60  RHFVKHVLAFFAASDGIVNENLAEHFLAEVQYTEAKFFYGFQVAMENIHSETYSLLIDTY 119

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D+ E   LFN    +  +  KA+WAL++    S                 +  V +  
Sbjct: 120 IKDQKEKNHLFNALDTIDCVRKKADWALRWIDNGS---------------FAERLVAFAA 164

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   F  I  L +   M G++   + I RDE LH +F   +  +          +
Sbjct: 165 VEGIFFSGSFCSIFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLYTKHL------IHQ 218

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++ + ++ +A  +E  +  + +P   +G+NA    QY++F+A+R   ++G   +F  
Sbjct: 219 LSKEQVQEIILDAVEIEKEFVTDALPVKLIGMNADLMAQYIEFVADRLLTELGNPKVFN- 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           T NPF +M  +I ++ + NFFE RV EYQ+   + 
Sbjct: 278 TTNPFDFMD-MISIQGKTNFFEKRVAEYQKSGVMS 311


>gi|325119319|emb|CBZ54873.1| hypothetical protein NCLIV_052980 [Neospora caninum Liverpool]
          Length = 392

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/339 (28%), Positives = 156/339 (46%), Gaps = 29/339 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +    ++ +L A      +LP+++   WE Y     + W   E+ +  D+  W+S   L 
Sbjct: 68  KEKESEEPLLIANPRRWVILPIQHHAIWEMYKKQEASFWTAEEIDLAQDMTHWES---LN 124

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            +E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I
Sbjct: 125 SNEKHFIKYVLAFFAASDGIVLENLAEKFLSEIQIPEARAFYGFQIAMENIHSETYSLLI 184

Query: 136 TSLGLDE---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
                DE    ELF+    V ++  KA WA  +                   F + L   
Sbjct: 185 DQYIRDEKEKMELFDAVHNVKAVAVKAAWAAMWIN-------------NRNCFAERLVG- 230

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG+ F   F  I  L +   M G+    + I RDE LH +F   + +Q+K + P  
Sbjct: 231 FACVEGILFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHADFACLLYSQLKNKLPD- 289

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                 +  + M+ EA  +E A+  E +P   +G+N  S  QY++F+A+R    +G+  +
Sbjct: 290 ------KVVQDMVREAVTVERAFICEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKI 343

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           F +  NPF WM E+I L+ + NFFE RV EYQ+   +  
Sbjct: 344 F-FATNPFDWM-ELISLQGKTNFFEKRVGEYQKAGVMAD 380


>gi|157869457|ref|XP_001683280.1| ribonucleoside-diphosphate reductase small chain [Leishmania major
           strain Friedlin]
 gi|68224164|emb|CAJ04657.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania major strain Friedlin]
          Length = 392

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 92/352 (26%), Positives = 159/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 52  AAGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 111

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W +   L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 112 GNDMKDWAT---LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQL 168

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 169 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS---------- 218

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 219 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 274

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 275 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 328

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 329 VADRLLVSLGEEKHYHSTQ-PFEFM-EMISLQGKTNFFERKVGEYQKAGVMS 378


>gi|118383611|ref|XP_001024960.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila]
 gi|89306727|gb|EAS04715.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila SB210]
          Length = 376

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/358 (26%), Positives = 165/358 (46%), Gaps = 37/358 (10%)

Query: 4   NTGLSPI--------QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWM 55
            TG++P+        +    +   +D+ +L    +   L P+KY   WE Y     + W 
Sbjct: 32  ATGMNPLPLLKSKNDEGKAPKEGYEDEPLLKDNPNRFVLFPIKYNKVWEMYKKELASFWT 91

Query: 56  PTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQ 115
             E+ +  DL  W+    LTD+ER  IK  L FFA+S+ +V  N+       +  PE R 
Sbjct: 92  ADEIDLYQDLKDWE---RLTDNERHFIKYVLAFFAASDGIVLENLAEQFMCEVQIPEARA 148

Query: 116 YLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSP 172
           +   Q   E +HS T+  +I +   DE E   LF   + VP I  KA WAL++     + 
Sbjct: 149 FYGFQIAMENIHSETYSLLIDTYIKDEVEKDYLFKASQNVPVIHKKAQWALKWINNNDN- 207

Query: 173 SFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDES 232
                             + +   EG++F   F  I  L + + M G+    + I RDE 
Sbjct: 208 -------------FASRLIAFAAIEGIFFSGSFCAIFWLKKRSLMPGLTFSNELISRDEG 254

Query: 233 LHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSC 292
           LH +F   + + +  +         +++   ++ EA  +E  +  E +P   +G+N+   
Sbjct: 255 LHTDFACLLYSMLNKKL-------TKEEIYEIITEAVEIEKEFISEALPVELIGMNSNMM 307

Query: 293 EQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +QY++F+A+R    +G+   +  ++NPF WM  +I ++ + NFFE RV EYQ+   + 
Sbjct: 308 KQYLEFVADRLLFALGVPKFYN-SKNPFEWMD-MISIQGKTNFFEKRVGEYQKANVMS 363


>gi|74025552|ref|XP_829342.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
 gi|70834728|gb|EAN80230.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
          Length = 337

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 92/333 (27%), Positives = 159/333 (47%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W   E+ + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKEAESSIWTVEEIDLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A L+E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVLIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|195172750|ref|XP_002027159.1| GL20023 [Drosophila persimilis]
 gi|198459455|ref|XP_001361381.2| GA21447 [Drosophila pseudoobscura pseudoobscura]
 gi|194112972|gb|EDW35015.1| GL20023 [Drosophila persimilis]
 gi|198136695|gb|EAL25959.2| GA21447 [Drosophila pseudoobscura pseudoobscura]
          Length = 391

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 86/344 (25%), Positives = 157/344 (45%), Gaps = 28/344 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  D   W 
Sbjct: 60  MEKTGSPFDPSIEPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDATDW- 118

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               LTD+ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 119 --ARLTDNERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSE 176

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   +  E   LFN    +P++  KA+WA+ +  +                  
Sbjct: 177 MYSVLIDTYIREPQERDYLFNAIETMPAVKRKADWAMSWISS-------------KSANF 223

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + + + + 
Sbjct: 224 AERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMYHHLV 283

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   +  +++   ++ +A  +E  +  E +P   +G+N     QY++F+A+R   +
Sbjct: 284 Q-------RPKRERIIEIIRDAVEIEQEFLTEALPVNLIGMNCVLMSQYIEFVADRLLGE 336

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   + 
Sbjct: 337 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVAEYQRMGVVT 378


>gi|262263187|dbj|BAI48096.1| ribonucleotide reductase M2 [Sus scrofa]
          Length = 355

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 90/329 (27%), Positives = 153/329 (46%), Gaps = 28/329 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
            +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   L  
Sbjct: 48  PSVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWET---LKP 104

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           +ER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I 
Sbjct: 105 EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID 164

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WAL++                 +    +  V +
Sbjct: 165 TYIKDSKEREFLFNAIETMPCVKKKADWALRWIG-------------DKEATYGERVVAF 211

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 212 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 264

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +Q+ + ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G   +F
Sbjct: 265 HKPSEQRVKEIIVNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFGKVF 324

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTE 342
           +  ENPF +M E I L+ + NFFE RV E
Sbjct: 325 RV-ENPFDFM-ENISLEGKTNFFEKRVGE 351


>gi|44971395|gb|AAS49745.1| RPXV032 [Rabbitpox virus]
          Length = 319

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|41054952|ref|NP_955770.1| ribonucleoside-diphosphate reductase subunit M2 B [Mus musculus]
 gi|81885688|sp|Q6PEE3|RIR2B_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|34786000|gb|AAH58103.1| Ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus]
 gi|74218244|dbj|BAE23760.1| unnamed protein product [Mus musculus]
          Length = 351

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/342 (28%), Positives = 160/342 (46%), Gaps = 28/342 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           +  E  V  +++ +L   S    + P++Y   W  Y  A  + W   EV +  DL  W  
Sbjct: 21  ETEENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHW-- 78

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  
Sbjct: 79  -NKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEM 137

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   LFN    +P +  KA+WAL++                 +    
Sbjct: 138 YSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA-------------DRKSTFG 184

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 185 ERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN 244

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  + + R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R   ++
Sbjct: 245 -------KPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGEL 297

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 298 GFSKIF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|22164633|ref|NP_671546.1| EVM028 [Ectromelia virus]
 gi|22123774|gb|AAM92332.1|AF523264_28 EVM028 [Ectromelia virus]
          Length = 319

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 88/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQVTEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++FIA+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFIADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|438946|gb|AAA60776.1| homolog of vaccinia virus CDS F4L (ribonucleotide reductase, small
           chain); putative [Variola major virus]
 gi|94484491|gb|ABF23604.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484688|gb|ABF23800.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484886|gb|ABF23997.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724274|gb|ABG43399.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 333

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 153/337 (45%), Gaps = 29/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN+  + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT 
Sbjct: 11  VNLVMEPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTP 67

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I 
Sbjct: 68  DEKYFIKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLID 127

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA ++    +S                +  + +
Sbjct: 128 TYVKDSNEKNYLFNAIETMPCVKKKADWAQKWIHDSASYG--------------ERLIAF 173

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 174 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 226

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               ++  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++
Sbjct: 227 YPPSEETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIKFVADRLISELGFKKIY 286

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 NVT-NPFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 321


>gi|111184227|gb|ABH08147.1| HSPV044 [Horsepox virus]
          Length = 319

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|194474072|ref|NP_001124015.1| ribonucleoside-diphosphate reductase subunit M2 B [Rattus
           norvegicus]
 gi|149066498|gb|EDM16371.1| ribonucleotide reductase M2 B (TP53 inducible) (predicted) [Rattus
           norvegicus]
          Length = 351

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 96/342 (28%), Positives = 161/342 (47%), Gaps = 28/342 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
           +  E  V  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W  
Sbjct: 21  ETKENEVRSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW-- 78

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            N L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  
Sbjct: 79  -NKLKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEM 137

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   LFN    +P +  KA+WAL++                 +    
Sbjct: 138 YSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA-------------DRKSTFG 184

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 185 ERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN 244

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  K  +++   ++ +A  +E  +  E +P G +G+N    +QY++F+A+R   ++
Sbjct: 245 -------KPSEERVMEIIVDAVKIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGEL 297

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 298 GFSKIF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|90023100|ref|YP_528927.1| amino acid adenylation [Saccharophagus degradans 2-40]
 gi|89952700|gb|ABD82715.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 368

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 139/348 (39%), Positives = 196/348 (56%), Gaps = 6/348 (1%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
            G +     +  V   DKR++N  +D+NQL P KY WAW+ +++A  NHW P ++ M  D
Sbjct: 27  AGQAATPNAQAPVCASDKRVINGHTDINQLAPFKYPWAWDFFINANKNHWTPLDINMSQD 86

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           +  +K    LT+ ER M +  L +  +S+ L   NI LA+   ++ PE + Y  RQ +EE
Sbjct: 87  VYDYKH--NLTEAERHMYENVLSYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEE 144

Query: 125 AVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           A+H+ T+Q+ I +LGLD+GE++N YR VP I AK   A +  +++          D    
Sbjct: 145 ALHTWTYQHCIETLGLDQGEIYNRYRVVPEINAKIQMANRRLESILRSDIDLTDPDQLNN 204

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F+     F  VFEG WFY GF+ I +L R   M G AEQ QYIMRDE++H  FGI  ++Q
Sbjct: 205 FILAYIFFAAVFEGCWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDETMHCAFGIQTVSQ 264

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           I IEN    T       +TM  EA   E  YA   + +  +G +A    +  +FIANRR 
Sbjct: 265 IIIEN---CTNIDVDAIKTMWEEADEAEANYARYILREPILGYSANDHIEQFRFIANRRA 321

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            Q+GLE  F   +   PW+ E  +++KEKNFFETRV EYQ    L+WD
Sbjct: 322 RQLGLEEPFPQAKCALPWLDEQANIRKEKNFFETRVIEYQ-AGGLEWD 368


>gi|42544136|ref|NP_056528.2| ribonucleoside-diphosphate reductase subunit M2 B isoform 1 [Homo
           sapiens]
 gi|114621161|ref|XP_001153916.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B
           isoform 2 [Pan troglodytes]
 gi|74727333|sp|Q7LG56|RIR2B_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|261278726|pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2
 gi|261278727|pdb|3HF1|B Chain B, Crystal Structure Of Human P53r2
 gi|7229086|dbj|BAA92434.1| ribonucleotide reductase [Homo sapiens]
 gi|7229115|dbj|BAA92493.1| ribonucleotide reductase [Homo sapiens]
 gi|45259569|dbj|BAD12267.1| p53-inducible ribonucleotide reductase small subunit 2 [Homo
           sapiens]
 gi|52545612|emb|CAB70703.2| hypothetical protein [Homo sapiens]
 gi|63055293|gb|AAY29059.1| ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|80473666|gb|AAI08262.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|109659128|gb|AAI17497.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|119612247|gb|EAW91841.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_b [Homo
           sapiens]
 gi|120660296|gb|AAI30629.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|190689549|gb|ACE86549.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|190690911|gb|ACE87230.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|261859014|dbj|BAI46029.1| ribonucleotide reductase M2 B [synthetic construct]
 gi|313882916|gb|ADR82944.1| ribonucleotide reductase M2 B (TP53 inducible) [synthetic
           construct]
          Length = 351

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 163/350 (46%), Gaps = 28/350 (8%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           +    S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV + 
Sbjct: 13  DQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS 72

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q  
Sbjct: 73  KDLPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQIL 129

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS  +  +I +   D  +   LFN    +P +  KA+WAL++              
Sbjct: 130 IENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA------------ 177

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
              +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 178 -DRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 236

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+
Sbjct: 237 LMFQYLVN-------KPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV 289

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           A+R   ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 290 ADRLLVELGFSKVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|324519017|gb|ADY47264.1| Ribonucleoside-diphosphate reductase small chain [Ascaris suum]
          Length = 376

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 100/354 (28%), Positives = 164/354 (46%), Gaps = 28/354 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            N+T     +  +K      + +L    +   + P+KY   W+ Y  A  + W   EV +
Sbjct: 37  ENSTTRKAPEVTDKGDEEVVEPLLANNPNRFVIFPIKYHDIWDFYKRAVASFWTVEEVDL 96

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D   W+    L+D ER  I R L FFA+S+ +V  N+V    + +  PE R +   Q 
Sbjct: 97  SKDYQHWE---NLSDGERFFISRVLAFFAASDGIVNENLVERFAQEVQVPEARFFYGFQI 153

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS  +  ++ +   D+ E   LFN   E   I  KA+WAL++             
Sbjct: 154 MIENIHSEMYSKMVETYIRDDNERKKLFNAINEFEFIKKKADWALKWI------------ 201

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D    + + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F 
Sbjct: 202 ADKQAPYAERLIAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTHSNELISRDEGLHRDFA 260

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +K        K  +++   ++ EA  +E  Y  E +P G +G+N     QY+++
Sbjct: 261 CLMFSHLKK-------KPNKERIYEIIREAVKIEQEYLTEALPVGLIGMNCELMSQYIEY 313

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +A+    ++    L+   ENPF +M+  I ++ + NFFE RV+EYQ+   L  D
Sbjct: 314 VADHLLTELKCPKLYNM-ENPFDFMAR-ISIEAKTNFFEKRVSEYQKAGVLSTD 365


>gi|146298285|ref|YP_001192876.1| ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
 gi|146152703|gb|ABQ03557.1| Ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
          Length = 325

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 92/334 (27%), Positives = 157/334 (47%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P+K+   WE Y     + W   E+ +  DL  W   N L DDER  
Sbjct: 5   EPILQENKNRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLHQDLTDWN--NKLNDDERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 E---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E    ELFN     P+I  K  WAL++ ++ S                 +  + +   EG
Sbjct: 123 EAEKTELFNALEVFPAIAKKGEWALKWIESDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + N           K  +
Sbjct: 168 IFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHL------VNKVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ + ++ +A  +E  +  E++P   +G+NA    QY++F+A+R   ++G E ++  + N
Sbjct: 222 ERIKEIIVDALDIERQFVTESLPVSLIGMNAGLMTQYLEFVADRLLVELGCERVYG-SAN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I L+ + NFFE RV EYQ+   +  D
Sbjct: 281 PFDFMD-MISLQGKTNFFEKRVAEYQKSGVMNTD 313


>gi|294950175|ref|XP_002786498.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239900790|gb|EER18294.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 350

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 151/331 (45%), Gaps = 28/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        + P+KY   WE Y     + W   E+ +  DL  W+    L+D++R  
Sbjct: 15  EDLLKENPHRYVMFPIKYLAIWEMYKKHEASFWTAEEIDLSQDLRDWE---NLSDNDRHF 71

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   D
Sbjct: 72  ISHVLAFFAASDGIVLENLSAKFSGEVQCPEARAFYGFQIAMENIHSETYSLLIDNYIKD 131

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             +   +F     VPS+  KA WAL +                D  F + L   +   EG
Sbjct: 132 PEQKDKIFRAIETVPSVRKKAEWALSWIN-------------DDNCFAERLIA-FACVEG 177

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           + F   F  I  L +   M G+    + I RDE LH +F   +       N   +T+   
Sbjct: 178 ILFSGSFCAIYWLKKRGLMPGLTFSNELISRDEGLHADFACLLY------NMLKYTRLPD 231

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++  A  +E  +  E++P   +G+N+    +Y++F+A+R    +G   L+  T N
Sbjct: 232 ERVHEIVRGAVEVERVFISESLPVSLIGMNSQLMCRYIEFVADRLLVALGHPKLYNAT-N 290

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM ++I L+ + NFFE RV EYQ+G  +
Sbjct: 291 PFDWM-KMISLQGKTNFFEKRVGEYQKGGVM 320


>gi|197101489|ref|NP_001125944.1| ribonucleoside-diphosphate reductase subunit M2 B [Pongo abelii]
 gi|75041724|sp|Q5R9G0|RIR2B_PONAB RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|55729743|emb|CAH91600.1| hypothetical protein [Pongo abelii]
          Length = 351

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 163/350 (46%), Gaps = 28/350 (8%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           +    S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV + 
Sbjct: 13  DQDERSSSDTNENEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS 72

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q  
Sbjct: 73  KDLPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQIL 129

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS  +  +I +   D  +   LFN    +P +  KA+WAL++              
Sbjct: 130 IENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA------------ 177

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
              +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 178 -DRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 236

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+
Sbjct: 237 LMFQYLVN-------KPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV 289

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           A+R   ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 290 ADRLLVELGFSKVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer
          Length = 419

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 94  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 151

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 152 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 211

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 212 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 258

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 259 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 313

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 314 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 370

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 371 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 403


>gi|187903099|ref|YP_001883390.1| ribonucleoside diphosphate reductase small subunit, rr2 [Musca
           domestica salivary gland hypertrophy virus]
 gi|187384748|gb|ACD03521.1| ribonucleoside diphosphate reductase small subunit, rr2 [Musca
           domestica salivary gland hypertrophy virus]
          Length = 343

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 86/336 (25%), Positives = 156/336 (46%), Gaps = 27/336 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
            ++  ++ +L        L P++Y   W  Y  A  + W   EV +  D+  W+    L+
Sbjct: 11  EMDTSNEPLLQENPRRFVLFPIEYEDIWRMYKKAEASFWTVEEVDLSKDMNDWE---RLS 67

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
             E+  IK  L FFA+S+ +V  N++    + +   E R +   Q   E VHS  +  +I
Sbjct: 68  SGEQHFIKHVLAFFAASDGIVNENLLERFAQEVQVSEARCFYGFQIAMENVHSEMYSVLI 127

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   +  E   LFN    +P++  KA+WA  +  +                F + L   
Sbjct: 128 DTYIRERAERERLFNAIETIPAVKRKADWAFNWITS------------TTATFGERLLA- 174

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           + V EG++F   FA I  L +   M G+    + I RDE +H +F + +  +  +  P  
Sbjct: 175 FAVVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGMHCDFAVLLFKRYLVNRP-- 232

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                +++   ++ EA  +E  +  + +P   +G+N     QY++F+A+R    +G++ +
Sbjct: 233 ----SEERVGEIVREAVTIEQEFLTDALPVSLIGMNCGLMSQYIEFVADRLLVDLGMKRI 288

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +  T+NPF +M  +I L  + NFFE RV +YQ+   
Sbjct: 289 YN-TKNPFDFMD-MISLDGKTNFFEKRVGDYQRLGV 322


>gi|75076588|sp|Q4R741|RIR2B_MACFA RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|67969468|dbj|BAE01083.1| unnamed protein product [Macaca fascicularis]
          Length = 351

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 97/346 (28%), Positives = 162/346 (46%), Gaps = 28/346 (8%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
            S     +  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL 
Sbjct: 17  RSSSDTNDNEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLP 76

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E V
Sbjct: 77  HW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENV 133

Query: 127 HSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQ 183
           HS  +  +I +   D  +   LFN    +P +  KA+WAL++                 +
Sbjct: 134 HSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA-------------DRK 180

Query: 184 EFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVIN 243
               +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +  
Sbjct: 181 STFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ 240

Query: 244 QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 303
            +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+A+R 
Sbjct: 241 YLVN-------KPSEERVREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFVADRL 293

Query: 304 CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 294 LVELGFSKIF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|156847978|ref|XP_001646872.1| hypothetical protein Kpol_2002p85 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117553|gb|EDO19014.1| hypothetical protein Kpol_2002p85 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 400

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 100/343 (29%), Positives = 160/343 (46%), Gaps = 27/343 (7%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           +Q  E +    ++ +L A  +   L P++Y   +E Y  A  + W   E+ +  DL  W 
Sbjct: 63  VQRHELKEKETEEPLLVADPNRKILFPIQYPDIYEAYKRAEASFWTAEEIDLSKDLHDWN 122

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N + ++ER  I R L FFA+S+ +V  N+           E + +   Q   E +HS 
Sbjct: 123 --NRMNENERFFISRVLAFFAASDGIVNENLTENFSVEAQILEAKCFYGFQIMIENIHSE 180

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           T+  +I +   D  E   LFN    +P I  KA WAL++              D++  F 
Sbjct: 181 TYSLLIDTYIKDPKESQYLFNAIETIPQIKEKAEWALRWIN------------DSEALFA 228

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L   +   EG++F   FA I  L +   M G+    + I RDE LH +F   + + IK
Sbjct: 229 ERLVA-FAAIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLLFSHIK 287

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
            +               ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R    
Sbjct: 288 NKPDP-------AIVEKIVTEAVEIEKRYFTDALPVALLGMNADLMNQYVEFVADRLLVA 340

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            G E +FK  ENPF +M E I L  + NFFE RV++YQ+ + +
Sbjct: 341 FGNEKVFKV-ENPFDFM-ENISLAGKTNFFEKRVSDYQKASVI 381


>gi|224100309|ref|XP_002311826.1| predicted protein [Populus trichocarpa]
 gi|222851646|gb|EEE89193.1| predicted protein [Populus trichocarpa]
          Length = 342

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 91/351 (25%), Positives = 158/351 (45%), Gaps = 33/351 (9%)

Query: 7   LSPIQAGEKRVNVDDK----RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           +  ++ G +   + ++     +L  ++    + P++Y   WE Y  A  + W   EV + 
Sbjct: 1   MGSLRNGTESERIREEDKQEPILKEQNQRFCMFPIRYKELWEMYKKAEASFWTAEEVDLS 60

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+  W+    L+D E+  I   L FFA+S+ +V  N+       +  PE R +   Q  
Sbjct: 61  RDMQQWE---ALSDSEKHFISHVLAFFAASDGIVLENLAARFLYDVQIPEARAFYGFQIA 117

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS  +  ++ +   D  E   LFN    +P +  KA WAL + Q+           
Sbjct: 118 MENIHSEMYSLLLETYIKDSREKHRLFNAIENIPCVAEKAKWALDWIQS----------- 166

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
                   +  V +   EG++F   F  I  L +   M G+    + I RDE LH +F  
Sbjct: 167 ---SMVFAERLVAFACIEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 223

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            + + ++ +          QK   ++ EA  +E  +  E +P   +G+NA     Y++F+
Sbjct: 224 LLYSLLQRQLHW-------QKVYHIVGEAVEIETKFVCEALPCALIGMNATLMGDYIKFV 276

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           A+R    +G +  +   ENPF WM E I L+ + NFFE RV +YQ+ + + 
Sbjct: 277 ADRLLVALGYQKKYNV-ENPFDWM-EFISLQGKANFFERRVGDYQKASVMS 325


>gi|313213932|emb|CBY40745.1| unnamed protein product [Oikopleura dioica]
          Length = 418

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 89/338 (26%), Positives = 155/338 (45%), Gaps = 29/338 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
              +   + +L   +    + P++Y   W  Y  A  + W   EV +  D+  WK    L
Sbjct: 87  ADFDPQLEPLLKENNQRFVIFPIQYHDIWRMYKKAVASFWTTEEVDLGRDMDDWK---KL 143

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  IK  L FFA+S+ +V  N+V      +  PE R +   Q   E +HS  +  +
Sbjct: 144 KKEEQFFIKHVLAFFAASDGIVNENLVDRFMSEIQIPEARSFYGFQIMMENIHSEMYAKL 203

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +L  D  E   LFN    +P+I  KA+WAL++    +  S                 +
Sbjct: 204 IENLVHDTKEKMGLFNAIETMPAIKKKADWALKWIGADAPYSVR--------------VI 249

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 250 AFAAVEGIFFSGSFAAIFWLKKRGLMPGVTFSNELISRDEGLHTDFACLMYKHMVQ---- 305

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  Q++   ++ +A  +E  +  + +P   +G+N    + Y++F+A+R   ++    
Sbjct: 306 ---KPSQEQIIAIIRDAVSIEQEFLTDALPVRLIGMNCDLMKTYIEFVADRLLVELDCPK 362

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ++K  ENPF +M E+I L+ + NFFE +V+EY +   +
Sbjct: 363 IYKV-ENPFDFM-EMISLEGKTNFFEKKVSEYARAGVM 398


>gi|266919|sp|P29883|RIR2_VACCP RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335710|gb|AAA48294.1| F14 [Vaccinia virus]
          Length = 319

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 85/332 (25%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N +T DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKVTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   +   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFRMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|330994651|ref|ZP_08318574.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
 gi|329758292|gb|EGG74813.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
          Length = 365

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 89/352 (25%), Positives = 168/352 (47%), Gaps = 21/352 (5%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           ++T ++   A   +  + ++ +L A        P +Y WA++ +L+    HW+P EVP+ 
Sbjct: 28  DSTAMTDTAAPVAQPPM-EQSLLTANP---VYKPFRYPWAYDAWLTQQRVHWLPEEVPLA 83

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
           DD+  W     LT+ ER ++ +   FF  S+  V N  +    +     E    L   + 
Sbjct: 84  DDVKDWH--RTLTESERHLVTQIFRFFTQSDVEVNNCYMKHYSQVFKPTEVLMMLSAFSN 141

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
            E +H   + +++ ++G+ E E ++ + +   +  K ++  Q+            +   +
Sbjct: 142 IETIHIAAYSHLLDTIGMPETE-YSAFLKYKEMKDKYDYMQQF------------SVSDN 188

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
            +  + L  F    EG+  +  FA +L+  R NK+ G+ +   + +RDESLH +    + 
Sbjct: 189 YQIARTLAAFGAFTEGLQLFASFAILLNFPRHNKLKGMGQIVSWSVRDESLHCDSMARLF 248

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIAN 301
                ENP +WT   +   R +  +    E A+   +   G   GL+A   ++Y++F+AN
Sbjct: 249 RVFVQENPEIWTDTLRDDIRQICRDIVEHEDAFIDLSFEMGAVEGLDAGQVKRYIRFVAN 308

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           RR  Q+GL+ ++    NP PW+ E+++  +  NFFE R TEY + +    WD
Sbjct: 309 RRLGQLGLDGIYDIATNPLPWVDEMVNAVEHANFFENRATEYSRASTTGTWD 360


>gi|146090970|ref|XP_001466408.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           infantum JPCM5]
 gi|134070770|emb|CAM69127.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania infantum JPCM5]
          Length = 388

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 90/340 (26%), Positives = 157/340 (46%), Gaps = 28/340 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
            +  N +++ +         L P++Y   W KY    +  W   E+ + +D+  W +   
Sbjct: 60  AEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDLGNDMKDWAT--- 116

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q   E +HS T+  
Sbjct: 117 LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQLMMENIHSETYSV 176

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           ++ +   D  E   L +  + +P I  KA WA+++  +                F + L 
Sbjct: 177 LLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS-------------SASFQERLI 223

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
            F  V EG++F   F  +  L +   M G+    + I RDE LH +F   +       N 
Sbjct: 224 GFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------NS 276

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G E
Sbjct: 277 HIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLLVSLGEE 336

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             ++ T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 337 KHYRSTQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 374


>gi|224000239|ref|XP_002289792.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975000|gb|EED93329.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 335

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 91/327 (27%), Positives = 157/327 (48%), Gaps = 28/327 (8%)

Query: 26  NARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN 85
           +       L P+ Y   W  Y     + W   E+ +  DL+ W     L  DER  I   
Sbjct: 7   DEEGSRFSLFPIAYPDLWSMYKQHVASFWTADEIDLSADLSDWHK--KLNPDERHFISMV 64

Query: 86  LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE--- 142
           L FFA ++ +V  N+     R ++ PE R +   Q   E++H  T+  +I +   D    
Sbjct: 65  LAFFAGADGIVVENLAERFCREVTVPEARCFYGFQMAMESIHQETYCLLIDTYITDPKVR 124

Query: 143 GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFY 202
             LF+ +  VPS+  KA+WA +Y  +                F + L  F  V EG++F 
Sbjct: 125 ERLFSAHATVPSVERKASWAQRYIGS-------------KASFAERLVAFAAV-EGIFFS 170

Query: 203 TGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSR 262
             F  I  L +   M G+    + I RDE LH +F   + +++K++         Q++ +
Sbjct: 171 GSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCSFACQLYSKLKLKLS-------QEEIQ 223

Query: 263 TMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
           T+++EA  +E ++  + +P   +G+N+    QY++F+A+R    +G + ++  ++NPF W
Sbjct: 224 TIINEAVDVEKSFICDALPVSLIGMNSRLMAQYIEFVADRMLTDLGYQAMYG-SKNPFDW 282

Query: 323 MSEVIDLKKEKNFFETRVTEYQQGAEL 349
           M  +I L+ + NFFE RV EYQ+   +
Sbjct: 283 MD-MISLEGKTNFFEKRVGEYQKSGVM 308


>gi|194755279|ref|XP_001959919.1| GF11796 [Drosophila ananassae]
 gi|190621217|gb|EDV36741.1| GF11796 [Drosophila ananassae]
          Length = 393

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 88/342 (25%), Positives = 155/342 (45%), Gaps = 28/342 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           ++      +   + +L        + P++Y   W+ Y  A  + W   EV +  DL  W 
Sbjct: 62  MEKSATPFDPSLEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWH 121

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
               L DDER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E VHS 
Sbjct: 122 ---RLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENVHSE 178

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  +   LFN    +P++  KA+WAL +  +                  
Sbjct: 179 MYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALAWISS-------------KSANF 225

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
            +  + +   EG++F   FA I  L +   M G+    + I RDE LH +F + +   + 
Sbjct: 226 GERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLV 285

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
                   K  +++   ++ +A  +E  +  + +P   +G+N     QY++F+A+R   +
Sbjct: 286 Q-------KPRRERIIEIIRDAVDIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVE 338

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +G+  ++  T+NPF +M E+I L  + NFFE +V EYQ+   
Sbjct: 339 LGVGKIYN-TKNPFNFM-EMISLDGKTNFFEKKVGEYQRMGV 378


>gi|113195221|ref|YP_717351.1| ribonucleotide reductase small subunit [Taterapox virus]
 gi|90660497|gb|ABD97610.1| ribonucleotide reductase small subunit [Taterapox virus]
          Length = 319

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|7023557|dbj|BAA92005.1| unnamed protein product [Homo sapiens]
          Length = 351

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 163/350 (46%), Gaps = 28/350 (8%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           +    S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV + 
Sbjct: 13  DQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS 72

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q  
Sbjct: 73  KDLPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQIL 129

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS  +  +I +   D  +   LFN    +P +  KA+WAL++              
Sbjct: 130 IENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA------------ 177

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
              +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 178 -DRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 236

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+
Sbjct: 237 LMFQYLVN-------KPSEERVREIIVDAVKIEQEFLTEALPVGLIGVNCILMKQYIEFV 289

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           A+R   ++G   +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 290 ADRLLVELGFSKVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|9631087|ref|NP_047757.1| ribonucleotide reductase small subunit homolog [Lymantria dispar
           MNPV]
 gi|3822355|gb|AAC70306.1| ribonucleotide reductase small subunit homolog [Lymantria dispar
           MNPV]
          Length = 348

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 91/342 (26%), Positives = 152/342 (44%), Gaps = 28/342 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
            A E+  +   + +L        + P++Y   W  Y  A  + W   EV +  D + W+ 
Sbjct: 19  PAPERPFDPRAEPLLRENPRRFVIFPIQYPDMWRMYKKAEASFWTVEEVDLSKDTSDWE- 77

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L D+ER  IK  L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  
Sbjct: 78  --RLNDNERHFIKHVLAFFAASDGIVNENLVERFAQEVQVAEARCFYGFQIAMENVHSEM 135

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +      E   L N    +P +  KA WAL++                +  F +
Sbjct: 136 YSTLIDTYVRSSEEKLRLLNAIETMPCVKEKAEWALRWIAG------------REAAFGE 183

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  
Sbjct: 184 RLVAFAAV-EGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLFKHLVQ 242

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                  +    + R ++ +A  +E  +  E +P   +GLN  +  QY++F+A+R   ++
Sbjct: 243 -------RPSAARVREIVTDAVAIEQRFLTEALPVRLLGLNCETMSQYIEFVADRLLLEL 295

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
                +  T NP  +M+ +I L+ + NFFE +V EYQ+   +
Sbjct: 296 VGAKHYN-TPNPLDFMN-LISLEGKTNFFEKKVGEYQKFGVM 335


>gi|313235850|emb|CBY19835.1| unnamed protein product [Oikopleura dioica]
          Length = 382

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 89/338 (26%), Positives = 155/338 (45%), Gaps = 29/338 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
              +   + +L   +    + P++Y   W  Y  A  + W   EV +  D+  WK    L
Sbjct: 51  ADFDPQLEPLLKENNQRFVIFPIQYHDIWRMYKKAVASFWTTEEVDLGRDMDDWK---KL 107

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  IK  L FFA+S+ +V  N+V      +  PE R +   Q   E +HS  +  +
Sbjct: 108 KKEEQFFIKHVLAFFAASDGIVNENLVDRFMSEIQIPEARSFYGFQIMMENIHSEMYAKL 167

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +L  D  E   LFN    +P+I  KA+WAL++    +  S                 +
Sbjct: 168 IENLVHDTKEKMGLFNAIETMPAIKKKADWALKWIGADAPYSVR--------------VI 213

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +      
Sbjct: 214 AFAAVEGIFFSGSFAAIFWLKKRGLMPGVTFSNELISRDEGLHTDFACLMYKHMVQ---- 269

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              K  Q++   ++ +A  +E  +  + +P   +G+N    + Y++F+A+R   ++    
Sbjct: 270 ---KPSQEQIIAIIRDAVSIEQEFLTDALPVRLIGMNCDLMKTYIEFVADRLLVELDCPK 326

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ++K  ENPF +M E+I L+ + NFFE +V+EY +   +
Sbjct: 327 IYKV-ENPFDFM-EMISLEGKTNFFEKKVSEYARAGVM 362


>gi|297265423|ref|XP_001091447.2| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 [Macaca
           mulatta]
          Length = 704

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 86/335 (25%), Positives = 139/335 (41%), Gaps = 58/335 (17%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W+S   L  +E
Sbjct: 412 VEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES---LKPEE 468

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I + 
Sbjct: 469 RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY 528

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LFN    +P +  KA+WAL++              D +  + + +  F  V
Sbjct: 529 IKDPKEREFLFNAIETMPCVKKKADWALRWI------------GDKEATYGERVVAFAAV 576

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE                        
Sbjct: 577 -EGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEVSLNQIIGXXXXXXXX-------- 627

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
                                        +G+N    +QY++F+A+R   ++G   +F+ 
Sbjct: 628 -----------------------------IGMNCTLMKQYIEFVADRLMLELGFSKVFRV 658

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 659 -ENPFDFM-ENISLEGKTNFFEKRVGEYQRMGVMS 691


>gi|3220181|gb|AAC23560.1| ribonucleotide reductase M2 subunit [Leishmania amazonensis]
          Length = 354

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 92/352 (26%), Positives = 158/352 (44%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 14  AAGAEVLPADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 73

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W     L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 74  GNDMKDW---AALNDGERHFIKHVLAFFAGSDGIVVENLAQRFMSDVKVPEARAFYGFQL 130

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 131 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQRKAEWAVRWIGS---------- 180

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 181 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 236

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 237 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 290

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  +  T+ PF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 291 VADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 340


>gi|66275840|ref|YP_232925.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|132629|sp|P11158|RIR2_VACCV RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335624|gb|AAA48244.1| F4L protein [Vaccinia virus]
 gi|335809|gb|AAA88680.1| ribonucleotide reductase (EC 1.17.4.1) small subunit [Vaccinia
           virus]
 gi|29692149|gb|AAO89322.1| ribonucleotide reductase small subunit [Vaccinia virus WR]
          Length = 319

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYYDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|885717|gb|AAA69333.1| C8L [Variola virus]
 gi|885826|gb|AAA69439.1| C8L [Variola virus]
 gi|94483878|gb|ABF22994.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484081|gb|ABF23196.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485084|gb|ABF24194.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485286|gb|ABF24395.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485489|gb|ABF24597.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485894|gb|ABF25000.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487109|gb|ABF26209.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487515|gb|ABF26613.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487716|gb|ABF26813.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488123|gb|ABF27218.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488323|gb|ABF27417.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488523|gb|ABF27616.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488724|gb|ABF27816.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488925|gb|ABF28016.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489125|gb|ABF28215.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489324|gb|ABF28413.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489527|gb|ABF28615.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489726|gb|ABF28813.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94490135|gb|ABF29220.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724070|gb|ABG43196.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724681|gb|ABG43804.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724885|gb|ABG44007.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725088|gb|ABG44209.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725293|gb|ABG44413.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725496|gb|ABG44615.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725700|gb|ABG44818.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725903|gb|ABG45020.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726107|gb|ABG45223.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726310|gb|ABG45425.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726513|gb|ABG45627.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635013|gb|ABU91466.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635031|gb|ABU91483.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635049|gb|ABU91500.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635067|gb|ABU91517.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635103|gb|ABU91551.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635121|gb|ABU91568.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635139|gb|ABU91585.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635158|gb|ABU91603.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635176|gb|ABU91620.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635194|gb|ABU91637.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635212|gb|ABU91654.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635230|gb|ABU91671.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635248|gb|ABU91688.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635266|gb|ABU91705.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635284|gb|ABU91722.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635320|gb|ABU91756.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635338|gb|ABU91773.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635356|gb|ABU91790.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635374|gb|ABU91807.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635392|gb|ABU91824.1| ribonucleotide reductase small subunit [Variola virus]
 gi|157739431|gb|ABU91739.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 319

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIKFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|46446983|ref|YP_008348.1| ribonucleoside-diphosphate reductase small chain [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46400624|emb|CAF24073.1| probable ribonucleoside-diphosphate reductase small chain
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 323

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 152/332 (45%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   L P+ +   W+ Y  A  + W   E+ +  DL  W     L +DE+  
Sbjct: 5   EPILRENKDRFVLFPINHAEIWQMYKKAEASFWTAEEIDLTSDLLDWD--RKLNNDEKYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAVNFMSEVQYPEARCFYGFQIMMENIHSEAYSLLIDTYIKD 122

Query: 142 E---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
                 LF     +P I+ KA+WAL++               +   F + L  F  V EG
Sbjct: 123 PTDKNRLFKALETIPCISNKADWALRWI--------------SQGSFSERLVAFAAV-EG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G++   + I RDE LH +F   + +Q+  + P        
Sbjct: 168 IFFSGSFCSIFWLKKRGLMPGLSFANELISRDEGLHCDFACLLYSQLNNKLPL------- 220

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  + ++  A  +E  +  + +P   +G+NA    QY++F+A+R    +G   L+    N
Sbjct: 221 ETLQAIISHAVAIEKEFVQDALPVRLIGMNATLMCQYIEFVADRLLVALGSPKLYNVD-N 279

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M  +I +  + NFFE RV+EYQ+   + 
Sbjct: 280 PFDFMD-LISMPGKTNFFERRVSEYQKSGVMS 310


>gi|313675915|ref|YP_004053911.1| ribonucleoside-diphosphate reductase [Marivirga tractuosa DSM 4126]
 gi|312942613|gb|ADR21803.1| Ribonucleoside-diphosphate reductase [Marivirga tractuosa DSM 4126]
          Length = 331

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 155/334 (46%), Gaps = 29/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            D+ +L    D   L P+++   WE Y  A  + W   E+ +  D   W+    LT+ E 
Sbjct: 8   QDEPILKENKDRFVLFPIQHKDIWEFYKMAEASFWTAEEIDLSQDQKDWE---NLTEGET 64

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             IK  L FFA+S+ +V  N+       +   E + +   Q   E VHS T+  +I +  
Sbjct: 65  HFIKHVLAFFAASDGIVNENLAENFVAEVQYTEAKFFYGFQIAMENVHSETYSLLIDTYV 124

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +  +  KA+WAL++    +                 +  + +   
Sbjct: 125 KDNKEKDKLFNAIDTMDCVKKKADWALRWIDEGN---------------YAERLIAFAAV 169

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +F   +       N HL  K 
Sbjct: 170 EGIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLY------NDHLVNKL 223

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            ++K   ++ +A  +E  +  +++P   +G+NA    QY++F+A+R   ++  + ++  +
Sbjct: 224 SKEKVTAIITDAVEIEKEFVTDSLPVKLIGMNADLMCQYIEFVADRLLQELRCDKVYG-S 282

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF +M E+I L+ + NFFE RV +YQ+   +K
Sbjct: 283 SNPFDFM-EMISLQGKTNFFEKRVGDYQKAGVMK 315


>gi|3914644|sp|O46310|RIR2_LEIAM RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase M2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2828563|gb|AAC08302.1| ribonucleotide reductase M2 subunit [Leishmania amazonensis]
          Length = 345

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 159/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 5   AAGAEVLPADKVAQGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 64

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W +   L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 65  GNDMKDWAT---LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQL 121

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA W +++  +          
Sbjct: 122 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWPVRWIGS---------- 171

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F Q L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 172 ---SASFQQRLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 227

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 228 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 281

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  ++ T+ PF +M E+I L+ + NFFE RV EYQ+   + 
Sbjct: 282 VADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFFEKRVGEYQKAGVMS 331


>gi|91081999|ref|XP_969259.1| PREDICTED: similar to AGAP006818-PA [Tribolium castaneum]
 gi|270007377|gb|EFA03825.1| hypothetical protein TcasGA2_TC013940 [Tribolium castaneum]
          Length = 374

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 90/336 (26%), Positives = 158/336 (47%), Gaps = 27/336 (8%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
             + + + +L        + P++Y   W+KY  A  + W   EV +  DL  WK  N L 
Sbjct: 49  EFDPELEPLLQENPRRFVVFPIQYPDIWDKYKQAEASFWTTEEVDLSKDLDDWK--NKLN 106

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
            DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  +I
Sbjct: 107 SDERYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAIENIHSEMYSMLI 166

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   +  E   LFN    +P +  KA+WAL +  +                   +  V 
Sbjct: 167 ETYISEPQEKEFLFNAIETLPCVKKKADWALLWINS-------------KNATFGERIVA 213

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L + N M G+    + I RDE LH +F   + + +       
Sbjct: 214 FAAVEGIFFSGSFASIFWLKKRNLMPGLTFSNELISRDEGLHCDFACLMFSHLVQ----- 268

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
             K  +++ ++++ +A  +E  +  E +P   +G+N     QY++F+A+R   ++G E +
Sbjct: 269 --KPSKERIQSIIQDAVKIEKEFLTEALPVSMIGMNCALMCQYIEFVADRLLGELGCEKI 326

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +  ++NPF +M+ +I  + + NFFE +V EYQ+   
Sbjct: 327 YN-SQNPFDFMT-IISNEGKTNFFEKKVGEYQKSGV 360


>gi|221480670|gb|EEE19110.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii GT1]
          Length = 391

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 95/332 (28%), Positives = 154/332 (46%), Gaps = 29/332 (8%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
            +L A      +LP+++   WE Y     + W   E+ +  D+  W++   L ++E+  I
Sbjct: 74  PLLMANPHRWVILPIQHHAIWEMYKKQEASFWTAEEIDLAQDMTHWET---LGENEKHFI 130

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
           K  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I     DE
Sbjct: 131 KYVLAFFAASDGIVLENLAEKFLTEIQVPEARAFYGFQIAMENIHSETYSLLIDQYIRDE 190

Query: 143 GE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGM 199
            E   LF+    V ++  KA WA  +                   F + L   +   EG+
Sbjct: 191 EEKLQLFDAVHNVKAVAVKAAWAAMWIN-------------NRNCFAERLVG-FACVEGI 236

Query: 200 WFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQ 259
            F   F  I  L +   M G+    + I RDE LH +F   + +Q+K + P        +
Sbjct: 237 LFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHADFACLLYSQLKHKLPD-------K 289

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
             + M+ EA  +E A+  E +P   +G+N  S  QY++F+A+R    +G+  +F +  NP
Sbjct: 290 VVQDMVREAVTVERAFICEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKIF-FATNP 348

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           F WM E+I L+ + NFFE RV EYQ+   +  
Sbjct: 349 FDWM-ELISLQGKTNFFEKRVGEYQKAGVMAD 379


>gi|237845387|ref|XP_002371991.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii ME49]
 gi|211969655|gb|EEB04851.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii ME49]
 gi|221501644|gb|EEE27410.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii VEG]
          Length = 391

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 95/332 (28%), Positives = 154/332 (46%), Gaps = 29/332 (8%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
            +L A      +LP+++   WE Y     + W   E+ +  D+  W++   L ++E+  I
Sbjct: 74  PLLMANPHRWVILPIQHHAIWEMYKKQEASFWTAEEIDLAQDMTHWET---LGENEKHFI 130

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
           K  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I     DE
Sbjct: 131 KYVLAFFAASDGIVLENLAEKFLTEIQVPEARAFYGFQIAMENIHSETYSLLIDQYIRDE 190

Query: 143 GE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGM 199
            E   LF+    V ++  KA WA  +                   F + L   +   EG+
Sbjct: 191 EEKLQLFDAVHNVKAVAVKAAWAAMWIN-------------NRNCFAERLVG-FACVEGI 236

Query: 200 WFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQ 259
            F   F  I  L +   M G+    + I RDE LH +F   + +Q+K + P        +
Sbjct: 237 LFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHADFACLLYSQLKHKLPD-------K 289

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
             + M+ EA  +E A+  E +P   +G+N  S  QY++F+A+R    +G+  +F +  NP
Sbjct: 290 VVQDMVREAVTVERAFICEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKIF-FATNP 348

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           F WM E+I L+ + NFFE RV EYQ+   +  
Sbjct: 349 FDWM-ELISLQGKTNFFEKRVGEYQKAGVMAD 379


>gi|19113338|ref|NP_596546.1| ribonucleotide reductase small subunit Suc22 [Schizosaccharomyces
           pombe 972h-]
 gi|9297110|sp|P36603|RIR2_SCHPO RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|3378511|emb|CAA20100.1| ribonucleotide reductase small subunit Suc22 [Schizosaccharomyces
           pombe]
          Length = 391

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 154/339 (45%), Gaps = 27/339 (7%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K+ +  D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L
Sbjct: 59  KKEDELDEVVLRPNPHRFVLFPIKYHEIWQFYKKAEASFWTAEEIDLSKDLVDWD--NKL 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             DER  I   L +FA+S+ +V  N++      +  PE R     Q   E +HS T+  +
Sbjct: 117 NADERYFISTVLAYFAASDGIVNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLL 176

Query: 135 ITSLGLDEGEL---FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           + +   +  E    F+    + SI AKA WAL++              D D  +   L  
Sbjct: 177 LDTYIREPKEKQRHFDAILTMGSIKAKAKWALRWIN------------DEDSTYAIRLVA 224

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K     
Sbjct: 225 FAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHLK----- 278

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              +  ++    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + 
Sbjct: 279 --HRPGRKVVEAIIVEAVDIEKEYFTDALPVSLLGMNKDLMCQYIEFVADRLLVALGNDK 336

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            +  T NPF +M E I L  + NFFE +V++YQ    + 
Sbjct: 337 YYNVT-NPFDFM-ENISLAGKTNFFEKKVSDYQIAGVMS 373


>gi|74025548|ref|XP_829340.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
 gi|70834726|gb|EAN80228.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
          Length = 337

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 90/333 (27%), Positives = 156/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W   E+ + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKEAESSIWTVEEIDLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +H  T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHCETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +     ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHCN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|291388369|ref|XP_002710634.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Oryctolagus cuniculus]
          Length = 339

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 99/339 (29%), Positives = 160/339 (47%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
               N D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 12  SPDTNEDEEPLLKKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NR 68

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 69  LTSDEKYFISHVLAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 128

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++                 +    +  
Sbjct: 129 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA-------------DRKSTFGERV 175

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 176 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 232

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 233 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLMELGFS 288

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 289 KVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 325


>gi|885759|gb|AAA69374.1| E4L [Variola virus]
 gi|5830589|emb|CAB54628.1| E4L protein [Variola minor virus]
 gi|94483674|gb|ABF22791.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484287|gb|ABF23401.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485692|gb|ABF24799.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486095|gb|ABF25200.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486298|gb|ABF25402.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486501|gb|ABF25604.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486703|gb|ABF25805.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486906|gb|ABF26007.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487312|gb|ABF26411.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487921|gb|ABF27017.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489931|gb|ABF29017.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724476|gb|ABG43600.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635085|gb|ABU91534.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 319

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|297449|emb|CAA46231.1| ribonucleotide reductase, small subunit [Schizosaccharomyces pombe]
 gi|447147|prf||1913428B ribonucleotide reductase:SUBUNIT=small
          Length = 391

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 155/339 (45%), Gaps = 27/339 (7%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K+ +  D+ +L        L P+KY   W+ Y  A  + W   E+ +  DL  W   N L
Sbjct: 59  KKEDELDEVVLRPNPHRFVLFPIKYHEIWQFYKKAEASFWTAEEIDLSKDLVDWD--NKL 116

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             DER  I   L +FA+S+ +V  N++      +  PE R     Q   E +HS T+  +
Sbjct: 117 NADERYFISTVLAYFAASDGIVNENLLERFSSEVQIPEARCVYGFQIMIENIHSETYSLL 176

Query: 135 ITSLGLDEGEL---FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           + +   +  E    F+    + SI AKA WAL++              D D  +   L  
Sbjct: 177 LDTYIREPKEKQRHFDAILTMGSIKAKAKWALRWIN------------DEDSTYAIRLVA 224

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K     
Sbjct: 225 FAAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFACLMFSHLK----- 278

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              +  ++  + ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G + 
Sbjct: 279 --HRPGRKLLKPIIVEAVDIEKEYFTDALPVSLLGMNKDLMCQYIEFVADRLLVALGNDK 336

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            +  T NPF +M E I L  + NFFE +V++YQ    + 
Sbjct: 337 YYNVT-NPFDFM-ENISLAGKTNFFEKKVSDYQIAGVMS 373


>gi|1808636|emb|CAA64118.1| G4L protein [Cowpox virus]
          Length = 319

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 86/332 (25%), Positives = 150/332 (45%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L + + M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRDLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  ++++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVKSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|17974949|ref|NP_536463.1| C10L [Monkeypox virus Zaire-96-I-16]
 gi|17529816|gb|AAL40494.1|AF380138_36 C10L [Monkeypox virus Zaire-96-I-16]
 gi|51342196|gb|AAU01240.1| MPXV-WRAIR030 [Monkeypox virus]
 gi|58220500|gb|AAW67788.1| MPXV-SL-030 [Monkeypox virus]
 gi|59858836|gb|AAX09131.1| MPXV-COP-030 [Monkeypox virus]
 gi|68448710|gb|AAY96833.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68448912|gb|AAY97034.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449113|gb|AAY97234.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449313|gb|AAY97433.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449512|gb|AAY97631.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|300872658|gb|ADK39060.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 147/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++  A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRFIITNAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|327269406|ref|XP_003219485.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Anolis carolinensis]
          Length = 414

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 158/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  +  +++ +L        + P+ Y   W+ Y  A  + W   EV +  D   W   N 
Sbjct: 87  ENGLKSNEEPLLRKNPRRFVIFPIHYPDIWKMYKKAQASFWTAEEVDLSKDFPHW---NK 143

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 144 LKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 203

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  E   LFN    +P +  KA+WAL++ +               +    +  
Sbjct: 204 LIDTYIKDPEERDFLFNAIETMPCVKKKADWALRWIR-------------DRKATFGERV 250

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 251 VAFASVEGIFFSGAFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 307

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 308 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCTLMKQYIEFVADRLLLELGFS 363

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 364 KVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 400


>gi|132628|sp|P20493|RIR2_VACCC RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335366|gb|AAA48018.1| putative F4L [Vaccinia virus Copenhagen]
          Length = 319

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYYDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|8101697|gb|AAF72618.1|AF252539_2 ribonucleotide reductase small subunit M2 [Leishmania amazonensis]
          Length = 345

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 93/352 (26%), Positives = 160/352 (45%), Gaps = 28/352 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
           A    + P     +  N +++ +         L P++Y   W KY    +  W   E+ +
Sbjct: 5   AAGAEVLPADKVAQGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDL 64

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
            +D+  W +   L D ER  IK  L FFA S+ +V  N+       +  PE R +   Q 
Sbjct: 65  GNDMKDWAT---LNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFYGFQL 121

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E +HS T+  ++ +   D  E   L +  + +P I  KA WA+++  +          
Sbjct: 122 MMENIHSETYSVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWAVRWIGS---------- 171

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                 F + L  F  V EG++F   F  +  L +   M G+    + I RDE LH +F 
Sbjct: 172 ---SASFQERLIGFAAV-EGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFA 227

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             +       N H+  K  +++   ++ +A  +E  +  + +P   +G+NA    QY++F
Sbjct: 228 CLLY------NSHIKHKLPRERVLEIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEF 281

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +A+R    +G E  ++ T+ PF +M E+I L+ + NFFE RV EYQ+   + 
Sbjct: 282 VADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFFEKRVGEYQKAGVMS 331


>gi|4836362|gb|AAD30422.1|AF117061_1 ribonucleotide reductase R2 subunit [Aedes albopictus]
          Length = 398

 Score =  258 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 94/352 (26%), Positives = 160/352 (45%), Gaps = 28/352 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +A N   +  +  +   +   + +L        + P++Y   W+ Y  A  + W   EV 
Sbjct: 58  LAKNEMSAAHKREQTPFDPSIEPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVD 117

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  DLA W+    L   E+  I   L FFA+S+ +V  N+V    + +   E R +   Q
Sbjct: 118 LSKDLADWE---KLKSGEKHFISHVLAFFAASDGIVNVNLVERFSQEVQVTEARCFYGFQ 174

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E VHS  +  +I +   D  E   LFN    +P +  KA+WAL +  +         
Sbjct: 175 IAMENVHSEMYSLLIDTYIRDSKEREYLFNAIDNLPCVKKKADWALNWISS--------- 225

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
                Q    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F
Sbjct: 226 ----KQANFGERVVAFAAVEGIFFSGTFASIFWLKKRGLMPGLTFSNELISRDEGLHTDF 281

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              +   +         K  Q++   ++ EA L+E  +  + +P   +G+N     QY++
Sbjct: 282 ACLMFKYLVQ-------KPSQERVIEIIREAVLIEQEFLTKALPVDLLGMNCELMSQYIE 334

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F A+R   ++G++ ++  T+NPF +M E I L+ + NFFE +V EYQ+   +
Sbjct: 335 FEADRLLLELGIDKIYN-TKNPFSFM-EFISLEGKTNFFEKKVGEYQKWGVM 384


>gi|840719|emb|CAA54549.1| ribonucleotide reductase R2 [Arabidopsis thaliana]
          Length = 340

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 98/334 (29%), Positives = 158/334 (47%), Gaps = 30/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L A++    + P++Y   WE Y  A  + W   EV +  D+  W+    LTD E+
Sbjct: 17  SEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWE---ALTDSEK 73

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +  
Sbjct: 74  HFISHILAFFAASDGIVLENLA-RFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFI 132

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I+ KA W L + Q+                F   L   +   
Sbjct: 133 KDSKEKDRLFNAIETIPCISKKAKWCLDWIQS-------------PMSFAVRLVA-FACA 178

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+    + I RDE LH +F   +I+ +++  P      
Sbjct: 179 EGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLISLLQLHVPL----- 233

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
             +K   ++HEA  +E  +  + +P   +G+N+    QY+QF+A+R    +G E  +K  
Sbjct: 234 --EKVYQIVHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-A 290

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF WM E I L+ + NFFE RV EYQ+ + + 
Sbjct: 291 ENPFDWM-EFISLQGKTNFFEKRVGEYQKASVMS 323


>gi|320585888|gb|EFW98567.1| ribonucleotide reductase small subunit [Grosmannia clavigera
           kw1407]
          Length = 378

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 102/344 (29%), Positives = 161/344 (46%), Gaps = 32/344 (9%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            NNT +S I+A E      ++ +L   +    L P+KY   W+ Y     + W   E+ +
Sbjct: 46  ENNTAVSAIKAAEA-----EEPLLKENAQRFVLFPIKYHEIWQMYKKHEASFWTAEEIDL 100

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             DL  W   N L DDER  +   L FFA+S+ +V  N+V      +  PE R +   Q 
Sbjct: 101 SKDLHDWN--NRLNDDERFFVSHILAFFAASDGIVNENLVERFSAEVQVPEARCFYGFQI 158

Query: 122 FEEAVHSHTFQYIITSLGL---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS T+  +I +          LFN    +P I  KA+WAL++             
Sbjct: 159 MMENVHSETYSLLIDTYIKDTAQRTHLFNAIDTIPCIRKKADWALKWI------------ 206

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
            D +  F Q L  F  V EG++F   F+ I  L +   M G+    + I RDE LH +F 
Sbjct: 207 SDRESTFAQRLVAFAAV-EGIFFSGAFSSIFWLKKRGLMPGLTFSNELISRDEGLHTDFA 265

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
             + + +K        +  +Q    ++ +A  +E  +  E +P   +G+N+   +QY++F
Sbjct: 266 CLLFSHLKN-------RPSKQLIEEIIVDAVKIEQEFLTEALPCALLGMNSTLMKQYIEF 318

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTE 342
           +A+R    +G + ++  + NPF +M E I L  + NFFE RV E
Sbjct: 319 VADRLLVALGNDKVYN-STNPFDFM-ENISLGGKTNFFEKRVPE 360


>gi|37551487|gb|AAQ93139.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|38348909|gb|AAR17885.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|88900660|gb|ABD57572.1| VACV040 [Vaccinia virus]
 gi|90819703|gb|ABD98513.1| VACV-DUKE-051 [Vaccinia virus]
          Length = 319

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 148/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYYDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRYIITDAVSIEQEFLTAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|124010268|ref|ZP_01694921.1| ribonucleoside-diphosphate reductase, beta subunit [Microscilla
           marina ATCC 23134]
 gi|123983653|gb|EAY24093.1| ribonucleoside-diphosphate reductase, beta subunit [Microscilla
           marina ATCC 23134]
          Length = 330

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 93/336 (27%), Positives = 155/336 (46%), Gaps = 28/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N   + +L +  +   L P++    W+ Y  A  + W   E+ +  DL  W     L DD
Sbjct: 3   NTVSEPLLESVDNRFVLFPIQQNDIWQMYKQAEASFWTAEEIDLAQDLKDWDE--KLNDD 60

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  I   L FFA+S+ +V  N+ +     + +PE R +   Q   E +H+ T+  +I +
Sbjct: 61  ERHFITHVLAFFAASDGIVNENLAVNFLEEVKSPEARCFYGFQVAIENIHAETYSLLIDT 120

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    VP +  KA WAL++                   F + L  F  
Sbjct: 121 YIKDADEKHRLFNALETVPCVKKKAEWALRWID--------------KGSFAERLIAFAA 166

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           V EG++F   F  I  L +   M G++   + I RDE LH +F   +       N ++  
Sbjct: 167 V-EGIFFSGSFCSIFWLKKRGLMPGLSFSNELISRDEGLHCDFACLLY------NSYIKN 219

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K   +   +++  A  +E  +  + +P   +G+N+    +Y++F+A+R   ++G E  + 
Sbjct: 220 KLPNETVVSIIKNAVEIEKEFVTDALPVKLIGMNSDLMSEYIEFVADRLLVELGCEKQYN 279

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            T NPF +M E+I L+ + NFFE RV+EY +     
Sbjct: 280 -TANPFDFM-EMISLEGKTNFFEKRVSEYSKAGVAN 313


>gi|302682638|ref|XP_003031000.1| hypothetical protein SCHCODRAFT_57055 [Schizophyllum commune H4-8]
 gi|300104692|gb|EFI96097.1| hypothetical protein SCHCODRAFT_57055 [Schizophyllum commune H4-8]
          Length = 362

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 90/341 (26%), Positives = 153/341 (44%), Gaps = 27/341 (7%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             G+      ++ +L        L P++Y   W  Y     + W   E+ +  DL  W+ 
Sbjct: 32  YVGDVDCPEHEEPLLKDSISRFVLFPIQYHEIWAMYKKEEASFWTAEEMDLSKDLHDWEE 91

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
           +  + D+ER  I   L FFA+S+ +V  N++      +  PE R +   Q   E VHS T
Sbjct: 92  R--MNDNERHFISHVLAFFAASDGIVNENLLTRFCGEVKVPEARCFYGFQIMMENVHSET 149

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  +   L N    +P +  KA WAL++              D    F  
Sbjct: 150 YSLLIDTYIRDPAQRTFLLNAVETIPCVRKKAEWALRWI------------ADRRSSFAI 197

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L  F  V EG++F   FA I  L +   M G+    + I RDE +H +F   ++     
Sbjct: 198 RLVAFSAV-EGIFFSGSFASIFWLKKRGLMPGLTFSNELITRDEGMHTDFACLLLTH--- 253

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
               +  +   +    ++ EA  +E  +  + +P   +G+NA    QY++F+A+R    +
Sbjct: 254 ----MRRRPHPEVIEMIIKEAVAIEKEFLTDALPVSLIGMNADLMCQYIEFVADRLLVAL 309

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           G + ++  T NPF +M  +I L+ + NFFE RV++Y+  A 
Sbjct: 310 GNDKVWNAT-NPFDFMD-MISLQGKTNFFEKRVSDYKIAAV 348


>gi|71024571|ref|XP_762515.1| hypothetical protein UM06368.1 [Ustilago maydis 521]
 gi|46101992|gb|EAK87225.1| hypothetical protein UM06368.1 [Ustilago maydis 521]
          Length = 424

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/321 (26%), Positives = 147/321 (45%), Gaps = 27/321 (8%)

Query: 31  VNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFA 90
              L P+++   W+ Y  A  + W   E+ +  DL  W   N L D+ER  I   L FFA
Sbjct: 103 RFVLFPIRFHEIWQMYKKAEASFWTAEEIDLSKDLHDWD--NKLNDNERHFISHVLAFFA 160

Query: 91  SSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFN 147
           +S+ +V  N+V      +   E R +   Q   E +HS T+  +I +   +  +   LF+
Sbjct: 161 ASDGIVNENLVERFSSEVQAAEARCFYGFQIMMENIHSETYSLLIDTYIREPEQREYLFD 220

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
               +P +  KA+WAL++              D    F + L  F  V EG++F   FA 
Sbjct: 221 AVETIPVVKQKADWALRWI------------SDKRATFAERLVAFAAV-EGIFFSGSFAS 267

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           I  L +   M G+    + I RDE LH +F   + + ++        +        ++ E
Sbjct: 268 IFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFSHLRR-------RAHPDTVLKIITE 320

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A  +E A+  E++P   +G+N+    QY++++A+R    +G    +  +  PF +M+  I
Sbjct: 321 AVEIEKAFLCESIPVALIGMNSKLMCQYIEYVADRLLVSLGNPVHYG-STCPFDFMT-NI 378

Query: 328 DLKKEKNFFETRVTEYQQGAE 348
            L+ + NFFE +V EY +   
Sbjct: 379 SLEGKTNFFEKKVAEYAKAGV 399


>gi|323098642|gb|ADX22879.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 85/332 (25%), Positives = 146/332 (43%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FF +S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFXASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++    +                 +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIHDSAGXG--------------ERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++  A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRFIITNAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|145537171|ref|XP_001454302.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124422057|emb|CAK86905.1| unnamed protein product [Paramecium tetraurelia]
          Length = 507

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 94/351 (26%), Positives = 158/351 (45%), Gaps = 31/351 (8%)

Query: 5   TGLSPIQAGEKRVNVD--DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           T LS +Q  +  V  +  D+ +L    +   L P+KY   W  Y     + W   E+ + 
Sbjct: 170 TPLSNLQTSQPVVQQNECDEPLLKQNPNRFVLFPIKYNDIWNMYKQHKASFWTAEEIDLY 229

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W+    LT DE+  IK  L FFA+S+ +V  N+       +  PE R +   Q  
Sbjct: 230 QDLKDWE---KLTADEKHFIKYVLAFFAASDGIVNENLAQQFCTEVQVPEARCFYGFQIA 286

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E +HS T+  +I +   DE E   L +    VP I  KA WA+++     S        
Sbjct: 287 MENIHSETYSLLIDTYITDENEKNYLLHAIDNVPVIQKKAMWAMKWINNNDS-------- 338

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
                   +  + +   EG++F   F  I  + + + M G+    + I RDE LH +F  
Sbjct: 339 ------FAERLIAFAAVEGIFFSGSFCAIFWIKKRSLMPGLTFSNELISRDEGLHTDFAC 392

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   +  +       E       ++  A  +E  +  E +P   +G+N+   +QY++F+
Sbjct: 393 LLYKHMINKLSIQRVHE-------IISSAVEIEKEFISEALPVELIGMNSNLMKQYIEFV 445

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           A+R    +G   ++  ++NPF WM  +I L+ + NFFE RV +YQ+   + 
Sbjct: 446 ADRLIFALGAPKIYN-SKNPFEWMD-MISLQGKTNFFERRVGDYQKAGVMS 494


>gi|73974198|ref|XP_539109.2| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 2 [Canis familiaris]
          Length = 351

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 99/339 (29%), Positives = 160/339 (47%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  V  D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEVKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +               +    +  
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIE-------------DRKSTFGERV 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 244

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 245 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV EYQ+ A +
Sbjct: 301 KVF-QAENPFDFM-ENISLEGKTNFFEKRVAEYQRFAVM 337


>gi|257053403|ref|YP_003131236.1| ribonucleotide-diphosphate reductase subunit beta [Halorhabdus
           utahensis DSM 12940]
 gi|256692166|gb|ACV12503.1| Ribonucleoside-diphosphate reductase [Halorhabdus utahensis DSM
           12940]
          Length = 330

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 164/331 (49%), Positives = 229/331 (69%), Gaps = 4/331 (1%)

Query: 23  RMLN--ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            +++  A  D N++LP+ Y WA E Y +  NN+W+P E+PMQDD+A W   + LTD ER 
Sbjct: 2   PIIDTAAEHDPNKILPIDYDWAREYYEAGVNNNWVPEEIPMQDDVAQWN-GDELTDAERQ 60

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +++ NLGFF+++ESL ANN+VLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG 
Sbjct: 61  LVEWNLGFFSTAESLTANNLVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGF 120

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +   L+ MY  VPSI  K  + +  T+++  P FT       ++ L+DL  FYV+ EG++
Sbjct: 121 EPEYLYGMYDRVPSIEEKDQFVVDLTRSIDDPEFTIDGDSDVRDLLRDLVGFYVIMEGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY GFA +L L R NKMVGI +Q++YIMRDESLH+ FG+D+I+QI+ ENP +WT EF  +
Sbjct: 181 FYAGFAMMLGLKRQNKMVGIGQQFEYIMRDESLHVGFGVDLIDQIRTENPGVWTDEFDSE 240

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  LE  YA E  P+  +G++      Y+++IA+RR  Q+ L   +  TENPF
Sbjct: 241 VIDLIKEAVELEQIYAREACPEEILGMSGSQFADYVEYIADRRLDQLDLPEQYG-TENPF 299

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           PWMSE +DL KEKNFFET+VTEYQ G  L+W
Sbjct: 300 PWMSEQVDLNKEKNFFETQVTEYQSGGSLEW 330


>gi|328700093|ref|XP_001944536.2| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Acyrthosiphon pisum]
          Length = 361

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 94/351 (26%), Positives = 156/351 (44%), Gaps = 28/351 (7%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           M N      + A     +   + +L        + P+ Y   W  Y     + W   EV 
Sbjct: 18  MTNKNFFESVSAYRANFDATIEPLLKDNPRRFVIFPIIYDDIWAMYKKQEASFWNVEEVN 77

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           ++ DL  W     LTDDER  I   L FFA+S+ +V  N+V    + +   E R +   Q
Sbjct: 78  LKSDLEDW---MKLTDDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQ 134

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS  +  +I +   D  E   LFN    +P +  KA+WAL++            
Sbjct: 135 IMMENIHSEMYSLLIDTYIQDPKEKDFLFNAIETMPCVKKKADWALKWI----------- 183

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
             D+   F + L  F  V EG++F   FA +  L +   M G+    + I RDE LH +F
Sbjct: 184 -SDSKATFGERLVAFAAV-EGIFFSGSFAALFWLKKRGLMPGLTFSNELISRDEGLHTDF 241

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              +   ++ + P       Q     ++ EA  +E  +    +P   VG++      Y++
Sbjct: 242 ACLLFKHLEQKPP-------QAVITHIICEAVTIEQDFLTNALPVRMVGMSCEKMAVYIE 294

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           F+A+R  +++G   ++  + NPFP+M  +I  + + NFFE RV +YQ+ + 
Sbjct: 295 FVADRLLNELGCPTVY-RSSNPFPFMD-LISQQGKTNFFEKRVGDYQKASV 343


>gi|187607401|ref|NP_001119973.1| ribonucleotide reductase M2 B (TP53 inducible) [Xenopus (Silurana)
           tropicalis]
 gi|165971068|gb|AAI58191.1| LOC100144925 protein [Xenopus (Silurana) tropicalis]
          Length = 346

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 98/348 (28%), Positives = 157/348 (45%), Gaps = 31/348 (8%)

Query: 5   TGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDD 64
           TG   +  G      +++  L        + P+ Y   W+ Y  A  + W   EV +  D
Sbjct: 13  TGDKNLTNGHSD---EEEPFLRKNPQRFVIFPIHYPDIWKMYKKAQASFWTAEEVDLSKD 69

Query: 65  LALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEE 124
           L  W+    L  +ER  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E
Sbjct: 70  LVHWE---KLKPEERNFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIE 126

Query: 125 AVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDA 181
            VHS  +  +I +   D      LFN    +P +  KA WAL++              D 
Sbjct: 127 NVHSEMYSLLIETYIKDPRRREFLFNAIETMPCVRKKAQWALRWI------------SDR 174

Query: 182 DQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDV 241
              F + +  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +
Sbjct: 175 KASFGERVVAFAAV-EGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLM 233

Query: 242 INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIAN 301
            + +         K  +++   ++  A  +E  +  E +P   +G+N    + Y++F+A+
Sbjct: 234 FHYLVK-------KPTEERVTEIIVNAVRIEQEFLTEALPVSLIGMNCTLMKTYIEFVAD 286

Query: 302 RRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           R   ++G    FK  ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 287 RLLVELGCSKAFK-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 332


>gi|15791173|ref|NP_280997.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           sp. NRC-1]
 gi|169236929|ref|YP_001690129.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           salinarum R1]
 gi|10581791|gb|AAG20477.1| ribonucleoside reductase small chain [Halobacterium sp. NRC-1]
 gi|167727995|emb|CAP14783.1| ribonucleoside-diphosphate reductase beta subunit [Halobacterium
           salinarum R1]
          Length = 331

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/327 (48%), Positives = 228/327 (69%), Gaps = 2/327 (0%)

Query: 26  NARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRN 85
           +A  D N++LP+ Y WA E Y     N+W P EV MQ D++ W+  N LTD ER +++ N
Sbjct: 7   DAEHDPNKILPIDYDWAREYYQQGVANNWTPEEVAMQGDISQWQ-GNELTDAERQLVEWN 65

Query: 86  LGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGEL 145
           LGFF+++ESL ANNIVLAIY +++ PECRQYLLRQA+EEAVH+ TF Y   SLG D   +
Sbjct: 66  LGFFSTAESLTANNIVLAIYEYVTAPECRQYLLRQAYEEAVHTDTFIYCCDSLGFDPEHM 125

Query: 146 FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGF 205
           + MY  +PSI  K  + +  T+ +   +FT  T D  ++FL+DL  FYV+ EG++FY GF
Sbjct: 126 YGMYDRIPSIAEKDEFVVGLTRAVDDQAFTIDTDDDLRDFLRDLVGFYVIMEGIFFYAGF 185

Query: 206 AQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML 265
           A +L+L R  KMVG+ EQ++YIMRDESLHLNFG+D+INQI+ E+P +WT +F+ +  +++
Sbjct: 186 AMMLALKRRGKMVGVGEQFEYIMRDESLHLNFGVDLINQIRDEHPDVWTADFEAEVNSLM 245

Query: 266 HEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSE 325
            +A  LE  YA +  P   +G+++     Y++++A+RR  Q+ ++P++  T+NPFPWM+E
Sbjct: 246 RDAVDLEQLYARDACPDDLLGMSSEQFADYVEYVADRRFQQLRMDPVYG-TDNPFPWMTE 304

Query: 326 VIDLKKEKNFFETRVTEYQQGAELKWD 352
            +DL  E NFFE  V+EYQQG  L WD
Sbjct: 305 QVDLNTETNFFERNVSEYQQGGSLDWD 331


>gi|290771185|emb|CAY80753.2| Rnr2p [Saccharomyces cerevisiae EC1118]
          Length = 399

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|241589542|ref|YP_002979567.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|240868254|gb|ACS65913.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
          Length = 328

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 179/311 (57%), Positives = 228/311 (73%), Gaps = 5/311 (1%)

Query: 1   MANNTGLSPI-----QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWM 55
           M  ++    +      A  KRVNV +KR++N  +DVNQL+P KY WAWEKYL+ C NHWM
Sbjct: 1   MDMSSSYDEVAHAHASATAKRVNVAEKRIINGATDVNQLVPFKYKWAWEKYLAGCANHWM 60

Query: 56  PTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQ 115
           P EV M  D+ALWK  NGLT+DER +IKRNLGFF +++SL ANNIVL  YRH++ PECRQ
Sbjct: 61  PQEVNMARDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRHITAPECRQ 120

Query: 116 YLLRQAFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFT 175
           YLLRQAFEEA+H+H +QYI+ SLGL+E E+FN Y EV SI  K  + + +  TL+ PSF 
Sbjct: 121 YLLRQAFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFK 180

Query: 176 TGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHL 235
           TGT + D++ L+ L VF  + EG++FY GF QIL++GR NKM G AEQYQYI+RDESLH 
Sbjct: 181 TGTPENDRKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHC 240

Query: 236 NFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQY 295
           NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA +TMP+G +GLNA   + Y
Sbjct: 241 NFGIDLINQIKLENPHLWTAEFKVEITELFKQAVDLEYRYAEDTMPRGVLGLNASMFKGY 300

Query: 296 MQFIANRRCHQ 306
           ++FI NRRC  
Sbjct: 301 LRFICNRRCRS 311


>gi|326403282|ref|YP_004283363.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
 gi|325050143|dbj|BAJ80481.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
          Length = 338

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 158/331 (47%), Gaps = 20/331 (6%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L          P +Y WA+E +L+    HW+P EVP+ DD+  W     LT  ER ++ 
Sbjct: 22  LLTENP---VYKPFRYPWAYEAWLTQQRVHWLPEEVPLADDVKDWH--RNLTPGERNLLT 76

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           +   FF  ++  V N  +    +     E    L   +  E +H   + +++ ++G+ E 
Sbjct: 77  QIFRFFTQADVEVNNCYMKHYSQVFKPTEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEV 136

Query: 144 ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYT 203
           E ++ + +   +  K ++  ++            + D+  E  + L  F    EG+  + 
Sbjct: 137 E-YSAFLKYKEMKDKYDYMQEF------------SVDSKHEIAKTLAAFGAFTEGLQLFA 183

Query: 204 GFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRT 263
            FA +L+  R NKM G+ +   + +RDESLH N  I +      ENP +WT+E +++   
Sbjct: 184 SFAILLNFPRFNKMKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYL 243

Query: 264 MLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
                   E A+       G   GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW
Sbjct: 244 CCATIVDHEDAFIDLAFEFGAVEGLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPW 303

Query: 323 MSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           + E+++  +  NFFE R TEY + +    WD
Sbjct: 304 LDEMLNAVEHTNFFENRATEYSKASTAGSWD 334


>gi|299747484|ref|XP_001837064.2| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
 gi|298407540|gb|EAU84681.2| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 379

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 92/341 (26%), Positives = 153/341 (44%), Gaps = 28/341 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
             GE  +   ++ +L        L P++Y   W  Y  A  + W   E+ +  D+  W  
Sbjct: 44  FVGEVDLPESEEPLLKPSPKRLTLYPIQYPEIWTHYKRAQASFWTAEEIDLSHDMMDW-- 101

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
            + LT+ ER  + R L FFASS+ +V  N+V      +  PE R +   Q   E VHS T
Sbjct: 102 -SKLTNAERHFLSRILAFFASSDGIVNENLVERFSSEVQVPEARCFYGFQVMIENVHSET 160

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   D  E   LF     +PSI  KA WAL +            T D    F +
Sbjct: 161 YSLLIDTYIKDPEERDFLFRAIETIPSIQRKAEWALTW------------TSDKSTTFAE 208

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
            L   + V EG++F   FA I  + +   + G+    + I RDE +H +F   +   ++ 
Sbjct: 209 RLVA-FAVVEGVFFSGSFAAIFWMRKRGLLPGLTFSNELISRDEGMHTDFACLLFAYLRK 267

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
                           ++ EA  +E  +  + +P   +G+N+    QY++F+A+R    +
Sbjct: 268 RPHS-------DTILAIVTEAVEIEKEFFSDALPVSLIGMNSSLMNQYIEFVADRLLTSL 320

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           G +  +    NPF +M E+I ++ + NFFE RV++Y +   
Sbjct: 321 GNDKHYHVD-NPFDFM-ELISMEGKANFFEKRVSDYAKANV 359


>gi|148259750|ref|YP_001233877.1| ribonucleotide-diphosphate reductase subunit beta [Acidiphilium
           cryptum JF-5]
 gi|146401431|gb|ABQ29958.1| Ribonucleoside-diphosphate reductase [Acidiphilium cryptum JF-5]
          Length = 338

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 158/331 (47%), Gaps = 20/331 (6%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L          P +Y WA+E +L+    HW+P EVP+ DD+  W     LT  ER ++ 
Sbjct: 22  LLTENP---VYKPFRYPWAYEAWLTQQRVHWLPEEVPLADDVKDWH--RNLTPGERNLLT 76

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           +   FF  ++  V N  +    +     E    L   +  E +H   + +++ ++G+ E 
Sbjct: 77  QIFRFFTQADVEVNNCYMKHYSQVFKPTEVLMMLSAFSNIETIHIAAYSHLLDTIGMPEV 136

Query: 144 ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYT 203
           E ++ + +   +  K ++  ++            + D+  E  + L  F    EG+  + 
Sbjct: 137 E-YSAFLKYKEMKDKYDYMQEF------------SVDSKHEIAKTLAAFGAFTEGLQLFA 183

Query: 204 GFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRT 263
            FA +L+  R NKM G+ +   + +RDESLH N  I +      ENP +WT+E +++   
Sbjct: 184 SFAILLNFPRFNKMKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYL 243

Query: 264 MLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
                   E A+       G   GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW
Sbjct: 244 CCATIVDHEDAFIDLAFEFGAVEGLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPW 303

Query: 323 MSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           + E+++  +  NFFE R TEY + +    WD
Sbjct: 304 LDEMLNAVEHTNFFENRATEYSKASTAGSWD 334


>gi|323098445|gb|ADX22683.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 86/332 (25%), Positives = 146/332 (43%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FF +S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFXASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++  A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRFIITNAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|296227440|ref|XP_002759377.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           isoform 1 [Callithrix jacchus]
          Length = 351

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 98/350 (28%), Positives = 162/350 (46%), Gaps = 28/350 (8%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
           +    S     E  +  +++ +L   S    + P++Y   W+ Y  A  + W   EV + 
Sbjct: 13  DQDERSSADTNENEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS 72

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            DL  W   N L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q  
Sbjct: 73  KDLPHW---NKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQIL 129

Query: 123 EEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTK 179
            E VHS  +  +I +   D  +   LFN    +P +  KA+WAL++              
Sbjct: 130 IENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA------------ 177

Query: 180 DADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGI 239
              +    +  V +   EG++F   FA I  L +   M G+    + I RDE LH +F  
Sbjct: 178 -DRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFAC 236

Query: 240 DVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 299
            +   +         K  +++ R ++ +A  +E  +  E +P G +G+N    +QY++F+
Sbjct: 237 LMFQYLVN-------KPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFV 289

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           A+R   ++G    F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 290 ADRLLVELGFSKFF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|323347997|gb|EGA82256.1| Rnr2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 399

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|6322434|ref|NP_012508.1| Rnr2p [Saccharomyces cerevisiae S288c]
 gi|1172946|sp|P09938|RIR2_YEAST RecName: Full=Ribonucleoside-diphosphate reductase small chain 1;
           AltName: Full=Ribonucleotide reductase R2 subunit 1;
           AltName: Full=Ribonucleotide reductase small subunit 1
 gi|52695523|pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695524|pdb|1SMQ|B Chain B, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695525|pdb|1SMQ|C Chain C, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695526|pdb|1SMQ|D Chain D, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|172450|gb|AAA34988.1| ribonucleoside diphosphate reductase small subunit [Saccharomyces
           cerevisiae]
 gi|1008142|emb|CAA89317.1| RNR2 [Saccharomyces cerevisiae]
 gi|285812874|tpg|DAA08772.1| TPA: Rnr2p [Saccharomyces cerevisiae S288c]
          Length = 399

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|209966751|ref|YP_002299666.1| ribonucleotide-diphosphate reductase subunit beta [Rhodospirillum
           centenum SW]
 gi|209960217|gb|ACJ00854.1| ribonucleoside-diphosphate reductase, beta subunit [Rhodospirillum
           centenum SW]
          Length = 322

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 91/332 (27%), Positives = 159/332 (47%), Gaps = 20/332 (6%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
            +L          P +Y WA+E +L+    HW+P EVP+ DD+  W+    LT+ ER ++
Sbjct: 4   PLLTPNP---VYKPFRYPWAYEAWLTQQRIHWLPEEVPLADDVKDWRQ--KLTEAERNLL 58

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
            +   FF  ++  V N  +    R     E    L   +  E VH   + +++ ++G+ E
Sbjct: 59  TQIFRFFTQADVEVNNCYMRHYSRVFQPTEVCMMLAAFSAMETVHIAAYSHLLDTIGMPE 118

Query: 143 GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFY 202
            E ++ +     +  K ++   +              D+ ++  + L VF    EG+  +
Sbjct: 119 IE-YSAFLRYKEMKDKYDYMQGF------------NVDSLEDIAKTLAVFGAFTEGLQLF 165

Query: 203 TGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSR 262
             FA +++  R NKM G+ +   + +RDE+LH    I +      ENP +WT+ FQ++  
Sbjct: 166 ASFAILMNFPRFNKMKGMGQIVTWSVRDETLHTLSMIKLFRTFVNENPQVWTEAFQRELT 225

Query: 263 TMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP 321
                    E A+       G   G+ A   ++Y+++IA+RR  Q+GLEP+++  +NP P
Sbjct: 226 VCCETIVHHEDAFIDLAFEMGPVEGMTAEDVKRYIRWIADRRLGQLGLEPVYRIEKNPLP 285

Query: 322 WMSEVIDLKKEKNFFETRVTEYQQGAE-LKWD 352
           WM  +++  +  NFFE R TEY + A    WD
Sbjct: 286 WMDAILNGIEHTNFFENRATEYSKAATRGTWD 317


>gi|321263951|ref|XP_003196693.1| ribonucleotide reductase small subunit [Cryptococcus gattii WM276]
 gi|317463170|gb|ADV24906.1| Ribonucleotide reductase small subunit, putative [Cryptococcus
           gattii WM276]
          Length = 430

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 98/328 (29%), Positives = 153/328 (46%), Gaps = 28/328 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L        L P+KY   W+ Y  A  + W   E+    DL  W   + +T+ ER  I 
Sbjct: 102 ILRESDSRFVLFPIKYNEIWQAYKRAQASFWTAEELDFGHDLIDWH--DRMTEQERFFIL 159

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  NIV      +   E R +   Q+  E VHS T+  +I +   D  
Sbjct: 160 RILAFFAASDGIVGENIVSQFSLEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDAQ 219

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     +P I  KA+WAL+Y                D+   +   V +   EG++
Sbjct: 220 EKDFLFRGMENIPCIKQKADWALKYI--------------TDELPFRTRLVAFACVEGIF 265

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE +H +F   + N +K        +    +
Sbjct: 266 FSGSFAAIFWLKKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLK-------HRCSTDE 318

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA ++E  +  + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF
Sbjct: 319 VHRIVSEALVIEKQFLTDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPF 377

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAE 348
            WM E+I L+ + NFFE+RV+ YQ+   
Sbjct: 378 DWM-ELISLQGKANFFESRVSAYQKANV 404


>gi|1710398|sp|P50650|RIR2_PLAF4 RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|555613|gb|AAA50170.1| ribonucleotide reductase small subunit [Plasmodium falciparum]
          Length = 349

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 97/361 (26%), Positives = 173/361 (47%), Gaps = 38/361 (10%)

Query: 1   MANNTGLS--PIQAGEKRV-------NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACN 51
           MA+   +S  PI + ++R           ++++LN  SD   L P+ Y   W+ Y  A  
Sbjct: 1   MADVINISRIPIFSKQEREFSDLQKGKEINEKILNKESDRFTLYPILYPDVWDFYKKAEA 60

Query: 52  NHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNP 111
           + W   E+ +  DL  ++    L ++E+  IK  L FFA+S+ +V  N+     R +   
Sbjct: 61  SFWTAEEIDLSSDLKDFE---KLNENEKHFIKHVLAFFAASDGIVLENLASKFLREVQIT 117

Query: 112 ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQT 168
           E +++   Q   E +HS T+  +I +   DE E   LF+    +P++  KA WA ++   
Sbjct: 118 EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKERLNLFHAIENIPAVKNKALWAAKWIND 177

Query: 169 LSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIM 228
            +S                +  V     EG+ F   F  I    + NK+ G+    + I 
Sbjct: 178 TNS--------------FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELIS 223

Query: 229 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLN 288
           RDE LH +F   + + +  + P       +Q  + ++ EA  +E ++  E++P   +G+N
Sbjct: 224 RDEGLHTDFNCLIYSLLDNKLP-------EQIIQNIVKEAVEVERSFICESLPCDLIGMN 276

Query: 289 APSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +    QY++F+A+R    +G   +F +++NPF WM  +I L+ + NFFE RV +YQ+   
Sbjct: 277 SRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWMD-LISLQGKTNFFEKRVADYQKSGV 334

Query: 349 L 349
           +
Sbjct: 335 M 335


>gi|151945057|gb|EDN63308.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae YJM789]
 gi|190409471|gb|EDV12736.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae RM11-1a]
 gi|256271075|gb|EEU06176.1| Rnr2p [Saccharomyces cerevisiae JAY291]
          Length = 399

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|308809930|ref|XP_003082274.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
 gi|116060742|emb|CAL57220.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
          Length = 382

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 90/331 (27%), Positives = 148/331 (44%), Gaps = 29/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   L P+K+   WE Y  A  + W   EV +  D   W++   L ++E+  
Sbjct: 63  EPLLRDNPDRFCLFPIKHPRVWEMYKKAEASFWTAEEVDLTYDYKDWQT---LNENEKHF 119

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +   L FFASS+ +V  N+       +  PE R +   Q   E +HS  +  ++ +   D
Sbjct: 120 VSHVLAFFASSDGIVLENLCSRFMSDVQLPEARSFYGFQLAIENIHSEMYSLLLDTYIKD 179

Query: 142 EG---ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
                ELF     VP++  KA+WAL +  +             D  F + L   +   EG
Sbjct: 180 PKKKSELFRAIHTVPTVAMKADWALHWIGS-------------DASFPERLVG-FACVEG 225

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   +   ++           +
Sbjct: 226 IFFSGSFCAIFWLKKRGLMRGLTFSNELISRDEGLHCDFACLLYGMLQN-------PLSE 278

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
                ++ +A  +E  +  + +    VG+NA     Y++F+A+R   Q+G   LF    N
Sbjct: 279 ATLHHIVGDAVKIEKEFVCDALSCSLVGMNADMMSTYIEFVADRLLIQLGASKLFNAV-N 337

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM E+I L+ + NFFE RV +YQ+   +
Sbjct: 338 PFDWM-ELISLQGKANFFEHRVDQYQKAGVM 367


>gi|207343947|gb|EDZ71248.1| YJL026Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 399

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 101/334 (30%), Positives = 158/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+S+V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDSIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|194036959|ref|XP_001925036.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B [Sus
           scrofa]
          Length = 351

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 97/339 (28%), Positives = 157/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E      ++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEAKSSEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NR 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++                 +    +  
Sbjct: 141 LIDTYIRDPKQREFLFNAIETMPYVKKKADWALRWIA-------------DRKATFGERV 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 244

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  + + R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 245 ----KPSEARVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLTELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 301 KVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|149721713|ref|XP_001493623.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) [Equus
           caballus]
          Length = 351

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 98/339 (28%), Positives = 159/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     +++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEAKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           LT DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LTSDEKYFISHVLAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WALQ+                 +    +  
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALQWIA-------------DRKSTFGERV 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 244

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G  
Sbjct: 245 ----KPSEERVREIIVNAVEIEQEFLTEALPVDLIGMNCVLMKQYIEFVADRLLVELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 301 KVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|225012154|ref|ZP_03702591.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
 gi|225003709|gb|EEG41682.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
          Length = 325

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 92/332 (27%), Positives = 154/332 (46%), Gaps = 28/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P+K+   WE Y     + W   E+ +  DL  W +   LT+DE+  
Sbjct: 5   EPILQENENRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLHQDLTDWNT--KLTEDEKYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   LF      P+I  KA+WAL++  + S                 +  + +   EG
Sbjct: 123 DVEKDRLFKAIEVFPAIKKKADWALRWIDSDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + N           K   
Sbjct: 168 IFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHL------VNKVPP 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            + + +L +A  +E  +  E++P   +G+NA    QY++F+ +R   ++GLE  F  T N
Sbjct: 222 ARIKEILLDALTIEREFITESLPISLIGMNAKLMTQYLEFVTDRLLQELGLEKEFNVT-N 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M  +I L+ + NFFE RV EYQ+   L 
Sbjct: 281 PFDFMD-MISLQGKTNFFEKRVGEYQKAGVLN 311


>gi|124808087|ref|XP_001348226.1| ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
 gi|23497116|gb|AAN36665.1|AE014816_50 ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
          Length = 349

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 97/361 (26%), Positives = 173/361 (47%), Gaps = 38/361 (10%)

Query: 1   MANNTGLS--PIQAGEKRV-------NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACN 51
           MA+   +S  PI + ++R           ++++LN  SD   L P+ Y   W+ Y  A  
Sbjct: 1   MADVINISRIPIFSKQEREFSDLQKGKEINEKILNKESDRFTLYPILYPDVWDFYKKAEA 60

Query: 52  NHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNP 111
           + W   E+ +  DL  ++    L ++E+  IK  L FFA+S+ +V  N+     R +   
Sbjct: 61  SFWTAEEIDLSSDLKDFE---KLNENEKHFIKHVLAFFAASDGIVLENLASKFLREVQIT 117

Query: 112 ECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQT 168
           E +++   Q   E +HS T+  +I +   DE E   LF+    +P++  KA WA ++   
Sbjct: 118 EAKKFYSFQIAVENIHSETYSLLIDNYIKDEKERLNLFHAIENIPAVKNKALWAAKWIND 177

Query: 169 LSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIM 228
            +S                +  V     EG+ F   F  I    + NK+ G+    + I 
Sbjct: 178 TNS--------------FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELIS 223

Query: 229 RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLN 288
           RDE LH +F   + + +  + P       +Q  + ++ EA  +E ++  E++P   +G+N
Sbjct: 224 RDEGLHTDFNCLIYSLLDNKLP-------EQMVQNIVKEAVEVERSFICESLPCDLIGMN 276

Query: 289 APSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +    QY++F+A+R    +G   +F +++NPF WM  +I L+ + NFFE RV +YQ+   
Sbjct: 277 SRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWMD-LISLQGKTNFFEKRVADYQKSGV 334

Query: 349 L 349
           +
Sbjct: 335 M 335


>gi|313117005|ref|YP_004038129.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
 gi|312294957|gb|ADQ68993.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
          Length = 330

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 162/330 (49%), Positives = 226/330 (68%), Gaps = 4/330 (1%)

Query: 24  MLNARS--DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +LN  +  D N++LP+ Y WA + Y     N+W+P E+PMQ+D+A W   + L+D E+ +
Sbjct: 3   ILNNDTEHDPNKILPIDYDWARQYYRDGVANNWVPEEIPMQEDIAQWN-GDALSDSEKQL 61

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           ++ NLGFF+++ESL ANNIVLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG D
Sbjct: 62  VEWNLGFFSTAESLTANNIVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFD 121

Query: 142 EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWF 201
              ++ MY  VPSI  K  + +  T+ L  P FT       ++ L+DL  FYVV EG++F
Sbjct: 122 PEYMYGMYDRVPSIKEKDEFVVDLTRNLDDPDFTVEDTADVRDLLRDLVGFYVVMEGVFF 181

Query: 202 YTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS 261
           Y GFA +L+L R NKMVGI +Q++YIMRDESLH+ FG+D+INQI+ ENP  WT EF  + 
Sbjct: 182 YAGFAMMLALKRQNKMVGIGQQFEYIMRDESLHVGFGVDLINQIRAENPDAWTDEFGAEV 241

Query: 262 RTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP 321
           R ++ +A  LE  YA E  P   +G++     +Y++ +A+RR  Q+ L+  +  T+NPFP
Sbjct: 242 RDLIEKAVDLEQIYAREACPDDVLGMSPDQFAEYVEHVADRRLGQLDLDASYG-TDNPFP 300

Query: 322 WMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           WMSE +DL KEKNFFET+VTEYQ G  L W
Sbjct: 301 WMSEAVDLNKEKNFFETQVTEYQSGGSLDW 330


>gi|323308423|gb|EGA61668.1| Rnr2p [Saccharomyces cerevisiae FostersO]
          Length = 399

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 100/334 (29%), Positives = 157/334 (47%), Gaps = 27/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W   N + ++ER
Sbjct: 74  KEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWN--NRMNENER 131

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +  
Sbjct: 132 FFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYI 191

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++ Q            DAD  F + L   +   
Sbjct: 192 KDPKESEFLFNAIHTIPEIGEKAEWALRWIQ------------DADALFGERLVA-FASI 238

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   +   +K +        
Sbjct: 239 EGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDP----- 293

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  
Sbjct: 294 --AIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKV- 350

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           ENPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 351 ENPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 383


>gi|328872436|gb|EGG20803.1| ribonucleotide reductase small subunit [Dictyostelium fasciculatum]
          Length = 335

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 88/331 (26%), Positives = 155/331 (46%), Gaps = 28/331 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   L P+KY   W  Y  A  + W   E+ +  D+  W+  N L D+ER 
Sbjct: 6   EEPLLKENKDRFVLFPIKYTDIWNMYKKAEASFWTAEEIDLASDVNEWE--NKLNDNERH 63

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +   
Sbjct: 64  FIKNVLAFFAASDGIVNENLATKFMSEVQIPEARCFYGFQIAIENIHSETYSLLIDTYIK 123

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           +  E   LFN    +P +  KA+WAL++                + +   +  V +   E
Sbjct: 124 NPDEKKVLFNAIETIPCVKKKADWALRWI--------------TNSKSFAERLVAFAAVE 169

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + N++  +         
Sbjct: 170 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYNKLNNKLDV------ 223

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
            +   +++ +A   E  +  +++P   +G+N+    +Y++F A+R    +G + ++  + 
Sbjct: 224 -KTIESIIRDAVECEKEFVTDSLPVDLIGMNSREMSKYIEFCADRLLVSLGYKKIYN-SA 281

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           NPF WM E+I L ++ NFFE +V+EY +   
Sbjct: 282 NPFDWM-EMISLMRKANFFEGKVSEYAKAGV 311


>gi|126322530|ref|XP_001380256.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 361

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 93/339 (27%), Positives = 162/339 (47%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           +  +   ++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 34  DNGLKSSEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 90

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  +  
Sbjct: 91  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENIHSEMYSL 150

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WALQ+                 +    +  
Sbjct: 151 LIDTYIKDPQKREFLFNAIETMPCVKRKADWALQWIA-------------DRKSTFGERV 197

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   + + +     
Sbjct: 198 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFHYLVN--- 254

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ + ++  A  +E  +  + +P G +G+N+   +QY++F+A+R   ++G  
Sbjct: 255 ----KPSEERVKEIIINAVEIEQEFLTDALPVGLIGINSTLMKQYIEFVADRLLVELGFS 310

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F  ++NPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 311 KVF-QSDNPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 347


>gi|194673004|ref|XP_607398.4| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|297482473|ref|XP_002692807.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Bos
           taurus]
 gi|296480530|gb|DAA22645.1| ribonucleotide reductase M2 polypeptide-like [Bos taurus]
          Length = 351

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 97/339 (28%), Positives = 159/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKKAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  +E+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSEEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++                 +    +  
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIA-------------DRKSTFGERV 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 244

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 245 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLTELGFS 300

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV+EYQ+ A +
Sbjct: 301 KVF-QAENPFDFM-ENISLEGKTNFFEKRVSEYQRFAVM 337


>gi|6969682|gb|AAF33894.1| TF4L [Vaccinia virus Tian Tan]
          Length = 319

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 88/332 (26%), Positives = 148/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAPNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE L  +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLRCDFACLMFKHLL-------HPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    E Y++F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTAALPVKLIGMNCEMMETYIEFVADRLISELGFKKIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQQ   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQQMGVMS 307


>gi|289742419|gb|ADD19957.1| ribonucleotide reductase beta subunit [Glossina morsitans
           morsitans]
          Length = 396

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 89/354 (25%), Positives = 157/354 (44%), Gaps = 28/354 (7%)

Query: 2   ANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPM 61
            + T  +       + +   + +L        + P++Y   W+ Y  A  + W   EV +
Sbjct: 57  KDATVTTASDNSVAKFDPSIEPLLKENPKRFVIFPIQYPEIWKMYKKAEASFWTAEEVDL 116

Query: 62  QDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQA 121
             D+  W   N L+D ER  I   L FFA+S+ +V  N+V    + +   E R +   Q 
Sbjct: 117 SKDMDDW---NRLSDGERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQI 173

Query: 122 FEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGT 178
             E VHS  +  +I +  +DE E   LFN    +P +  KA WAL +  +          
Sbjct: 174 AMENVHSEMYSLLIETYIMDEKEREYLFNAIETMPLVKKKAEWALAWISS---------- 223

Query: 179 KDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFG 238
                    +  + +   EG++F   FA I  L +   M G+    + I RDE LH  F 
Sbjct: 224 ---HSANFGERIIAFAAVEGIFFSGSFASIFWLKKRGIMPGLTFSNEMISRDEGLHCEFA 280

Query: 239 IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQF 298
           + +   +         K  +++   ++ +A  +E  +  E +P   +G+N+ S  +Y+++
Sbjct: 281 VLMFKHLIQ-------KPSKERILEIITDAVKIEKEFLTEALPVDLIGMNSESMCKYIEY 333

Query: 299 IANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           +A+R   ++ +   +   ENPF +M++ I +  + NFFE RV EYQ+      D
Sbjct: 334 VADRLLLELDVGKYY-LAENPFEFMNK-ISIDGKTNFFEKRVGEYQKIGVSSDD 385


>gi|6525234|gb|AAF15363.1|AF205376_1 ribonucleotide reductase R2 subunit [Plasmodium falciparum]
          Length = 320

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 161/331 (48%), Gaps = 29/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +R+LN  SD   L P+ Y   W+ Y  A  + W   E+ +  DL  ++    L ++E+  
Sbjct: 2   RRILNKESDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFE---KLNENEKHF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+     R +   E +++   Q   E +HS T+  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVLENLASKFLREVQITEAKKFYSFQIAVENIHSETYSLLIDNYIKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF+    +P++  KA WA ++    +S                +  V     EG
Sbjct: 119 EKERLNLFHAIENIPAVKNKALWAAKWINDTNS--------------FAERIVANACVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           + F   F  I    + NK+ G+    + I RDE LH +F   + + +  + P       +
Sbjct: 165 ILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------E 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           Q  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R    +G   +F +++N
Sbjct: 218 QMVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKN 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 277 PFNWMD-LISLQGKTNFFEKRVADYQKSGVM 306


>gi|9633651|ref|NP_051729.1| ribonucleotide reductase, small subunit [Myxoma virus]
 gi|6523870|gb|AAF14903.1|AF170726_19 ribonucleotide reductase, small subunit [Myxoma virus]
 gi|301134541|gb|ADK63655.1| M015L [Myxoma virus]
          Length = 322

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 94/334 (28%), Positives = 158/334 (47%), Gaps = 28/334 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++D+ +L    D   + P++Y   W  Y  A  + W P EV +  DL  W+    LT DE
Sbjct: 1   MEDEPVLKESLDRYVVFPIQYNDIWNMYKKAVASFWTPEEVDISKDLKDWRV---LTPDE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I + 
Sbjct: 58  KYFIKHILAFFAASDGIVNENLAERFYVEVQIAEARCFYGFQIAMENIHSEMYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            +D  E   LF     +  I  KA W  ++             ++ D  + + L   +  
Sbjct: 118 IIDLQEKEKLFKAIETMDCIKQKAEWVQKWI------------RNKDATYAERLIA-FAS 164

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +  KM G+    + I RDE LH +F   +   +K         
Sbjct: 165 VEGIFFSGSFAAIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLMFKHLK-------HT 217

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++  +++ EA ++E  +  E +P   +G+N     QY++F+A+R   ++G   +F  
Sbjct: 218 PSEERVASIIKEAVVIEQRFLTEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSA 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           T NPF +M E I L+ + NFFE RV++YQ+   +
Sbjct: 278 T-NPFDFM-ENISLEGKTNFFEKRVSDYQRMGVV 309


>gi|281340156|gb|EFB15740.1| hypothetical protein PANDA_011632 [Ailuropoda melanoleuca]
          Length = 336

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 98/339 (28%), Positives = 159/339 (46%), Gaps = 28/339 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E     D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 9   ENEAKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 65

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 66  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 125

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +               +    +  
Sbjct: 126 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIE-------------DRKSTFGERV 172

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +     
Sbjct: 173 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVN--- 229

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
               K  +++ R ++  A  +E  +  E +P G +G+N    +QY++F+A+R   ++G  
Sbjct: 230 ----KPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS 285

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +F   ENPF +M E I L+ + NFFE RV EYQ+ A +
Sbjct: 286 KVF-QAENPFDFM-ENISLEGKTNFFEKRVAEYQRFAVM 322


>gi|219110949|ref|XP_002177226.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411761|gb|EEC51689.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 409

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 93/323 (28%), Positives = 151/323 (46%), Gaps = 28/323 (8%)

Query: 30  DVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFF 89
               L P+++   W  Y     + W   E+ +  DL  W  +  L D+ER  I   L FF
Sbjct: 92  SRFSLFPIEHDDLWGMYKQHVASFWTVDEIDLSADLTDWHER--LNDNERHFISMVLAFF 149

Query: 90  ASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE---GELF 146
           A ++ +V  N+     R ++ PE R +   Q   E +H  T+  +I S   D      LF
Sbjct: 150 AGADGIVVENLAERFCREVTVPEARAFYGFQMAMEGIHQETYCLLIDSYISDPKDREMLF 209

Query: 147 NMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFA 206
             + +VPS+  KA WA +Y  +             D  F + L  F  V EG++F   F 
Sbjct: 210 AAHTKVPSVEKKARWAQRYIGS-------------DASFAERLVAFAAV-EGIFFSGAFC 255

Query: 207 QILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH 266
            I  L +   M G+    + I RDE LH +F   + ++++ +         +     ++ 
Sbjct: 256 SIFWLKKRGLMPGLTFSNELISRDEGLHCSFACQLYSKLERKLS-------ETDMHKLIG 308

Query: 267 EATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEV 326
           EA  +E  +  + +P G +G+NA    QY++F+A+R  H +G   L+  ++NPF WM  +
Sbjct: 309 EAVEVEKGFVCDALPVGLIGMNASLMSQYVEFVADRLLHDLGYRTLYG-SKNPFDWMD-M 366

Query: 327 IDLKKEKNFFETRVTEYQQGAEL 349
           I L+ + NFFE RV EYQ+   +
Sbjct: 367 ISLEGKTNFFEKRVGEYQKSGVM 389


>gi|170664480|gb|ACB28637.1| small subunit ribonucleotide reductase [Myxoma virus]
 gi|170664652|gb|ACB28808.1| small subunit ribonucleotide reductase [recombinant virus
           6918VP60-T2]
          Length = 322

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 93/334 (27%), Positives = 158/334 (47%), Gaps = 28/334 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++D+ +L    D   + P++Y   W  Y  A  + W P EV +  DL  W+    LT DE
Sbjct: 1   MEDEPVLKESLDRYVVFPIQYNDIWNMYKKAVASFWTPEEVDISKDLKDWRV---LTPDE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I + 
Sbjct: 58  KYFIKHILAFFAASDGIVNENLAERFYVEVQIAEARCFYGFQIAMENIHSEMYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            ++  E   LF     +  I  KA W  ++             ++ D  + + L   +  
Sbjct: 118 IINLQEKEKLFKAIETMDCIKQKAEWVQKWI------------RNKDATYAERLIA-FAS 164

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +  KM G+    + I RDE LH +F   +   +K         
Sbjct: 165 VEGIFFSGSFAAIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLMFKHLK-------HT 217

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             +++  +++ EA ++E  +  E +P   +G+N     QY++F+A+R   ++G   +F  
Sbjct: 218 PSEERVASIIKEAVVIEQRFLTEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSA 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           T NPF +M E I L+ + NFFE RV++YQ+   +
Sbjct: 278 T-NPFDFM-ENISLEGKTNFFEKRVSDYQRMGVV 309


>gi|292397811|ref|YP_003517877.1| RR2b [Lymantria xylina MNPV]
 gi|291065528|gb|ADD73846.1| RR2b [Lymantria xylina MNPV]
          Length = 338

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 94/345 (27%), Positives = 153/345 (44%), Gaps = 30/345 (8%)

Query: 13  GEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKN 72
           GEK  +   + +L        + P++Y   W  Y  A  + W   EV +  D   W+   
Sbjct: 11  GEKPFDPQAEPLLRENPRRFVIFPIQYSDMWSMYKKAEASFWTVEEVDLSKDTRDWE--- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L D+ER  IK  L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  + 
Sbjct: 68  RLNDNERHFIKHVLAFFAASDGIVNENLVERFAQEVQVVEARCFYGFQIAMENVHSEMYS 127

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +      E   L N    +P +  KA WAL++  +             +  F + L
Sbjct: 128 TLIDTYVRSSEEKLRLLNAIETMPCVKEKAEWALRWIAS------------KEATFGERL 175

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
             F  V EG++F   FA I  L +   M G+    + I RDE LH +F   +   +    
Sbjct: 176 VAFAAV-EGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVQ-- 232

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
                +    + R ++ +A  +E  +  E +P   +GLN  +  QY++F+A+R    +  
Sbjct: 233 -----RPSAARVREIVTDAVAIEQRFLTEALPVRLLGLNCETMSQYIEFVADRLLVDLIG 287

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL--KWD 352
              +  T NP  +M+ +I L+ + NFFE +V EYQ+   +  K D
Sbjct: 288 TKHYN-TANPLDFMT-LISLEGKTNFFEKKVGEYQKFGVMFAKDD 330


>gi|322368525|ref|ZP_08043093.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
 gi|320551809|gb|EFW93455.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
          Length = 330

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 165/324 (50%), Positives = 225/324 (69%), Gaps = 2/324 (0%)

Query: 28  RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLG 87
             D N++LPL Y WA + Y +  NN+W+P E+PMQDD++ W   + L+D ER +I+ NLG
Sbjct: 9   EHDPNKILPLDYDWARDYYEAGVNNNWVPEEIPMQDDISQWN-GDALSDAERQLIEWNLG 67

Query: 88  FFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGELFN 147
           FF+++ESL ANNIVLA+Y +++ PECRQYLLRQA+EEA+H+ TF Y   SLG D   L+ 
Sbjct: 68  FFSTAESLTANNIVLALYEYVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGFDPDYLYG 127

Query: 148 MYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQ 207
           MY  VPSI  K  + +  T+ +  P FT  T    +EFL+DL  FYV+ EG++FY GFA 
Sbjct: 128 MYDRVPSIAEKDEFVVDLTRAIDRPDFTIETDADVREFLRDLVGFYVIMEGVFFYAGFAM 187

Query: 208 ILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267
           +L L R NKMVGI +Q++YI+RDESLH+ FG+D+IN+I+ ENP+ WT  F  +   ++  
Sbjct: 188 MLGLKRQNKMVGIGQQFEYILRDESLHVGFGVDLINEIRAENPNAWTDAFGDEVTDLITN 247

Query: 268 ATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 327
           A  LE  YA+E  P   +G++A    +Y++ IA+RR  Q+ L+  +  TENPFPWMSE +
Sbjct: 248 AVELEKIYAYEACPDEILGMSAAQFAEYVEHIADRRLAQLDLDEQYG-TENPFPWMSEQV 306

Query: 328 DLKKEKNFFETRVTEYQQGAELKW 351
           DL KEKNFFET+VTEYQ G  L W
Sbjct: 307 DLNKEKNFFETQVTEYQSGGSLDW 330


>gi|86132508|ref|ZP_01051102.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
 gi|85817069|gb|EAQ38253.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
          Length = 328

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 94/333 (28%), Positives = 157/333 (47%), Gaps = 28/333 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+++   WE Y  +  + W   E+ +  DL  WK    LTDDER  
Sbjct: 5   EPILAENKDRFVIFPIQHDDIWEWYKKSEASFWTAEEIDLHQDLVDWK--GKLTDDERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LFN     P+I  KA+WAL++  +                F + L  F  V EG
Sbjct: 123 EVEKDKLFNALENFPAIKKKADWALKWIDS--------------PSFAERLIAFAAV-EG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + N           K  +
Sbjct: 168 IFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHL------VNKVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++  A  +E  +  E++P   +G+N+    QY++++ +R   ++  E ++  T N
Sbjct: 222 ERITEIIVNALDIEREFITESLPVSLIGMNSNLMTQYLEYVTDRLLTELDCEKVYN-TAN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           PF +M  +I L+ + NFFE RV EYQ+   +K 
Sbjct: 281 PFDFMD-MISLQGKTNFFEKRVGEYQKAGVVKD 312


>gi|58260834|ref|XP_567827.1| ribonucleotide reductase small subunit [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|134117207|ref|XP_772830.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255448|gb|EAL18183.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229908|gb|AAW46310.1| ribonucleotide reductase small subunit, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 430

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 98/328 (29%), Positives = 153/328 (46%), Gaps = 28/328 (8%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L        L P+KY   W+ Y  A  + W   E+    DL  W   + +T+ ER  I 
Sbjct: 102 ILRESESRFVLFPIKYNEIWQAYKHAQASFWTAEELDFGHDLIDWH--DRMTEQERFFIL 159

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           R L FFA+S+ +V  NIV      +   E R +   Q+  E VHS T+  +I +   D  
Sbjct: 160 RILAFFAASDGIVGENIVSQFALEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDAQ 219

Query: 144 E---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           E   LF     +P I  KA+WAL+Y                D+   +   V +   EG++
Sbjct: 220 EKDFLFRGMTNIPCIKQKADWALKYI--------------TDELPFRTRLVAFACVEGIF 265

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           F   FA I  L +   M G+    + I RDE +H +F   + N +K        +    +
Sbjct: 266 FSGSFAAIFWLKKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLK-------HRCSTDE 318

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA ++E  +  + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF
Sbjct: 319 VHHIVSEALVIEKQFLTDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPF 377

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAE 348
            WM E+I L+ + NFFE+RV+ YQ+   
Sbjct: 378 DWM-ELISLQGKANFFESRVSAYQKANV 404


>gi|126662515|ref|ZP_01733514.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
 gi|126625894|gb|EAZ96583.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
          Length = 325

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 157/334 (47%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+K+   WE Y       W   E+ +  DL  W   N L DDE+  
Sbjct: 5   EPILQENKDRFVIFPIKHQDIWEWYKKQEACIWTAEEIDLHTDLNDWN--NKLNDDEKYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +  PE + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYPEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF+     P+I  KA WAL++ ++ S                 +  + +   EG
Sbjct: 123 EVEKNKLFHAIETFPAIKEKAQWALKWIESDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + +        +  K  +
Sbjct: 168 IFFSGSFCSIYWLKKRGLMPGLTFSNELISRDEGMHCDFAVHLHSHH------IVNKVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++G + ++  + N
Sbjct: 222 ERITEIIVDALNIERQFITESLPVSLIGMNATLMTQYLEFVTDRLLVELGCDRVYN-SSN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I L+ + NFFE RV EYQ+   +  D
Sbjct: 281 PFDFMD-MISLQGKTNFFEKRVAEYQKAGVMNSD 313


>gi|324509007|gb|ADY43795.1| Ribonucleoside-diphosphate reductase small chain [Ascaris suum]
          Length = 337

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 97/346 (28%), Positives = 153/346 (44%), Gaps = 28/346 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
             I          D+ +L        + P+KY   W  Y +A  + W   E+ +  D A 
Sbjct: 4   GDISMMSATAKNSDEPLLAENPSRFVIFPIKYHDIWAFYKNAVASFWTADEIDLSRDYAD 63

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           W+    LTD ER  I R L FFA+S+ +V  N+       +  PE R +   Q   E VH
Sbjct: 64  WE---KLTDGERFFISRVLSFFAASDGIVNENLTGRFSTEVQVPEARFFYGFQIMMEGVH 120

Query: 128 SHTFQYIITSLGLDEGEL---FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S  +  +I +   D  E    F+   +   I  KA+WAL++              D +  
Sbjct: 121 SEMYSKMIEAYIKDPKEQMVHFDAIHQFECIKKKADWALRWID------------DRNSP 168

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
           F   L  F  V EG+ F   FA I  L +   M G+    + I RDE LH +F   +   
Sbjct: 169 FPVRLIAFAAV-EGIMFSGSFAAIFWLKKRGVMKGLTHSNELISRDEGLHRDFACLLYK- 226

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
                 ++  K  Q++   ++ EA  LE  Y  E +P   +G+N     QY++++A+   
Sbjct: 227 ------YIKHKPSQEQVYEIIKEAVSLEQEYLTEALPVDLIGMNCRLMSQYIEYVADHLL 280

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++G   ++  + NPF +M E + ++ + NFFE RV+EYQ+   L 
Sbjct: 281 TELGYPKVYNAS-NPFDFM-ENLSIEAKTNFFERRVSEYQRAGVLS 324


>gi|86134368|ref|ZP_01052950.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
 gi|85821231|gb|EAQ42378.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
          Length = 323

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 93/332 (28%), Positives = 159/332 (47%), Gaps = 28/332 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
             + +L    +   + P+++   WE Y       W   E+ +  DL  W +   LTDDER
Sbjct: 3   KQEPILQPNDNRFVIFPIQHNDLWEWYKKQQACFWTAEEIDLHSDLVDWTT--KLTDDER 60

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +  
Sbjct: 61  YFIKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYV 120

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            DE E   LF      P+I  KA+WAL++ ++              + F + L  F  V 
Sbjct: 121 KDEVEKDRLFRAIEVFPAIKKKADWALKWIES--------------ESFAERLIAFAAV- 165

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   + G+    + I RDE +H +F + +       N H+  + 
Sbjct: 166 EGIFFSGAFCSIFWLKKRGLLPGLTFSNELISRDEGMHCDFAVHLH------NNHIVNRV 219

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            + + + ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   + G E ++  T
Sbjct: 220 PKDRIKEIIVDALDIEREFVTESLPVSLIGMNAKLMTQYLEFVTDRLLLEFGCEKVYDVT 279

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
            NPF +M E+I L+ + NFFE RV+EYQ+   
Sbjct: 280 -NPFDFM-EMISLEGKTNFFEKRVSEYQKAGV 309


>gi|145553335|ref|XP_001462342.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124430181|emb|CAK94969.1| unnamed protein product [Paramecium tetraurelia]
          Length = 355

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 90/336 (26%), Positives = 152/336 (45%), Gaps = 29/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N  D+ +L    +   L P+KY   W  Y     + W   E+ +  DL  W+    LT D
Sbjct: 33  NYCDEPLLKQNPNRFVLFPIKYNDIWNMYKQHKASFWTAEEIDLYQDLKDWE---KLTAD 89

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +
Sbjct: 90  EKHFIKYVLAFFAASDGIVNENLAQQFCTEVQVPEARCFYGFQIAMENIHSETYSLLIDT 149

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              DE E   L +    VP I  KA WA+++     S                +  + + 
Sbjct: 150 YITDENEKNYLLHAIDNVPVIQKKAMWAMKWINENDS--------------FAERLIAFA 195

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   F  I  + + + M G+    + I RDE LH +F   +   +  +  +   
Sbjct: 196 AVEGIFFSGSFCAIFWIKKRSLMPGLTFSNELISRDEGLHTDFACLLYKHLVNKMSNQRI 255

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
            E       ++  A  +E  +  E +P   +G+N+   +QY++F+A+R    +G   ++ 
Sbjct: 256 HE-------IISSAVEIEKEFISEALPVELIGMNSNLMKQYIEFVADRLIFALGAPKIYN 308

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++NPF WM  +I L+ + NFFE RV +YQ+   + 
Sbjct: 309 -SKNPFEWMD-MISLQGKTNFFERRVGDYQKAGVMS 342


>gi|261335316|emb|CBH18310.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei gambiense DAL972]
          Length = 337

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 90/333 (27%), Positives = 157/333 (47%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A ++ W    + + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKKAESSIWTVENIYLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAASDGIVLENLAERFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|289582310|ref|YP_003480776.1| ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
 gi|289531863|gb|ADD06214.1| Ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
          Length = 330

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 160/331 (48%), Positives = 230/331 (69%), Gaps = 4/331 (1%)

Query: 23  RMLN--ARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
            ++N  A  D N++LP+ Y WA E Y +  NN+W+P E+PMQDD++ W   + L+D ER 
Sbjct: 2   PIINTDAEHDPNKILPIDYDWAREYYEAGVNNNWVPEEIPMQDDVSQWN-GDALSDAERQ 60

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +++ NLGFF+++ESL ANNIVLA+Y H++ PECRQYLLRQA+EEA+H+ TF Y   SLG 
Sbjct: 61  LVEWNLGFFSTAESLTANNIVLAVYDHVTAPECRQYLLRQAYEEAIHTDTFIYCCDSLGF 120

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +   ++ MY  +PSI  K  + +  T+ ++   F   T +  ++F++DL  FYV+ EG++
Sbjct: 121 EPDYMYGMYDRIPSIAEKDEFVIDLTRVINQNGFVIETDEDLRDFIRDLVGFYVIMEGIF 180

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY GFA +L L R NKMVGI +Q++YIMRDESLH+ FG+D+I+QI++ENP +WT  F  +
Sbjct: 181 FYAGFAMMLGLKRQNKMVGIGQQFEYIMRDESLHVGFGVDLIDQIRMENPDVWTDAFGDE 240

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
              ++ EA  LE  YA+E  P   +G++A    +Y++ IA+RR  Q+ L   +  T+NPF
Sbjct: 241 VVELITEAVELEKIYAYEACPDEILGMSADQFAEYVEHIADRRLGQLDLPTQYG-TDNPF 299

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           PW+SE +DL KEKNFFET+VTEYQ G  L W
Sbjct: 300 PWLSEQVDLNKEKNFFETQVTEYQSGGSLDW 330


>gi|297209|emb|CAA48969.1| C8L [Variola virus]
 gi|745144|prf||2015436AF C8L gene
          Length = 333

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 151/337 (44%), Gaps = 29/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN+  + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT 
Sbjct: 11  VNLVMEPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTP 67

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I 
Sbjct: 68  DEKYFIKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLID 127

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA ++                D     +  + +
Sbjct: 128 TYVKDSNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAF 173

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 174 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 226

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               ++  R+++ +A  +E  +    +P   +G+N    + YM+F+A+R   ++G + ++
Sbjct: 227 YPPSEETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIY 286

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NP  +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 NVT-NPSDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 321


>gi|18640273|ref|NP_570429.1| CMLV039 [Camelpox virus]
 gi|18482949|gb|AAL73746.1|AF438165_36 ribonucleotide reductase small subunit [Camelpox virus M-96]
 gi|19717972|gb|AAG37497.1| CMP39L [Camelpox virus CMS]
          Length = 319

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 84/332 (25%), Positives = 147/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT +E+  
Sbjct: 2   EPILAKNQNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPNEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCTEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +   +++ +A  +E  +    +P   +G+N    + Y++F+A+R   ++G + ++    N
Sbjct: 218 ETVISIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVI-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PFDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|156102402|ref|XP_001616894.1| ribonucleoside-diphosphate reductase small chain [Plasmodium vivax
           SaI-1]
 gi|148805768|gb|EDL47167.1| ribonucleoside-diphosphate reductase small chain, putative
           [Plasmodium vivax]
          Length = 349

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 89/342 (26%), Positives = 165/342 (48%), Gaps = 29/342 (8%)

Query: 11  QAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKS 70
            +  ++    ++++L+  +D   L P+ Y   W+ Y  A  + W   E+ +  DL  ++ 
Sbjct: 20  FSDLQKSKEANEKILSKETDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFE- 78

Query: 71  KNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHT 130
              L D+E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +HS T
Sbjct: 79  --KLNDNEKHFIKHVLAFFAASDGIVLENLASKFLRQVKITEAKKFYAFQIAVENIHSET 136

Query: 131 FQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQ 187
           +  +I +   DE E   LF+    +P++  KA WA ++    +S                
Sbjct: 137 YSLLIDNYIKDEKERMNLFHAIENIPAVKNKALWAAKWINDTNS--------------FA 182

Query: 188 DLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKI 247
           +  V     EG+ F   F  I    + NK+ G+    + I RDE LH +F   + + ++ 
Sbjct: 183 ERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLEN 242

Query: 248 ENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI 307
           + P       ++  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R    +
Sbjct: 243 KLP-------EEVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECL 295

Query: 308 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           G   +F + +NPF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 296 GSPKIF-HAKNPFNWMD-LISLQGKTNFFEKRVADYQKSGVM 335


>gi|221120499|ref|XP_002159812.1| PREDICTED: similar to hCG23833 [Hydra magnipapillata]
          Length = 387

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 92/333 (27%), Positives = 154/333 (46%), Gaps = 27/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           D+ +L        L P++Y   W+ Y  A  + W   EV +  D   W+    L   E+ 
Sbjct: 59  DEPLLRENPRRFVLFPIQYKDIWKMYKQAEASFWTVEEVDLAADAVHWEE--KLKPQEKY 116

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+V    + +  PE R +   Q   E +HS  +  +I +L  
Sbjct: 117 FISHVLAFFAASDGIVNENLVECFSQEVQLPEARAFYGFQIAIENIHSEMYSLLIDTLIK 176

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P +  KA WAL++                D     +  V +   E
Sbjct: 177 DPIEKSNLFNAIETMPCVQKKAVWALKWIN-------------KDCASFSERVVAFAAVE 223

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L + N + G+    + I RDE LH +F   +   I         K  
Sbjct: 224 GIFFSGSFAAIFWLKKRNLLPGVTFSNELISRDEGLHCDFACLMYKHIVN-------KPS 276

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           +++ + ++ +A  +EI +  E++P   +G+N    + Y++F A+R  + +G    +   E
Sbjct: 277 EERVKQIIRDAVAIEIEFLTESLPCDLLGMNKSLMKTYIEFCADRLINALGYSKEWNV-E 335

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M E I L ++ NFFE+RV++YQ+   + 
Sbjct: 336 NPFDFM-ENISLARKANFFESRVSDYQKAGVMD 367


>gi|150024561|ref|YP_001295387.1| ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
 gi|149771102|emb|CAL42569.1| Ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
          Length = 325

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 93/334 (27%), Positives = 161/334 (48%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P+K+   WE Y S   + W   E+ +  DL  W   N L++DER  
Sbjct: 5   EPILQENKNRFVIFPIKHHDIWEFYKSMEASFWTAEEIDLSQDLNDWN--NKLSNDERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  VKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKD 122

Query: 142 E---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E    ELFN     P+I  KA+WALQ+ ++ S                 +  + +   EG
Sbjct: 123 EVEKDELFNALEVFPAIKKKADWALQWIESDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + N           K  +
Sbjct: 168 IFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHL------VNKVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ R+++ +A  +E  +  E++P   +G+NA    QY++F+A+R   ++G +  +  T N
Sbjct: 222 ERIRSIIVDALNIEREFITESLPVSLIGMNAVLMTQYLEFVADRLLVELGCDREYN-TAN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I L+ + NFFE +V EYQ+   +  D
Sbjct: 281 PFDFMD-MISLQGKTNFFEKKVAEYQKAGVMNTD 313


>gi|303278144|ref|XP_003058365.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459525|gb|EEH56820.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 338

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 95/332 (28%), Positives = 158/332 (47%), Gaps = 30/332 (9%)

Query: 22  KRMLNAR-SDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           + +L+A  S+   + P+KYG  WE Y  A  + W   EV + DD+  W+    L+DDE+ 
Sbjct: 14  EPILDAAGSERFTMFPIKYGDIWEMYKKAEASFWTAEEVDLSDDMKHWE---KLSDDEKH 70

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+ +     +  PE R +   Q   E +HS  +  +I +   
Sbjct: 71  FISHILAFFAASDGIVLENLGVRFMGEVQIPEARAFYGFQIAIENIHSEMYSLLIDAYIK 130

Query: 141 ---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
               +  LF     +P +  KA+WAL++ ++                F + L   +   E
Sbjct: 131 DAAQKKYLFEAMENIPCVAKKADWALKWIES-------------SATFAERLIA-FACIE 176

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   + + ++        K  
Sbjct: 177 GIFFSGSFCSIYWLKKRGMMPGLTFSNELISRDEGLHRDFACLLYSYLQN-------KPD 229

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
               R ++ EA  +E  +  + +P   VG+N     +Y++F+A+    Q+GLE  +  T 
Sbjct: 230 VSIVRQIVCEAVEIEKEFVCDALPVSLVGMNKDLMSEYIEFVADHLLGQLGLEKEYN-TV 288

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           NPF +M E+I L+ + NFFE RV EYQ+   +
Sbjct: 289 NPFEFM-ELISLQGKTNFFEKRVGEYQKSGVM 319


>gi|254449372|ref|ZP_05062814.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
 gi|198261018|gb|EDY85321.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
          Length = 404

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 136/349 (38%), Positives = 191/349 (54%), Gaps = 5/349 (1%)

Query: 3   NNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQ 62
             T  + +  G   V  +DK+++N  +D+NQL P KY WAWE +L+A  NHW P ++ M 
Sbjct: 61  EQTNAAQMSGGVNPVKAEDKKVVNGMADINQLAPFKYPWAWEYFLNANKNHWTPLDINMA 120

Query: 63  DDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAF 122
            D+  +     LT +ER +    L +  +S+ +   NI LA+   +S PE + Y  RQ +
Sbjct: 121 QDVHDFHH--KLTLEERHVYTNVLSYLTTSDIMAMRNIGLAVMEKMSAPELQIYQARQVY 178

Query: 123 EEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDAD 182
           EE++H+ T+Q+ I +LGLD+GE++N YR VP I AK   A +   ++  P      +D  
Sbjct: 179 EESLHTWTYQHCIETLGLDQGEVYNRYRVVPEINAKIQIANRRLNSVMRPDIDLNDRDEL 238

Query: 183 QEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVI 242
             FL     F  +FEG WFY GF+ I +L R   M G AEQ QYIMRDE +H +FG+ V 
Sbjct: 239 HNFLMSYIFFAGIFEGCWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDEVMHASFGLRVA 298

Query: 243 NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANR 302
            QI  E          +  R M  E    E  YA   +    +G +A       +FIANR
Sbjct: 299 RQIMREENIQPDP---KAMREMWDECEAAEEGYARYLLRDPILGYSAEDHVNQFRFIANR 355

Query: 303 RCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           R +++ LE  F   EN  PW+ E  +++KEKNFFETRVTEYQ G  L W
Sbjct: 356 RANKLSLEEPFPGAENALPWLDEQANMRKEKNFFETRVTEYQVGGGLTW 404


>gi|301097698|ref|XP_002897943.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
 gi|262106388|gb|EEY64440.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
          Length = 360

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 81/352 (23%), Positives = 152/352 (43%), Gaps = 41/352 (11%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + +   +S  +  E    +  +  L A  +   L P++    W+ Y  A  + W   E+ 
Sbjct: 33  LKDELEMSEYKRKELSGELQPEPYLVANPNRFVLFPIQEHDVWQMYKKAEASFWTAEELD 92

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           +  DL  W     LTD+ER  IK  L FFA+S+ +V  N+ +     +  PE R +   Q
Sbjct: 93  LVHDLNDW---AKLTDNERHFIKHVLAFFAASDGIVNENLAMNFSNEVQIPEARCFYGFQ 149

Query: 121 AFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTG 177
              E +HS  +  +I +   D  E   L      +P +  K                   
Sbjct: 150 IAIENIHSEVYSLLIDTYIKDAVEKDHLLRAIETIPCVQKKH------------------ 191

Query: 178 TKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNF 237
                     +  + +   EG++F   F  +  L +   M G++   + I RDE +H +F
Sbjct: 192 --------SNERLLAFAAVEGIFFSGSFCSVFWLKKRGLMPGLSFSNEMISRDEGMHTDF 243

Query: 238 GIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQ 297
              + +++  + P       + +   ++ +A  +E  +  +++P   +G+N+    QY++
Sbjct: 244 ACLMYSKLVNKLP-------ESRVHEIIRDAVAIEHEFVCDSLPVELIGMNSALMCQYIE 296

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           F+A+R  + +G+  ++   +NPF WM  +I L+ + NFFE RV EY +    
Sbjct: 297 FVADRLLYSLGVSKIYNV-KNPFDWMD-MISLQGKTNFFEKRVGEYSKAGVG 346


>gi|254442775|ref|ZP_05056251.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
 gi|198257083|gb|EDY81391.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
          Length = 361

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 123/330 (37%), Positives = 195/330 (59%), Gaps = 2/330 (0%)

Query: 22  KRMLNARSDV-NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           K+++N R  +   LLPLKY WA+E Y +   NHW P ++ M  D+  WK    +++ ER 
Sbjct: 26  KKIINGRETMTFNLLPLKYNWAYEIYKTMKANHWEPEDIGMNKDIEQWKDTEQVSEIERW 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I   +G+F+++E +V +NI+  I   ++ PE +  L R A EE VH+ +  Y+I+SLG+
Sbjct: 86  IIMMGIGYFSAAEGIVGDNILHVIRELVTAPELKLVLGRHAHEENVHADSLLYMISSLGI 145

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +  E   M+ ++P+I  K  +  + +  L +    T T +  Q+F +++F+F    EG  
Sbjct: 146 NPHECEAMFEDIPTIVKKNEFVTRQSHALRNDVDLTIT-ENKQKFAKNVFLFGQCMEGTQ 204

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY  F  ILSL R NK  GI E ++Y +RDES H+    ++   +  ENP +WT EF+ +
Sbjct: 205 FYGMFGMILSLYRQNKFRGIGEMFRYTLRDESNHIELLRNLFMDLIEENPDVWTPEFKAE 264

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 320
            R  + EA  LE  +  + +P   +GL      QY+ +IA+RR    GL+PL     NP 
Sbjct: 265 LRDAMSEAIALEKEFIADCLPVDSIGLRKEDFVQYIDYIADRRLEGCGLDPLTPGVTNPL 324

Query: 321 PWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PW++E++D+KKE+NFFE RVTEYQ+ + L+
Sbjct: 325 PWLAEMMDIKKEQNFFEGRVTEYQKASSLE 354


>gi|39977011|ref|XP_369893.1| hypothetical protein MGG_06408 [Magnaporthe oryzae 70-15]
 gi|145016179|gb|EDK00669.1| hypothetical protein MGG_06408 [Magnaporthe oryzae 70-15]
          Length = 403

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 155/353 (43%), Gaps = 40/353 (11%)

Query: 4   NTGLSPIQAGEKRVNVD----DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEV 59
              + P++       +     D+ +L                 W+ Y  A  + W   E+
Sbjct: 52  AKDVKPVEKPAVAPTIKAFEMDEPILQENPQRFV---------WQMYKKAEASFWTAEEI 102

Query: 60  PMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLR 119
            +  DL  W   N LTDDE+  I   L FFA+S+ +V  N+V      +  PE R +   
Sbjct: 103 DLSKDLHDWN--NKLTDDEKYFISHILAFFAASDGIVNENLVERFSAEVQIPEARCFYGF 160

Query: 120 QAFEEAVHSHTFQYIITSLGL---DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTT 176
           Q   E +HS T+  +I +          LFN    +P I  KA+WAL++           
Sbjct: 161 QIMMENIHSETYSLLIDTYIKETAQRTYLFNAIDTIPCIRKKADWALRWI---------- 210

Query: 177 GTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLN 236
              D    F   L  F VV EG++F   FA I  L +   M G+    + I RDE LH +
Sbjct: 211 --TDKKSTFATRLIAFAVV-EGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTD 267

Query: 237 FGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           F   + + +         +  ++  + ++ +A  +E  +  E +P   +G+NA   +QY+
Sbjct: 268 FACLLFSLLNN-------RPNKEVVKEIVVDAVKIEQEFLTEALPCALLGMNANLMKQYI 320

Query: 297 QFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +F+A+R    +G E ++    NPF +M E I L  + NFFE RV EYQ+   +
Sbjct: 321 EFVADRLLVALGNEKVY-RATNPFDFM-ENISLGGKTNFFEKRVGEYQKAGVM 371


>gi|544843|gb|AAB29634.1| C8L product [variola virus VAR, India-1967, Peptide, 333 aa]
          Length = 333

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 152/337 (45%), Gaps = 29/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           VN+  + +L    +   + P++Y   W  Y  A  + W+  EV +  D+  W   N LT 
Sbjct: 11  VNLVMEPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWIVEEVDISKDINDW---NKLTP 67

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I 
Sbjct: 68  DEKYFIKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLID 127

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   LFN    +P +  KA+WA ++                D     +  + +
Sbjct: 128 TYVKDSNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAF 173

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   FA I  L +   M G+    + I RDE LH +F   +   +        
Sbjct: 174 AAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL------- 226

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
               ++  R+++ +A  +E  +    +P   +G+N    + YM+F+A+R   ++G + ++
Sbjct: 227 YPPSEETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIY 286

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NP  +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 287 NVT-NPSDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 321


>gi|290977320|ref|XP_002671386.1| predicted protein [Naegleria gruberi]
 gi|284084954|gb|EFC38642.1| predicted protein [Naegleria gruberi]
          Length = 338

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 92/334 (27%), Positives = 159/334 (47%), Gaps = 28/334 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +L        L PL+Y   WE Y  A  + W   EV +  D+  W +   LT +E+
Sbjct: 17  KEEALLKENPHRFVLFPLEYPKIWEMYKKAMASFWTAEEVDLHTDITQWTT---LTPNEQ 73

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             IK  L FFA+S+ +V  N+       +  PE R +   Q   E +H+  +  +I +L 
Sbjct: 74  HFIKSVLAFFAASDGIVNENLCQQFMAEVQIPEARCFYGFQIAIENIHAEMYSTLIETLI 133

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D+ E   LFN    VPS+  KA WA+++                 +    +  + +   
Sbjct: 134 KDQRERHRLFNAIDTVPSVQKKARWAMKWINN--------------ENLFAERLLAFACV 179

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   F  I  L +   M G+A   + I RDE LH +F   + + +K      +TK 
Sbjct: 180 EGIFFSGSFCSIFWLKKRGLMPGLAFSNELISRDEGLHTDFACLLYSTLK------FTKL 233

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
            QQ   +++ EA  +E  +  E++P   +G+N+   +QY++ +A+R    +G + ++  +
Sbjct: 234 PQQVVHSLVSEAVEIEKEFICESLPVDLIGMNSRLMQQYIEMVADRLLVSLGYDKIYN-S 292

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            NPF WM+ +I +  + NFFE +V EY +   + 
Sbjct: 293 PNPFDWMN-IISVSGKTNFFEKKVGEYAKANIMS 325


>gi|213402763|ref|XP_002172154.1| ribonucleoside-diphosphate reductase small chain
           [Schizosaccharomyces japonicus yFS275]
 gi|212000201|gb|EEB05861.1| ribonucleoside-diphosphate reductase small chain
           [Schizosaccharomyces japonicus yFS275]
          Length = 392

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 89/338 (26%), Positives = 151/338 (44%), Gaps = 27/338 (7%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K+ +  D+ +L        + P++Y   W+ Y  A  + W   E+ +  DL  W   N L
Sbjct: 61  KKEDEKDEVVLTPNPRRFVMFPIEYHDIWQFYKKAEASFWTAEEIDLSKDLHDWD--NKL 118

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             DER  I   L +FA+S+ +V  N++      +   E R     Q   E +HS T+  +
Sbjct: 119 NKDERYFISTVLAYFAASDGIVNENLLSRFSSEVQIAEARCVYGFQIMIENIHSETYSLL 178

Query: 135 ITSLGLDEGEL---FNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           + +   D  E    F+    + SI AKA WAL++ +               +       V
Sbjct: 179 LDTYIRDPYEKQRHFDAILTMGSIKAKAKWALRWIE-------------DPESIYAVRLV 225

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   FA I  L +   M G+    + I RDE +H +F   + + +K     
Sbjct: 226 AFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGVHTDFACLMFSHLK----- 280

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
              +  ++    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R    +G E 
Sbjct: 281 --HRPGKKVVERIIIEAVNIEKEYFTDALPVYLLGMNCDLMCQYIEFVADRLLLSLGNEK 338

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            +  T NPF +M E I L  + NFFE +V++YQ    +
Sbjct: 339 YYNVT-NPFDFM-ENISLAGKTNFFEKKVSDYQIAGVM 374


>gi|145352915|ref|XP_001420779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581014|gb|ABO99072.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 346

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 153/331 (46%), Gaps = 29/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   L P+K+   WE Y  A  + W   EV +  D   W +   L D+E+  
Sbjct: 27  EPLLRDNPDRFCLFPIKHAKVWEMYKKAEASFWTAEEVDLTYDYRDWIT---LNDNEQHF 83

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS  +  ++ +   D
Sbjct: 84  ISHVLAFFAASDGIVLENLCSRFMTDVQLPEARSFYGFQLAIENIHSEMYSLLLDTYIKD 143

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             +   LF     VP++  KA+WAL++  +             D  F + L   +   EG
Sbjct: 144 PKKKSDLFRAIHTVPTVAKKADWALKWIGS-------------DASFAERLVG-FACVEG 189

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   + + +  ENP       +
Sbjct: 190 IFFSGSFCAIFWLKKRGLMRGLTFSNELISRDEGLHCDFACLLYSML--ENPL-----SE 242

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +    ++ +A  +E  +  + +    VG+NA     Y++F+A+R   Q+G+  L+    N
Sbjct: 243 KVLHQLVGDAVTIEKEFVCDALSCSLVGMNANMMSTYIEFVADRLLLQLGVSKLYNAV-N 301

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM E+I L+ + NFFE RV +YQ+   +
Sbjct: 302 PFDWM-ELISLQGKANFFEHRVDQYQKAGVM 331


>gi|221060582|ref|XP_002260936.1| ribonucleotide reductase small subunit [Plasmodium knowlesi strain
           H]
 gi|193811010|emb|CAQ42908.1| ribonucleotide reductase small subunit,putative [Plasmodium
           knowlesi strain H]
          Length = 349

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 88/345 (25%), Positives = 165/345 (47%), Gaps = 29/345 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
               +  ++    ++++L+  +D   L P+ Y   W+ Y  A  + W   E+ +  DL  
Sbjct: 17  EKAFSDLQKSKEANEKILSKETDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDLKD 76

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           ++    L ++E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +H
Sbjct: 77  FE---KLNENEKHFIKHVLAFFAASDGIVLENLASKFLRQVQITEAKKFYSFQIAVENIH 133

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S T+  +I +   DE E   LF+    +P++  KA WA ++    +S             
Sbjct: 134 SETYSLLIDNYIKDEKERMNLFHAIENIPAVKNKALWAAKWINDTNS------------- 180

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V     EG+ F   F  I    + NK+ G+    + I RDE LH +F   + + 
Sbjct: 181 -FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSL 239

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           ++ + P       ++  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R  
Sbjct: 240 LENKLP-------EEVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLL 292

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             +G   +F + +NPF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 293 ECLGSRKIF-HAKNPFNWMD-LISLQGKTNFFEKRVADYQKSGVM 335


>gi|332876813|ref|ZP_08444570.1| ribonucleoside-diphosphate reductase, beta subunit [Capnocytophaga
           sp. oral taxon 329 str. F0087]
 gi|332685239|gb|EGJ58079.1| ribonucleoside-diphosphate reductase, beta subunit [Capnocytophaga
           sp. oral taxon 329 str. F0087]
          Length = 324

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 94/330 (28%), Positives = 153/330 (46%), Gaps = 28/330 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+++   W+ Y +A  + W   EV +  DL  W+  N L D+ER  
Sbjct: 4   EPLLQDNKDRFVIFPIQHNDIWQFYKNAEASFWTAEEVDLSPDLHDWQ--NKLNDNERFF 61

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I R L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  +I +   D
Sbjct: 62  ISRVLAFFAASDGIVNENLAINFLQEVQYPEARCFYGFQIMIENIHSEMYSLLIDTYVKD 121

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   L      +P +T KA WAL++                   F + L  F  V EG
Sbjct: 122 PAEKDYLLRAIETIPCVTKKAKWALRWI--------------TKGSFAERLIAFAAV-EG 166

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   +             K  +
Sbjct: 167 IFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYVNHLQ------NKLSE 220

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R ++ +A  +E  +  + +P   +G+NA    QY++F+A+R    +G   ++  T N
Sbjct: 221 ETIREIIVDAVAIEKEFVTDALPVKLIGMNAELMCQYIEFVADRLLVALGCNKVWNAT-N 279

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           PF +M E+I L+ + NFFE RV EYQ+   
Sbjct: 280 PFDFM-ELISLQGKTNFFERRVGEYQKTGV 308


>gi|241951880|ref|XP_002418662.1| ribonucleoside diphosphate reductase, putative [Candida
           dubliniensis CD36]
 gi|223642001|emb|CAX43965.1| ribonucleoside diphosphate reductase, putative [Candida
           dubliniensis CD36]
          Length = 394

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 90/338 (26%), Positives = 156/338 (46%), Gaps = 27/338 (7%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +    ++ +L      + + P+KY   W+ Y  +  + W   E+ +  DLA W   N + 
Sbjct: 65  KQEESNEPLLTKDKTRHTIYPIKYPELWQFYKKSLASFWTAEELDLSKDLADWN--NKMN 122

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           ++ER  I R L FFA+S+ +V  N+V      +  PE +     Q   E +HS T+  +I
Sbjct: 123 ENERFFISRVLAFFAASDGIVNENLVENFCAEVQIPEAQSVYKFQIMMENIHSETYSLLI 182

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA+WA+++ Q              +     +  V 
Sbjct: 183 ETYFKDPEEADFLFNAIENIPFIREKADWAIRWIQ-------------DEDALYAERLVA 229

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE +H ++   + + +K +    
Sbjct: 230 FAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELICRDEGIHTDYACLLFSYLKNKPSP- 288

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                 +    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R     G +  
Sbjct: 289 ------EIIEKIITEAVTIEKKYFSDALPVSLLGMNCDLMCQYVEFVADRLLVAFGNKKY 342

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  T NPF +M E I L  + NFFE RV++YQ+   ++
Sbjct: 343 YNVT-NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVME 378


>gi|322817571|gb|EFZ25271.1| ribonucleoside-diphosphate reductase small chain, putative
           [Trypanosoma cruzi]
          Length = 337

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 89/336 (26%), Positives = 159/336 (47%), Gaps = 28/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
              ++ +L    D   + P+KY   W+KY  A ++ W   E+ +  DLA W+    + + 
Sbjct: 13  QEQEEPLLRENPDRYVIFPIKYHDIWKKYKEAESSIWTVEEIDLSSDLADWE---KMNEG 69

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E VHS T+  ++ +
Sbjct: 70  EKFFIKHVLAFFAASDGIVLENLAQRFMTEVQVPEVRCFYGFQIAIENVHSETYSVLLDT 129

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   + +    +P I  KANWA+++ ++ SS                +  V + 
Sbjct: 130 YITDTEEKDRMLHAISTIPCIQKKANWAIRWIRSSSS--------------FAERLVAFA 175

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   F  +  L +   M G+    + I RDE LH +F   +         ++  
Sbjct: 176 AVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------ENYIVN 229

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K   ++ R ++  A  +E  +  +++P   +G+NA     Y++F+A+R    +G E  + 
Sbjct: 230 KLPTERIREIICSAVDIEREFICDSIPVRLLGMNADLMSTYIEFVADRLLVALGNERHYN 289

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++NPF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 290 -SKNPFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|68485781|ref|XP_713171.1| hypothetical protein CaO19.9424 [Candida albicans SC5314]
 gi|68485874|ref|XP_713125.1| hypothetical protein CaO19.1868 [Candida albicans SC5314]
 gi|46434604|gb|EAK94008.1| hypothetical protein CaO19.1868 [Candida albicans SC5314]
 gi|46434651|gb|EAK94054.1| hypothetical protein CaO19.9424 [Candida albicans SC5314]
 gi|238883648|gb|EEQ47286.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           albicans WO-1]
          Length = 394

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 89/338 (26%), Positives = 156/338 (46%), Gaps = 27/338 (7%)

Query: 16  RVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLT 75
           +    ++ +L      + + P+KY   W+ Y  +  + W   E+ +  DL  W   N + 
Sbjct: 65  KQEESNEPLLTPDKTRHTIYPIKYPELWQFYKKSLASFWTAEELDLSKDLDDWN--NKMN 122

Query: 76  DDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYII 135
           ++ER  I R L FFA+S+ +V  N+V      +  PE +     Q   E +HS T+  +I
Sbjct: 123 ENERFFISRVLAFFAASDGIVNENLVENFCAEVQIPEAKSVYKFQIMMENIHSETYSLLI 182

Query: 136 TSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVF 192
            +   D  E   LFN    +P I  KA+WA+++ Q+             +     +  V 
Sbjct: 183 ETYFKDPEEADFLFNAIDNIPFIRKKADWAIRWIQS-------------EDALYAERLVA 229

Query: 193 YVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHL 252
           +   EG++F   FA I  L +   M G+    + I RDE +H ++   + + +K +    
Sbjct: 230 FAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELICRDEGIHTDYACLLFSYLKNKPSS- 288

Query: 253 WTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPL 312
                 +    ++ EA  +E  Y  + +P   +G+N     QY++F+A+R     G +  
Sbjct: 289 ------EIIEKIITEAVDIEKEYFSDALPVSLLGMNCDLMCQYVEFVADRLLVAFGNKKY 342

Query: 313 FKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           +  T NPF +M E I L  + NFFE RV++YQ+   ++
Sbjct: 343 YNVT-NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVME 378


>gi|325953830|ref|YP_004237490.1| ribonucleoside-diphosphate reductase [Weeksella virosa DSM 16922]
 gi|323436448|gb|ADX66912.1| Ribonucleoside-diphosphate reductase [Weeksella virosa DSM 16922]
          Length = 323

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 90/331 (27%), Positives = 154/331 (46%), Gaps = 28/331 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    +   + P+++   W+ Y  A  + W   EV +  D+  W+  N L  DER 
Sbjct: 2   NEPILQNNKNRFVIFPIQHDDIWQFYKKAEASFWTAEEVDLSSDMNDWQ--NKLNKDERY 59

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I   L FFA+S+ +V  N+ +   + +  PE R +   Q   E +HS  +  +I +   
Sbjct: 60  FISHVLAFFAASDGIVNENLAVNFVQEVQYPEARFFYGFQIMIENIHSEMYSLLIDTYIK 119

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L      +P +  KA+WAL++ ++                F + L  F  V E
Sbjct: 120 DPKEKDHLLRAIETIPCVGKKADWALEWIES--------------DNFAERLIAFAAV-E 164

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +             K  
Sbjct: 165 GIFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYVNHLK------NKLP 218

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           ++  + ++ +A  +E  +  E +P   +G+NA    QY++F+A+R    +G + ++  T 
Sbjct: 219 EETVQKIIADAVEVEKEFVTEALPVRLIGMNAELMCQYIEFVADRLLDALGCKKVWNAT- 277

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           NPF +M E+I L+ + NFFE RV EYQ+   
Sbjct: 278 NPFDFM-ELISLQGKTNFFERRVGEYQKSGV 307


>gi|66822029|ref|XP_644369.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|66823381|ref|XP_645045.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|41019487|sp|P42521|RIR2_DICDI RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|29611978|gb|AAB72227.2| ribonucleotide reductase small subunit [Dictyostelium discoideum]
 gi|60472492|gb|EAL70444.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|60472997|gb|EAL70945.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
          Length = 338

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 94/337 (27%), Positives = 156/337 (46%), Gaps = 28/337 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
            + +   + +L    D   L P+KY   W  Y  A  +HW+  E+ + +D   W+    L
Sbjct: 5   NKKDTFIEPILKENKDRFVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWE--YKL 62

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           TD+ER  I   L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +
Sbjct: 63  TDNERHFISHVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYSLL 122

Query: 135 ITSLGLDEG---ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   D+    +LFN    +P I  KA WAL++     S                +  V
Sbjct: 123 IETYIKDKQTKDKLFNAIETIPCIKKKAEWALRWINDSDS--------------FAERLV 168

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
            +   EG++F   F  I  L +   M G+    + I RDE LH +F   +  +++ +   
Sbjct: 169 AFAAVEGIFFSGSFCSIFWLKKRGLMQGLTFSNELISRDEGLHCDFACLLYTKLQRKLDP 228

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
                  +    M+ +A   E  +  E++P   +G+N+ S  QY++F A+R    +G + 
Sbjct: 229 -------KVIEKMIRDAVECEKEFICESLPVDLIGMNSRSMSQYIEFCADRLVVSLGYKK 281

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           +F  + NPF WM E+I L+++ NFFE +V EY +   
Sbjct: 282 IFN-SSNPFEWM-EMISLQRKSNFFEGKVAEYAKTGV 316


>gi|306478720|ref|NP_042072.2| Ribonucleoside-diphosphate reductase small chain [Variola virus]
 gi|464615|sp|P33799|RIR2_VAR67 RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
          Length = 319

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 148/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   + P++Y   W  Y  A  + W   EV +  D+  W   N LT DE+  
Sbjct: 2   EPILAKNPNRFVIFPIQYHDIWNMYKKAEASFWTVEEVDISKDINDW---NKLTPDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVNENLAERFCIEVQITEARCFYGFQMAIENIHSEMYSLLIDTYVKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WA ++                D     +  + +   EG
Sbjct: 119 SNEKNYLFNAIETMPCVKKKADWAQKWIH--------------DSAGYGERLIAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------YPPSE 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +  R+++ +A  +E  +    +P   +G+N    + YM+F+A+R   ++G + ++  T N
Sbjct: 218 ETVRSIITDAVSIEQEFLTVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIYNVT-N 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           P  +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 277 PSDFM-ENISLEGKTNFFEKRVGEYQKMGVMS 307


>gi|163753569|ref|ZP_02160692.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
 gi|161325783|gb|EDP97109.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
          Length = 326

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 98/332 (29%), Positives = 160/332 (48%), Gaps = 28/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+K+   WE Y  +  + W   E+ +  DL  W +   L DDER  
Sbjct: 6   EPILQENKDRFVIFPIKHADIWEWYKKSEASFWTAEEIDLHQDLTDWTT--KLNDDERYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WALQ+ ++                F + L  F  V EG
Sbjct: 124 EAEKDKLFKAIENFPAIKKKADWALQWIES--------------PSFAERLIAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + +       N HL  K  +
Sbjct: 169 IFFSGAFCSIYWLKKRGIMPGLTFSNELISRDEGVHCDFAVHLH------NNHLVNKVPK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ R ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++G E  +  + N
Sbjct: 223 ERIRAIIVDALNIEREFITESLPVSLIGMNAKLMTQYLEFVTDRLLQELGCEKEYNVS-N 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M  +I L+ + NFFE RV+EYQ+   L 
Sbjct: 282 PFDFMD-MISLQGKTNFFEKRVSEYQKAGVLN 312


>gi|162147608|ref|YP_001602069.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542240|ref|YP_002274469.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786185|emb|CAP55767.1| putative ribonucleotide reductase small subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529917|gb|ACI49854.1| Ribonucleoside-diphosphate reductase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 353

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 86/354 (24%), Positives = 161/354 (45%), Gaps = 20/354 (5%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           + N TG +P  A +         +L +        P +Y WA++ +L+    HW+P EVP
Sbjct: 4   ITNATGTAPESAPQPTGVEARLDLLTSNP---IYKPFRYPWAYDAWLTQQRVHWLPEEVP 60

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           + DD+  W     LT+ E+ ++ +   FF  S+  V N  +    R     E    L   
Sbjct: 61  LADDVKDWH--RTLTESEQHLVTQIFRFFTQSDVEVNNCYMKHYSRVFKPTEVLMMLSAF 118

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           +  E +H   + +++ ++G+ E E ++ + +   +  K ++   +            + D
Sbjct: 119 SNIETIHIAAYSHLLDTIGMPEME-YSAFLKYKEMKDKYDYMQGF------------SVD 165

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
           +  E  + L  F    EG+  +  FA +L+  R NK+ G+ +   + +RDE+LH      
Sbjct: 166 SKPEIARTLAAFGAFTEGLQLFASFAILLNFPRFNKLKGMGQIVSWSVRDETLHCLSMAR 225

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFI 299
           +      ENP +WT   +     +  +    E A+       G   GL+    + Y++FI
Sbjct: 226 LFRVFIQENPEIWTDALRADIVQICRDIVEHEDAFIDLCFEMGPVEGLDGDLVKTYIRFI 285

Query: 300 ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           A+RR + +GL+ ++    NP PW+ ++++  +  NFFE R TEY + +    W+
Sbjct: 286 ADRRLNLLGLDGIYDVPSNPLPWVDDMLNAVEHTNFFENRSTEYSRASTTGSWE 339


>gi|254492407|ref|ZP_05105579.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxidans DMS010]
 gi|224462299|gb|EEF78576.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxydans DMS010]
          Length = 383

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 133/341 (39%), Positives = 187/341 (54%), Gaps = 5/341 (1%)

Query: 12  AGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSK 71
              K +N DDKR++N  +D+NQL P KY WAW  +L+A  NHW P ++ M  D+  ++  
Sbjct: 48  NNAKAINADDKRVINGEADINQLAPFKYPWAWNYFLNANKNHWTPLDINMAQDVHDYRH- 106

Query: 72  NGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTF 131
             LT +ER + +  L +  +S+ L   NI LA+   ++ PE + Y  RQ +EEA+H+ T+
Sbjct: 107 -KLTLEERHVYENVLSYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEEALHTWTY 165

Query: 132 QYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           Q+ I ++GLD+ E++N YR VP I  K   A     T+         +D  + F+     
Sbjct: 166 QHCIETIGLDQSEIYNRYRVVPEIHQKIKLANDRLDTVMRSDIDLRDRDELENFVMSYAF 225

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
           F  +FEG WFY GF+ I +L R   M G AEQ QYIMRDE +H +FGI V  QI  E   
Sbjct: 226 FAGIFEGSWFYNGFSPIFALQRRGLMKGTAEQLQYIMRDEVMHASFGIRVCKQIMKEENI 285

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
                  +K + M  EA   E  YA   +    +G +        ++ ANRR  Q+G E 
Sbjct: 286 TLDP---KKVQQMFEEADAAEETYAGYILRDPILGYSKEVHHGQFRYTANRRAKQLGFEE 342

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            F   E   PW+ E  +++KEKNFFET+VTEYQ G  LKWD
Sbjct: 343 PFPGAEATLPWLDEQANMRKEKNFFETKVTEYQTGGGLKWD 383


>gi|329113329|ref|ZP_08242110.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
 gi|326697154|gb|EGE48814.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
          Length = 339

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 95/348 (27%), Positives = 163/348 (46%), Gaps = 20/348 (5%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S   +G++        +L A        P +Y WA++ +L+    HW+P EVP+ DD+ 
Sbjct: 1   MSEHMSGQEPQQEQKFDLLTANP---VYKPFRYPWAYDAWLTQQRLHWLPEEVPLADDVK 57

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W     L + E+ ++ +   FF  S+  V N  +    R     E    L   +  E +
Sbjct: 58  DWH--RVLNEGEQHLVTQIFRFFTQSDVEVNNCYMKHYSRVFKPTEVLMMLSAFSNIETI 115

Query: 127 HSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           H   + Y++ +LG+ E E ++ + +   +  K ++              T T D+  E  
Sbjct: 116 HIAAYSYLLDTLGMPETE-YSAFLKYKEMKDKYDYMQ------------TFTVDSKHEIA 162

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F    EG+  +  FA +L+  R NK+ G+ +   + +RDE+LH    I +     
Sbjct: 163 KTLAAFGAFTEGLQLFASFAILLNFPRFNKLKGMGQIVSWSVRDETLHCLSIIRLFRVFI 222

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCH 305
            ENP LWT++ + +   +       E A+       G   GLNA   + Y+ FIA+RR  
Sbjct: 223 QENPELWTEQLRTELTDICRTIVEHEEAFIDLAFEMGAVEGLNAEQVKTYIHFIADRRLT 282

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           Q+GLEP++  T NP PW+ ++++  +  NFFE R TEY + +    W+
Sbjct: 283 QLGLEPIYNTTTNPLPWLDDMLNAVEHTNFFENRSTEYSRASTAGTWE 330


>gi|71648907|ref|XP_813233.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma cruzi
           strain CL Brener]
 gi|70878098|gb|EAN91382.1| ribonucleoside-diphosphate reductase small chain, putative
           [Trypanosoma cruzi]
          Length = 337

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 88/337 (26%), Positives = 160/337 (47%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +   ++ +L    D   + P+KY   W+KY  + ++ W   E+ +  DLA W+    + +
Sbjct: 12  LQEQEEPLLRENPDRYVIFPIKYHDIWKKYKESESSIWTVEEIDLSSDLADWE---KMNE 68

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
            E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E VHS T+  ++ 
Sbjct: 69  GEKFFIKHVLAFFAASDGIVLENLAQRFMTEVQVPEVRCFYGFQIAIENVHSETYSVLLD 128

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D  E   + +    +P I  KANWA+++ ++ SS                +  V +
Sbjct: 129 TYITDTEEKDRMLHAISTIPCIQKKANWAIRWIRSSSS--------------FAERLVAF 174

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
              EG++F   F  +  L +   M G+    + I RDE LH +F   +         ++ 
Sbjct: 175 AAVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------ENYIV 228

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +++ R ++  A  +E  +  + +P   +G+NA     Y++F+A+R    +G E  +
Sbjct: 229 NKLPKERIREIICSAVDIEREFICDAIPVRLLGMNADLMSTYIEFVADRLLVALGNERHY 288

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             ++NPF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 289 N-SKNPFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|71416121|ref|XP_810103.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma cruzi
           strain CL Brener]
 gi|70874586|gb|EAN88252.1| ribonucleoside-diphosphate reductase small chain, putative
           [Trypanosoma cruzi]
          Length = 337

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 89/336 (26%), Positives = 159/336 (47%), Gaps = 28/336 (8%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
              ++ +L    D   + P+KY   W+KY  A ++ W   E+ +  DLA W+    + + 
Sbjct: 13  QEQEEPLLRENPDRYVIFPIKYHDIWKKYKEAESSIWTVEEIDLSSDLADWE---KMNEG 69

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           E+  IK  L FFA+S+ +V  N+       +  PE R +   Q   E VHS T+  ++ +
Sbjct: 70  EKFFIKHVLAFFAASDGIVLENLAQRFMTEVQVPEVRCFYGFQIAIENVHSETYSVLLDT 129

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   + +    +P I  KANWA+++ ++ SS                +  V + 
Sbjct: 130 YITDTEEKDRMLHAISTIPCIQKKANWAIRWIRSSSS--------------FAERLVAFA 175

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
             EG++F   F  +  L +   M G+    + I RDE LH +F   +         ++  
Sbjct: 176 AVEGIFFSGSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLY------ENYIVN 229

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K   ++ R ++  A  +E  +  +++P   +G+NA     Y++F+A+R    +G E  + 
Sbjct: 230 KLPTERIREIICSAVDIEREFICDSIPVRLLGMNADLMSTYIEFVADRLLVALGNERHYN 289

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ++NPF +M E+I L+ + NFFE +V EYQ+   + 
Sbjct: 290 -SKNPFDFM-EMISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|91215505|ref|ZP_01252476.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
 gi|91186457|gb|EAS72829.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
          Length = 326

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 88/332 (26%), Positives = 158/332 (47%), Gaps = 28/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    +   L P+ +   WE Y     + W   E+ +Q D+  WK+   L+ DE+  
Sbjct: 5   EPILEENKNRFVLFPITHPDIWEWYKKCEASFWTAEEIDLQQDITDWKT--KLSKDEQYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 63  IKHILAFFAASDGIVNENLAENFVNEVQYTEAKFFYGFQIMVENIHSETYSLLIDTYVDD 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   LF      P+I  KA+WALQ+ ++ S                 +  + +   EG
Sbjct: 123 DKEKDLLFKAIENFPAIKKKADWALQWIESDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + N+          +  +
Sbjct: 168 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNEHL------VNQVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++ R ++ +A  +E  +  E++P   +G+N+    QY++F+A+R   ++G +  +  T N
Sbjct: 222 ERIRAIIVDALTIEREFVTESLPVSLIGMNSNLMTQYLEFVADRLLFELGCDKEYG-TAN 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M  +I L+ + NFFE RV EYQ+   + 
Sbjct: 281 PFDFMD-MISLQGKTNFFEKRVGEYQKAGVMN 311


>gi|301166951|emb|CBW26530.1| putative ribonucleoside-diphosphate reductase small chain subunit
           [Bacteriovorax marinus SJ]
          Length = 322

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 97/332 (29%), Positives = 156/332 (46%), Gaps = 27/332 (8%)

Query: 23  RMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
            +L    D   L PLKY   +E Y +     W   E+    D+  W+    L  DE+  I
Sbjct: 3   PILAPNDDRFVLFPLKYHSIFEMYKNHMAVFWTADELDFASDITDWE---KLNKDEQHFI 59

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
           K  L FFA+S+ +V  N+ L  Y  +  PE R +   Q   E +HS T+  +I +   D 
Sbjct: 60  KHILAFFAASDGIVNENLALRFYNDVQIPEARCFYGFQIAMENIHSETYSLLIDTYVKDP 119

Query: 143 ---GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGM 199
               ELF+     P +  KA+WA+++ Q+              + F + L   +   EG+
Sbjct: 120 KEKDELFHAVTHFPFVEKKADWAMKWMQS-------------KRSFAERLIA-FAAIEGI 165

Query: 200 WFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQ 259
           +F   F  I  L +   M G+    ++I RDE LH  F   +   +  E      +  ++
Sbjct: 166 FFSGSFCSIYWLKKRGLMPGLCTSNEFISRDEGLHCEFACHIHELLTPEE-----QLNKE 220

Query: 260 KSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP 319
               ++ EA  +E  +  E +P   +G+NA    +Y++F+A+   +++G E  +  TENP
Sbjct: 221 TITQIITEAVSIEKEFITEAIPVSLIGMNADMMSRYIEFVADYWLNRLGCEKAYN-TENP 279

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           F WM E+I L+ + NFFE RV+EYQ+   L  
Sbjct: 280 FDWM-ELISLEGKTNFFEKRVSEYQKPGVLGD 310


>gi|225320685|dbj|BAH29738.1| ribonucleoside-diphosphate reductase subunit M2 [Dicyema japonicum]
          Length = 337

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 93/343 (27%), Positives = 162/343 (47%), Gaps = 28/343 (8%)

Query: 10  IQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWK 69
           + + ++  + D + +L +      L P++Y   +  Y  A  + W   EV +  D+  W 
Sbjct: 3   LPSEQEEFSDDQEPLLVSNPRRFVLFPIEYPDIFTMYKQALASIWTVEEVDLSKDIKHW- 61

Query: 70  SKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSH 129
             N L  DE+  I   L FFA+S+ +V  N+V      +   E R +   Q   E +HS 
Sbjct: 62  --NILNSDEKRFISHVLAFFAASDGIVNENLVQRFSVEVQVSEARSFYGLQIAVENIHSE 119

Query: 130 TFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
            +  +I +   D  E   +F+    +P +  KA+WA+++ ++             +  F 
Sbjct: 120 MYSLLIDTYISDFQEKDKMFSAIETMPFVKKKADWAIRWIES------------TESHFS 167

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F  V EG++F   FA I  L +   M G+    + I RDE LH +F   + + +K
Sbjct: 168 ERLVAFAAV-EGIFFSGSFASIFWLKKRGVMPGLTYSNELISRDEGLHTDFACLLYHHLK 226

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQ 306
            + P       + +   ++ EA +LE  +  E +P   +G+N     QY++F+A+R   +
Sbjct: 227 KKLP-------RDRILQIITEAVVLEKEFLTEALPVALIGMNVNLMSQYIEFVADRLIIE 279

Query: 307 IGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +G +  + Y +NPF +M E I L  + NFFE RV EYQ+   +
Sbjct: 280 LGYDKHY-YAQNPFDFM-ENISLSGKTNFFEKRVGEYQRMGVM 320


>gi|9633826|ref|NP_051904.1| gp015L [Rabbit fibroma virus]
 gi|6578545|gb|AAF17899.1|AF170722_17 gp015L [Rabbit fibroma virus]
          Length = 322

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 92/333 (27%), Positives = 155/333 (46%), Gaps = 28/333 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           ++D+ +L    D   + P++Y   W+ Y  A  + W P EV +  DL  W     LT DE
Sbjct: 1   MEDEPVLKESLDRYVVFPIQYNDIWKMYKKAVASFWTPEEVDISKDLKDWH---ILTSDE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           +  IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I + 
Sbjct: 58  KYFIKHILAFFAASDGIVNENLAERFYVEVQIAEARCFYGFQIAIENIHSEMYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
            +D  E   LF     +  I  KA W  ++             ++ D  + + L   +  
Sbjct: 118 IIDIQEKEKLFKAIETMDCIKQKAEWVQKWI------------RNKDATYAERLIA-FAS 164

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +  KM G+    + I RDE LH +F   +   +          
Sbjct: 165 VEGIFFSGSFAAIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLMFKHLN-------HT 217

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             + ++  ++ EA ++E  +  + +P   +G+N     QY++F+A+R   ++G   +F  
Sbjct: 218 PSETRATDIIKEAVVIEQQFLTKALPVRLIGINCDLMCQYIEFVADRLVTELGYSKIFSA 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           T NPF +M E I L+ + NFFE RV++YQ+   
Sbjct: 278 T-NPFDFM-ENISLEGKTNFFEKRVSDYQRMGV 308


>gi|322795965|gb|EFZ18591.1| hypothetical protein SINV_11129 [Solenopsis invicta]
          Length = 426

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 85/341 (24%), Positives = 152/341 (44%), Gaps = 28/341 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD-DLALWKSKN 72
           +   N + + +L    +   + P++Y   WE Y  A  + W   EVP+   D   W    
Sbjct: 92  KDDFNPELEPLLQEGPNRFVIFPIQYPDIWEMYKKAVASFWTIEEVPLHKLDKKDWDE-- 149

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L  DE+  I   L FFA+S+ +V  N++    + +   E R +   Q   E +HS  + 
Sbjct: 150 KLNSDEKYFISHVLAFFAASDGIVNENLIERFSQEVKIAEARCFYGFQIAIENIHSEMYS 209

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  E   LFN    +P +  KA WAL +                +     + 
Sbjct: 210 LLIETYISDPKEKDFLFNAIETLPCVGKKAKWALNWIN-------------HESATFPER 256

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            + +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   I  + 
Sbjct: 257 VIAFAAVEGIFFSGSFAAIFWLKKRGVMPGLTFSNELISRDEGLHCDFACLIFKHIIQKP 316

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
                    +  ++++ +A  +E  +  + +P   +G+N      Y++F+A+R    +G 
Sbjct: 317 SF-------EHVKSIIMDAVEIEKEFLTQALPVELIGMNCSLMCNYIEFVADRLFVALGF 369

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           E ++  +ENPF +M+  I L+ + NFFE +V EY++   ++
Sbjct: 370 EKVYN-SENPFSFMN-FISLEGKTNFFEKKVGEYKKFGVVE 408


>gi|47208564|emb|CAF96041.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 352

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 96/353 (27%), Positives = 155/353 (43%), Gaps = 42/353 (11%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        + P++Y   W+ Y  A  + W   EV +  DLA W   + L  +E+  
Sbjct: 5   EPLLQENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLAHW---DSLKPEEKHF 61

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+V    + +  PE R +   Q   E+VHS  +  +I +   D
Sbjct: 62  ISHVLAFFAASDGIVNENLVQRFCQEVQVPEARSFYSYQVLIESVHSEMYSLLINTYIRD 121

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +P +  KA+WALQ+              D+   F + L  F  V EG
Sbjct: 122 LKEREHLFNAIYTMPCVKRKADWALQWIN------------DSTSTFGERLVAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN--------- 249
           ++F   FA I  L +   M G+    + I RDE LH  F   + + +  +          
Sbjct: 169 IFFSGSFASIYWLKKRGLMPGLTYSNELISRDEGLHCTFACLLYSYLVKKPSEDRVKDII 228

Query: 250 -----------PHLWTKEFQQKSRTMLHEATLLE-IAYAHETMPKGFVGLNAPSCEQYMQ 297
                       +      +     ++ +AT      +  E +P   +G+N    +QY++
Sbjct: 229 TKAVSIEQVGGSYRSMDGNKPNREVLIKDATCFCLQEFLTEALPVDLIGMNRCLMKQYIE 288

Query: 298 FIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           F+A+R    +GL  ++   ENPF +M E I L+ + NFFE RV EYQ+   + 
Sbjct: 289 FVADRLFADLGLAKMYN-AENPFDFM-EAISLEGKTNFFEKRVAEYQRFGIMS 339


>gi|70936723|ref|XP_739266.1| ribonucleotide reductase small subunit [Plasmodium chabaudi
           chabaudi]
 gi|56516136|emb|CAH80811.1| ribonucleotide reductase small subunit, putative [Plasmodium
           chabaudi chabaudi]
          Length = 349

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 90/345 (26%), Positives = 163/345 (47%), Gaps = 29/345 (8%)

Query: 8   SPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLAL 67
               +  ++    ++++LN  S    L P+ Y   W  Y  A  + W   E+ +  DL  
Sbjct: 17  EKEFSDLQKNKECNEKILNKESSRFTLHPIMYPEVWNFYKKAEASFWTAEEIDLSSDLKD 76

Query: 68  WKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVH 127
           ++    L  +E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +H
Sbjct: 77  FE---KLNVNEKHFIKHVLAFFAASDGIVLENLASKFLREVQIIEAKKFYAFQIAVENIH 133

Query: 128 SHTFQYIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQE 184
           S T+  +I +   DE E   LF+    +P+I  KA WA ++    +S             
Sbjct: 134 SETYSLLIDNYIRDEKERLNLFHAIENIPAIKNKALWAAKWINDTNS------------- 180

Query: 185 FLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQ 244
              +  V     EG+ F   F  I    + NK+ G+    + I RDE LH +F   + + 
Sbjct: 181 -FAERIVANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSL 239

Query: 245 IKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRC 304
           ++ + P       ++  + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R  
Sbjct: 240 LENKLP-------EEVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLL 292

Query: 305 HQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
             +G   +F +++NPF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 293 ECLGCSKVF-HSKNPFSWMD-LISLQGKTNFFEKRVADYQKSGVM 335


>gi|258542157|ref|YP_003187590.1| ribonucleotide-diphosphate reductase subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633235|dbj|BAH99210.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636294|dbj|BAI02263.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639347|dbj|BAI05309.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642403|dbj|BAI08358.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645458|dbj|BAI11406.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648511|dbj|BAI14452.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651564|dbj|BAI17498.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654555|dbj|BAI20482.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 339

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 95/348 (27%), Positives = 163/348 (46%), Gaps = 20/348 (5%)

Query: 7   LSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLA 66
           +S   +G++        +L A        P +Y WA++ +L+    HW+P EVP+ DD+ 
Sbjct: 1   MSEHMSGQEPQQEQKFDLLTANP---VYKPFRYPWAYDAWLTQQRLHWLPEEVPLADDVK 57

Query: 67  LWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAV 126
            W     L + E+ ++ +   FF  S+  V N  +    R     E    L   +  E +
Sbjct: 58  DWH--RVLNEGEQHLVTQIFRFFTQSDVEVNNCYMKHYSRVFKPTEVLMMLSAFSNIETI 115

Query: 127 HSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFL 186
           H   + Y++ +LG+ E E ++ + +   +  K ++              T T D+  E  
Sbjct: 116 HIAAYSYLLDTLGMPETE-YSAFLKYKEMKDKYDYMQ------------TFTVDSKHEIA 162

Query: 187 QDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIK 246
           + L  F    EG+  +  FA +L+  R NK+ G+ +   + +RDE+LH    I +     
Sbjct: 163 KTLAAFGAFTEGLQLFASFAILLNFPRFNKLKGMGQIVSWSVRDETLHCLSIIRLFRVFI 222

Query: 247 IENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCH 305
            ENP LWT++ + +   +       E A+       G   GLNA   + Y+ FIA+RR  
Sbjct: 223 QENPELWTEQLRTELTDICRTIVEHEEAFIDLAFEMGAVEGLNAEQVKTYIHFIADRRLT 282

Query: 306 QIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA-ELKWD 352
           Q+GLEP++  T NP PW+ ++++  +  NFFE R TEY + +    W+
Sbjct: 283 QLGLEPIYNTTTNPLPWLDDMLNAVEHTNFFENRATEYSRASTSGTWE 330


>gi|74025554|ref|XP_829343.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
 gi|70834729|gb|EAN80231.1| ribonucleoside-diphosphate reductase small chain [Trypanosoma
           brucei]
          Length = 337

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 91/333 (27%), Positives = 156/333 (46%), Gaps = 28/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L    D   + P+KY   W+KY  A +N W    + + +D+  W+    L D ER 
Sbjct: 16  EEPLLTENPDRYVIFPIKYPDIWQKYKKARSNFWAMENIYLGNDMTDWE---KLDDGERH 72

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+ + +V  N V      +  PE R +   Q   E +HS T+  +I +  +
Sbjct: 73  FIKHVLAFFAARDGIVLENFVQRFMCEVQVPEVRCFYGFQIAMENIHSETYSVLIDTYVV 132

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   L +  R +P I  KA WA+++  + +S             F   L  F  V E
Sbjct: 133 DPDEKQRLLHAIRTIPCIEKKAKWAIEWIGSQTS-------------FPTRLVAFAAV-E 178

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  
Sbjct: 179 GIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYEKY------IVNKLP 232

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
           + +   ++  A  +E  +  + +P   +G+N+    QY++F+A+R    +G +  +  ++
Sbjct: 233 RDRVLEIICNAVSIEREFICDALPVRLIGMNSQLMTQYIEFVADRLLVSLGYDRHYN-SK 291

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M  +I L+ + NFFE +V EYQ+   + 
Sbjct: 292 NPFDFMD-MISLQGKTNFFEKKVGEYQKAGVMS 323


>gi|225010999|ref|ZP_03701465.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
 gi|225004906|gb|EEG42862.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
          Length = 328

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 94/334 (28%), Positives = 156/334 (46%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+K+   WE Y       W   E+ + +DL  W   N L +DER  
Sbjct: 6   EPILTENPDRFVIFPIKHDDLWEWYKKCEACFWTAEEIDLSEDLNDWN--NKLNEDERYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  VKHILAFFAASDGIVNENLAENFVSEVQYAEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++ ++                F + L  F  V EG
Sbjct: 124 EKEKNKLFKALENFPAIKEKADWALKWIES--------------PSFAERLIAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H ++ + + N           K  +
Sbjct: 169 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYAVHLHNHHL------INKVPK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            + R +L +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E  +  + N
Sbjct: 223 ARIREILVDALNIERTFITESLPASLIGMNAKLMTQYLEFVTDRLLVELQCEKEYNVS-N 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I L+ + NFFE RV+EYQ+   L  D
Sbjct: 282 PFDFMD-MISLQGKTNFFEKRVSEYQKAGVLNKD 314


>gi|323453718|gb|EGB09589.1| hypothetical protein AURANDRAFT_60022 [Aureococcus anophagefferens]
          Length = 393

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 88/324 (27%), Positives = 149/324 (45%), Gaps = 27/324 (8%)

Query: 28  RSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLG 87
            S    L P+K    W  Y  A  + W   EV +  D   W+    L + ER  + R L 
Sbjct: 78  DSSRFTLFPIKDAGLWAMYKRAEASFWTAEEVDLGQDKQHWEQ---LDEGERYFLSRVLA 134

Query: 88  FFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE--- 144
           FFA+S+ +V  N+V    + ++ PE R +   Q   E VH   +  ++ +   D GE   
Sbjct: 135 FFAASDGIVLENLVERFAQEVTLPEARFFYAFQGAIEGVHQEMYSLLLETYVEDPGEREA 194

Query: 145 LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTG 204
           L   +  +P + AKA+WA+++T +             D  +   L  F  V EG++F   
Sbjct: 195 LTRAHDLMPCVKAKADWAMKWTAS-------------DAPYAARLLAFAAV-EGVFFSGS 240

Query: 205 FAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTM 264
           F  I  L +   + G+    + I RDE LH +F   + +++         +    ++  +
Sbjct: 241 FCAIFWLRKRGILPGLGFANELISRDEGLHCDFACALYSRLPGHL-----RLSDAEATAI 295

Query: 265 LHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMS 324
           + EA   E+ +  + +P   VG+NA     Y++F+A+R    +G   ++    NPF +M 
Sbjct: 296 ISEAVDTEVDFVTDALPVSLVGMNAKLMTDYVKFVADRLLASLGHPKIYGAA-NPFDFM- 353

Query: 325 EVIDLKKEKNFFETRVTEYQQGAE 348
           E+I ++ + NFFE RV EYQ+   
Sbjct: 354 ELISMQGKTNFFEKRVAEYQKANV 377


>gi|15617531|ref|NP_258331.1| RR2B [Spodoptera litura NPV]
 gi|15553267|gb|AAL01745.1|AF325155_57 ribonucleotide reductase small subunit homolog [Spodoptera litura
           NPV]
          Length = 333

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 96/343 (27%), Positives = 164/343 (47%), Gaps = 33/343 (9%)

Query: 18  NVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDD 77
           N+ D+ +L        + P++Y   W  Y  A  + W   EV +  DL+ W   + L + 
Sbjct: 8   NMSDEPLLQENPRRFVMFPIEYPDIWNMYKKAEASFWTVEEVDLSKDLSDW---DSLKES 64

Query: 78  ERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITS 137
           ER  IK  L FFA+S+ +V  N+V    + +   E R +   Q   E VHS  +  +I +
Sbjct: 65  ERNFIKHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQVAIENVHSEMYSLLIDT 124

Query: 138 LGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
              D  E   LFN    +P+I  KA W++++ ++ +              F + L  F  
Sbjct: 125 YVKDNDEKRRLFNAIETMPAIAKKAEWSIKWIKSAT------------ATFAERLIAFAA 172

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           V EG++F   FA I  + +   M G+    + I RDE LH +F   + + I         
Sbjct: 173 V-EGIFFSGSFAAIFWMKKRGLMPGLTFSNELISRDEGLHTDFACLMYSHIVN------- 224

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           K  + +   ++ EA  +E  +  E +P   +G+N     +Y++F+A+R   ++  E  + 
Sbjct: 225 KPTRDRILDIITEAVAIENEFVTEALPVAMLGMNNDLMSKYIEFVADRLLLELIGERHYN 284

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQ-----GAELKWD 352
            T+NPF +M+ +I L+ + NFFE +V+EYQ+     G +L+ D
Sbjct: 285 -TKNPFDFMN-LISLEGKTNFFEKKVSEYQKYGVMSGNKLEDD 325


>gi|284043177|ref|YP_003393517.1| ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
 gi|283947398|gb|ADB50142.1| Ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
          Length = 364

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/328 (35%), Positives = 194/328 (59%), Gaps = 2/328 (0%)

Query: 23  RMLNARSDV-NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           R++  R  +   LLPL+YGWA+E Y +   NHW P +V M  D+  W+ +  L++ +R +
Sbjct: 30  RVVGGRETMTFNLLPLRYGWAYELYRTMKANHWEPEDVQMAKDIEQWRDERALSEIDRWI 89

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           ++  +G+F+++E +V +NI+  +   ++  E +  L R A EE +H+ +  Y+I+SLG+D
Sbjct: 90  VRMAIGYFSAAEGIVGDNILHVVRELMTASELKLVLGRHAHEENIHADSLLYMISSLGID 149

Query: 142 EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWF 201
             E   M+ ++P+I AK  +    +Q L           +     +++F+F    EG  F
Sbjct: 150 PHECEAMFDDIPTIRAKNAFVTSASQALRR-DLDMQDPRSVALLAKNIFLFGQCMEGTQF 208

Query: 202 YTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS 261
           Y  F  +LSL R  K+ GI   ++Y +RDES H+     ++ ++  ENP +WT EF+ + 
Sbjct: 209 YGLFGMVLSLYRQGKLPGIGTMFRYTLRDESNHIELFRRLLRELVAENPEIWTAEFRDEL 268

Query: 262 RTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP 321
           R ++ EA  LE  +  + +P   VGLNA    QY+ +IA+RR   +GLEPL    ENP P
Sbjct: 269 RELMREAVALEQRFIDDCLPVEGVGLNADEFAQYIDYIADRRLEGVGLEPLKPGVENPLP 328

Query: 322 WMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           W++E++D++KE+NFFE RVTEYQ+ + L
Sbjct: 329 WLAELMDVRKEQNFFEGRVTEYQKASAL 356


>gi|156839886|ref|XP_001643629.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114248|gb|EDO15771.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 394

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 95/333 (28%), Positives = 155/333 (46%), Gaps = 27/333 (8%)

Query: 20  DDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDER 79
            ++ +LN   +   + P++Y   +E Y  A  + W   E+ +  DL+ W   + L  +ER
Sbjct: 67  KNEPLLNEDKNRLIMHPIRYPDIYEAYKKAEASFWTAEEIDLSKDLSDWN--DKLNSNER 124

Query: 80  LMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLG 139
             I R L FFA+S+ +V  N+       +  PE R +   Q   E +HS T+  +I +  
Sbjct: 125 FFISRVLAFFAASDGIVNENLTENFSVEVKVPEARCFYGFQIMIENIHSETYSLLIDTYI 184

Query: 140 LDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVF 196
            D  E   LFN    +P I  KA WAL++              + +  F + L   +   
Sbjct: 185 KDPKESDFLFNAIDYIPQIKEKAEWALRWIN------------NDEALFGERLVA-FASI 231

Query: 197 EGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE 256
           EG++F   FA I  L +   M G+    + I RDE LH +F   + + +  +        
Sbjct: 232 EGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLHTDFASLLFSHLDNKPDP----- 286

Query: 257 FQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT 316
                  ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G E  +K  
Sbjct: 287 --AIVEKIVTEAVEIEKRYFIDALPVALLGMNAKLMNQYVEFVADRLLVSFGNEKYYKV- 343

Query: 317 ENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ENPF +M E I L  + NFFE RV++YQ+ + +
Sbjct: 344 ENPFDFM-ENISLAGKTNFFEKRVSDYQKASVI 375


>gi|294055010|ref|YP_003548668.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614343|gb|ADE54498.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 360

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 125/327 (38%), Positives = 201/327 (61%), Gaps = 3/327 (0%)

Query: 24  MLNARSDVN-QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMI 82
           ++N +  +   +LPLKY WA++ Y +  NNHW P ++PMQ D+ LW+S + L+D ER +I
Sbjct: 28  IINGKDTMFFNILPLKYQWAYDLYKTMKNNHWEPEDIPMQKDVELWRSAD-LSDAERWII 86

Query: 83  KRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE 142
           K  +G+F+++E +V +NI       ++ PE +  L R A EE +H+ +  Y+I+SLG++ 
Sbjct: 87  KMAIGYFSAAEGIVGDNIQHVTRELVTAPELKLLLGRHAHEENIHADSLVYMISSLGINP 146

Query: 143 GELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFY 202
            E   M+ ++ +I  K  + +  ++ L      T T D  Q F +++F+F    EG  FY
Sbjct: 147 HECEAMFEDIDTIERKTAFVVNNSRGLRRDMDLTTTADK-QAFTKNMFLFGQCMEGTQFY 205

Query: 203 TGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSR 262
             F  +LSL R NK  GI + ++Y +RDES H+    ++I  +  EN  +WT EF+++ R
Sbjct: 206 GLFGMVLSLYRQNKFPGIGQMFRYTLRDESNHIEVFRNLIMDLIEENEDVWTPEFREELR 265

Query: 263 TMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
            ++ EA  LE  +  + +P   VGL+A    QY+ +IA+RR   +GL PL    +NPFPW
Sbjct: 266 DLMREAVTLEKDFIRDCLPVNSVGLSADEFCQYIDYIADRRLEGVGLAPLSPGVDNPFPW 325

Query: 323 MSEVIDLKKEKNFFETRVTEYQQGAEL 349
           ++E++D+KKE+NFFE RVTEYQ+ + L
Sbjct: 326 LAEMMDIKKEQNFFEGRVTEYQKASAL 352


>gi|82538850|ref|XP_723858.1| ribonucleotide reductase small chain [Plasmodium yoelii yoelii str.
           17XNL]
 gi|145580416|pdb|2P1I|A Chain A, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580417|pdb|2P1I|B Chain B, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580418|pdb|2P1I|C Chain C, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580419|pdb|2P1I|D Chain D, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580420|pdb|2P1I|E Chain E, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580421|pdb|2P1I|F Chain F, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580422|pdb|2P1I|G Chain G, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580423|pdb|2P1I|H Chain H, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|23478298|gb|EAA15423.1| Ribonucleotide reductase, small chain [Plasmodium yoelii yoelii]
          Length = 349

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 90/338 (26%), Positives = 162/338 (47%), Gaps = 29/338 (8%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           ++    ++++LN  S+   L P+ Y   W  Y  A  + W   E+ +  DL  ++    L
Sbjct: 24  QKSKESNEKILNKESNRFTLHPIMYPEVWNFYKKAEASFWTAEEIDLSSDLKDFE---KL 80

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
             +E+  IK  L FFA+S+ +V  N+     R +   E +++   Q   E +HS T+  +
Sbjct: 81  NVNEKHFIKHVLAFFAASDGIVLENLASKFLREVEIIEAKKFYSFQIAVENIHSETYSLL 140

Query: 135 ITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFV 191
           I +   DE E   LF+    +P+I  KA WA ++    +S                +  V
Sbjct: 141 IDNYIKDEKERLNLFHAIENIPAIKNKALWAAKWINDTNS--------------FAERIV 186

Query: 192 FYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 251
                EG+ F   F  I    + NK+ G+    + I RDE LH +F   + + ++ + P 
Sbjct: 187 ANACVEGILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLENKLP- 245

Query: 252 LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEP 311
                 +   + ++ EA  +E ++  E++P   +G+N+    QY++F+A+R    +G   
Sbjct: 246 ------ENVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECLGCSK 299

Query: 312 LFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           +F +++NPF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 300 VF-HSKNPFNWMD-LISLQGKTNFFEKRVADYQKSGVM 335


>gi|73974202|ref|XP_858105.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 4 [Canis familiaris]
          Length = 374

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 100/355 (28%), Positives = 160/355 (45%), Gaps = 37/355 (10%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
           E  V  D++ +L   S    + P++Y   W+ Y  A  + W   EV +  DL  W   N 
Sbjct: 24  ENEVKSDEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW---NK 80

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DE+  I   L FFA+S+ +V  N+V    + +  PE R +   Q   E VHS  +  
Sbjct: 81  LKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 140

Query: 134 IITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  +   LFN    +P +  KA+WAL++ +               +    +  
Sbjct: 141 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIE-------------DRKSTFGERV 187

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  +  
Sbjct: 188 VAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPS 247

Query: 251 HLWTKEF---------QQKSRTMLHEATLLEI-------AYAHETMPKGFVGLNAPSCEQ 294
               +E            +   M+  +  LEI        +  E +P G +G+N    +Q
Sbjct: 248 EERVREIIVNAVEIEQVSREAYMISTSLFLEIATCRSKHEFLTEALPVGLIGMNCVLMKQ 307

Query: 295 YMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           Y++F+A+R   ++G   +F   ENPF +M E I L+ + NFFE RV EYQ+ A +
Sbjct: 308 YIEFVADRLLVELGFSKVF-QAENPFDFM-ENISLEGKTNFFEKRVAEYQRFAVM 360


>gi|307192386|gb|EFN75622.1| Ribonucleoside-diphosphate reductase subunit M2 [Harpegnathos
           saltator]
          Length = 344

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 88/341 (25%), Positives = 156/341 (45%), Gaps = 28/341 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQD-DLALWKSKN 72
           ++  N D + +L    +   + P++Y   W+ Y  A  + W   EVP+   D   W+   
Sbjct: 10  KEEFNPDLEPLLQEEPNRFVIFPIRYPDIWDMYKKAVASFWTIEEVPLHKLDKKDWEE-- 67

Query: 73  GLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQ 132
            L  DER  I   L FFA+S+ +V  N++    + +   E R +   Q   E +HS  + 
Sbjct: 68  KLNSDERYFISHVLAFFAASDGIVNENLIERFCQEVKISEARCFYGFQIAIENIHSEMYS 127

Query: 133 YIITSLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDL 189
            +I +   D  E   LFN    +P +T KANWAL +                +     + 
Sbjct: 128 LLIETYISDLKEKDFLFNAIETLPCVTKKANWALNWIN-------------HESATFPER 174

Query: 190 FVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN 249
            V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +   +  + 
Sbjct: 175 IVAFAAVEGIFFSGSFAAIFWLKKRGVMPGLTFSNELISRDEGLHCDFACLMFKHVIQKP 234

Query: 250 PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 309
                    ++ +T++ +A  +E  +  + +P   +G+N      Y++F+A+R    +G 
Sbjct: 235 SF-------ERVKTIIMDAVEIEKEFLTQALPVKLIGMNCTLMCTYIEFVADRLFVALGF 287

Query: 310 EPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           + ++  +ENPF +M   I L+ + NFFE +V EY++   ++
Sbjct: 288 DKVYN-SENPFSFMD-FISLEGKTNFFEKKVGEYKKFGVME 326


>gi|18640102|ref|NP_570176.1| SPV016 ribonucleotide reductase, small subunit [Swinepox virus]
 gi|18448509|gb|AAL69755.1| SPV016 ribonucleotide reductase, small subunit [Swinepox virus]
          Length = 320

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 88/330 (26%), Positives = 148/330 (44%), Gaps = 29/330 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        + P+KY   W+ Y  +  + W   EV +  DL  W   + LT DE+  
Sbjct: 2   EPILQESDSRFVIFPIKYHDIWKMYKQSVASFWTVEEVDLSKDLDDW---DKLTKDEKYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFASS+ +V  N+    Y  +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKHILAFFASSDGIVNENLAERFYVDVQCSEARCFYGFQIAMENIHSEMYSLLIDTYVRD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   LFN    +  +  KA+WA ++               +  +   +  V +   EG
Sbjct: 119 NIEKMHLFNAIETMECVKKKADWARKWI--------------SSNKVYGERVVAFAAVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  + +   M G+    + I RDE LH +F   +   +            +
Sbjct: 165 IFFSGSFAAIFWIKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLL-------HPPSK 217

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +   +++ +A  +E  +    +P   +G+N     QY++F+A+R   ++G E +F    N
Sbjct: 218 EVITSIIIDAVNIEKEFLTVAIPVDLIGMNCCLMSQYIEFVADRLLTELGCEKVFNV-YN 276

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAE 348
           PF +M E I L+ + NFFE RV+EYQ+   
Sbjct: 277 PFSFM-EYISLEGKTNFFERRVSEYQKMGV 305


>gi|260061082|ref|YP_003194162.1| putative ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
 gi|88785214|gb|EAR16383.1| probable ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
          Length = 328

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 92/337 (27%), Positives = 161/337 (47%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           ++  ++ +L    D   + P+++   WE Y       W   E+ +  DL+ W   N L+D
Sbjct: 1   MSAAEEPILKENKDRFVIFPIQHHDLWEWYKKCEACFWTAEEIDLHQDLSDWN--NKLSD 58

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DE+  IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I 
Sbjct: 59  DEKYFIKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLID 118

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   DE E   LF      P+I  KA+WAL++ ++                F + L  F 
Sbjct: 119 TYVKDEKEKNVLFQAIENFPAIKKKADWALKWIES--------------PSFAERLIAFA 164

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++F   F  I  L +   M G+    + I RDE +H ++ + +       N HL 
Sbjct: 165 AV-EGIFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYAVHLH------NNHLV 217

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +++   ++  A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E ++
Sbjct: 218 NKVPKERITQIITNALDIEREFITESLPVSLIGMNAKLMTQYLEFVTDRLLVELECEKVY 277

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             + NPF +M  +I L+ + NFFE RV+EYQ+   + 
Sbjct: 278 N-STNPFDFMD-MISLQGKTNFFEKRVSEYQKAGVMN 312


>gi|330949820|gb|EGH50080.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae Cit 7]
          Length = 359

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 175/296 (59%), Positives = 232/296 (78%)

Query: 1   MANNTGLSPIQAGEKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVP 60
           +    GL+ ++    RV VD+K M+N R+D+NQL+P KY WAW+KYL  C NHWMP EV 
Sbjct: 64  LDVAEGLAELEGASARVAVDEKMMINCRADLNQLVPFKYDWAWQKYLDGCANHWMPQEVN 123

Query: 61  MQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQ 120
           M  D+ALWK+  GLTDDER ++ RNLGFF++++SLVANN+VLA+YR ++NPECRQY+LRQ
Sbjct: 124 MTADIALWKNPEGLTDDERRIVMRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQ 183

Query: 121 AFEEAVHSHTFQYIITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKD 180
           AFEEA+H+H +QY I SL +DEGE+FNMY E+PS+  KA W L+YT+++S P F TGT +
Sbjct: 184 AFEEAIHTHAYQYCIESLAMDEGEIFNMYHEIPSVAKKAAWGLKYTRSISDPKFETGTVE 243

Query: 181 ADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGID 240
            D+E L++L  +Y V EG++FY GF QILS+GR NKM G+AEQ+QYI+RDES+HLNFGID
Sbjct: 244 TDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYILRDESMHLNFGID 303

Query: 241 VINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM 296
           VINQIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y+
Sbjct: 304 VINQIKIENPHLWDAEMKKEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYL 359


>gi|305665630|ref|YP_003861917.1| putative ribonucleoside-diphosphate reductase small chain
           [Maribacter sp. HTCC2170]
 gi|88710386|gb|EAR02618.1| probable ribonucleoside-diphosphate reductase small chain
           [Maribacter sp. HTCC2170]
          Length = 328

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 87/334 (26%), Positives = 156/334 (46%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+++   WE Y       W   E+ +  DL  W +   L DDE+  
Sbjct: 6   EPILQENKDRFVIFPIQHHDLWEWYKKQEACIWTAEEIDLHQDLTDWNT--KLNDDEKYF 63

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   D
Sbjct: 64  IKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKD 123

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           + E   LF      P+I  KA+WAL++ ++                F + L  F  V EG
Sbjct: 124 DKEKDILFKAIENFPAIKKKADWALKWIES--------------PSFAERLIAFAAV-EG 168

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H ++ + +          +  K  +
Sbjct: 169 IFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDYAVHLHKNH------IVNKVTK 222

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++   ++ +A  +E  +  E++P   +G+N+    QY++F+ +R   ++  + ++  + N
Sbjct: 223 ERITDIIVDALNIEREFITESLPVSLIGMNSKLMTQYLEFVTDRLLVELECDKVYN-SSN 281

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I L+ + NFFE RV+EYQ+   L  D
Sbjct: 282 PFDFMD-MISLQGKTNFFEKRVSEYQKAGVLNKD 314


>gi|120437796|ref|YP_863482.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
 gi|117579946|emb|CAL68415.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
          Length = 325

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 90/334 (26%), Positives = 159/334 (47%), Gaps = 28/334 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L    D   + P+K+   W+ Y       W   E+ + +DL+ W   N L+ DER  
Sbjct: 5   EPILQENKDRFVIFPIKHHDIWDWYKKMEACFWTAEEIDLHEDLSDWN--NKLSADERYF 62

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           +K  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I +   +
Sbjct: 63  LKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLIDTYVKN 122

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF      P+I  KA+WAL++ ++ S                 +  + +   EG
Sbjct: 123 EKEKDQLFKAIEVFPAIKKKADWALKWIESDS---------------FAERLIAFAAVEG 167

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE +H +F + + NQ          +  +
Sbjct: 168 IFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGMHCDFAVHLHNQHL------VNQVPK 221

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +K R +L +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  E  +  + N
Sbjct: 222 EKIREILIDALNIEREFVTESLPVSLIGMNAKLMTQYLEFVTDRLLVELDCEKEYNVS-N 280

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
           PF +M  +I+L+ + NFFE RV+EYQ+   +  D
Sbjct: 281 PFDFMD-MINLQGKTNFFEKRVSEYQKAGVMNKD 313


>gi|225164890|ref|ZP_03727109.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
 gi|224800504|gb|EEG18881.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
          Length = 362

 Score =  248 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 117/330 (35%), Positives = 192/330 (58%), Gaps = 3/330 (0%)

Query: 22  KRMLNARSDV-NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           KR++N R  +   LLPLKY WA++ Y +   NHW P ++PM  D+  W+    +TD ER 
Sbjct: 26  KRVINGRETMTFNLLPLKYQWAYDLYRTMKANHWEPEDIPMGKDIEQWRDPRAVTDQERW 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
           +I+  +G+F+++E +V +NI       ++ PE +  L R A EE +H+ +  Y+I+SLG+
Sbjct: 86  IIRMGIGYFSAAEGIVGDNIQHVTRELVTAPELKLVLGRHAHEENIHADSLLYMISSLGI 145

Query: 141 DEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMW 200
           +  E   M+ ++P+I  K  + ++ ++ L          +  Q   +++F+F    EG  
Sbjct: 146 NPHECEAMFEDIPTIVRKNEFVVKNSRQLRR-DLDLTQPENKQLLARNMFLFGQCMEGTQ 204

Query: 201 FYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK 260
           FY  F  ILSL R NK  GI + ++Y +RDES H+    +++  +  ENP +WT  F+++
Sbjct: 205 FYGLFGMILSLYRQNKFPGIGQMFRYTLRDESNHIEVFRNLLMDLVEENPEIWTPGFKEE 264

Query: 261 SRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT-ENP 319
            R  + EA  LE  +  + +P   VGL       Y+ +IA+RR   +GL P+     +NP
Sbjct: 265 LRETMREAVTLEKEFIRDCLPVNAVGLAVDEFLTYIDYIADRRLEGVGLAPISATPIKNP 324

Query: 320 FPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
            PW++E++D+KKE+NFFE RVTEYQ+ + L
Sbjct: 325 LPWLAEMMDIKKEQNFFEGRVTEYQKASSL 354


>gi|284039889|ref|YP_003389819.1| ribonucleoside-diphosphate reductase [Spirosoma linguale DSM 74]
 gi|283819182|gb|ADB41020.1| Ribonucleoside-diphosphate reductase [Spirosoma linguale DSM 74]
          Length = 349

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 88/332 (26%), Positives = 147/332 (44%), Gaps = 29/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        L P+K+   WE Y +   + W   E+ +  D+  W S   L D ER  
Sbjct: 8   EPILEEDKGRFVLFPIKHWDIWEYYKTHEASFWTAEEIDLGQDMKDWNS---LNDGERHF 64

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+ +     +   E + +   Q   E +HS T+  +I +   D
Sbjct: 65  ISHVLAFFAASDGIVNENLAVNFLSEVQYAEAKCFYGFQVMMENIHSETYSLLIDTYIKD 124

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   L N    +P +  KA WAL++    S                 +  + + V EG
Sbjct: 125 PVEKDRLLNAIDTIPCVQKKAEWALRWIDNGS---------------FAERLIAFAVVEG 169

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   +         H+  K  +
Sbjct: 170 IFFSGSFCSIYWLKKRGMMPGLTFSNELISRDEGLHRDFACMLYT------DHIVNKLPE 223

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            +   ++  A  +E  +  + +P   +G+NA   +QY+ F+A+     +GL  ++    N
Sbjct: 224 SQIYDIIRNAVEIEQEFVADALPVSLIGMNAELMKQYIAFVADHLLVTLGLRKMYNVA-N 282

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M  +I L+ + NFFE RV EYQ+G  + 
Sbjct: 283 PFDFMD-MISLQGKTNFFEKRVGEYQRGEVMS 313


>gi|312130971|ref|YP_003998311.1| ribonucleoside-diphosphate reductase [Leadbetterella byssophila DSM
           17132]
 gi|311907517|gb|ADQ17958.1| Ribonucleoside-diphosphate reductase [Leadbetterella byssophila DSM
           17132]
          Length = 328

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 87/333 (26%), Positives = 153/333 (45%), Gaps = 29/333 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L        + P+K+   WE Y  A  + W   E+ +  D   W S   L D ER  
Sbjct: 10  EPLLMDDPTRFVIFPIKHNDIWEFYKKAEASFWTAEELDLSQDHKDWAS---LNDGERHF 66

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           I   L FFA+S+ +V  N+ +    ++   E + +   Q   E +H+ T+  +I +   D
Sbjct: 67  ISHVLAFFAASDGIVNENLAVGFLSNVQYAEAKCFYGFQIMIENIHAETYSLLIDTYIKD 126

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   + N    +P +  KA+WA+++ +                 F++ L  F  V EG
Sbjct: 127 TTERQRMLNAIETIPCVKKKADWAIRWIEQ--------------GTFIERLIAFAAV-EG 171

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   F  I  L +   M G+    + I RDE LH +F   +  +       +  K  +
Sbjct: 172 IFFSGSFCSIFWLKKRGLMPGLTFSNELISRDEGLHRDFACLLYTKY------IVNKLPE 225

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           ++  T++ +A  +E  +  + +P   +G+NAP   QY++F+A+     + L+ ++  T N
Sbjct: 226 EQVYTIIKDAVEIEKEFVSDALPVSLIGMNAPQMCQYIEFVADHLLESLNLKKVYNAT-N 284

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
           PF +M  +I L+ + NFFE RV EYQ+      
Sbjct: 285 PFDFMD-LISLQGKTNFFEKRVGEYQKAGVTAD 316


>gi|1710399|sp|P50649|RIR2_PLAFG RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|349790|gb|AAA29754.1| ribonucleotide reductase R2 subunit [Plasmodium falciparum]
          Length = 322

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/331 (26%), Positives = 157/331 (47%), Gaps = 27/331 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           +R+LN  SD   L P+ Y   +  Y  A    W   E+    DL  ++    L ++E+  
Sbjct: 2   RRILNKESDRFTLYPILYPDVFPFYKKAEACFWTAEEIDYSSDLKDFE---KLNENEKHF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+ ++  R +   E +++   Q   E +HS T+  +I +   D
Sbjct: 59  IKHVLAFFAASDGIVLENLAVSFLREVQITEAKKFYSFQIAVENIHSETYSLLIDNYIKD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
           E E   LF+    +P++  KA WA ++    +S                +  V     EG
Sbjct: 119 EKERLNLFHAIENIPAVKNKALWAAKWINDTNS--------------FAERIVANACVEG 164

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           + F   F  I    + NK+ G+    + I RDE LH +F   + + +  + P    +   
Sbjct: 165 ILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLDNKLPEQMVQNIV 224

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
           +++         +E ++  E++P   +G+N+    QY++F+A+R    +G   +F +++N
Sbjct: 225 KEAG-----GVEVEKSFICESLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKN 278

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAEL 349
           PF WM  +I L+ + NFFE RV +YQ+   +
Sbjct: 279 PFNWMD-LISLQGKTNFFEKRVADYQKSGVM 308


>gi|211956300|ref|YP_002302368.1| ribonucleotide reductase small subunit [Deerpox virus W-1170-84]
 gi|115503095|gb|ABI99013.1| ribonucleotide reductase small subunit [Deerpox virus W-1170-84]
          Length = 321

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 93/332 (28%), Positives = 151/332 (45%), Gaps = 28/332 (8%)

Query: 22  KRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLM 81
           + +L   ++   + P+ Y   W  Y  A  + W   EV +  DL  WK    LTD+ER  
Sbjct: 2   EPLLVESNNRFVIFPIVYNDIWIMYKKAVASFWTTEEVDLSKDLLDWK---KLTDNERYF 58

Query: 82  IKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLD 141
           IK  L FFA+S+ +V  N+    Y  +   E R +   Q   E +HS  +  +I +   D
Sbjct: 59  IKNILAFFAASDGIVNENLAQRFYSEVQCSEARCFYGFQIAIENIHSEMYSLLIDTYITD 118

Query: 142 EGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEG 198
             E   L      +  +  KA WA ++              D +  + + L  F  V EG
Sbjct: 119 VDEKNHLLKAIDTIDCVKEKAKWAEKWI------------LDKESSYGERLVAFAAV-EG 165

Query: 199 MWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ 258
           ++F   FA I  L +   M G+    + I RDE LH +F   +  Q+             
Sbjct: 166 IFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKQLL-------HPPNP 218

Query: 259 QKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN 318
            +   ++ EA  +E ++    +P   +G+N     QY++F+A+R   ++G   +FK +EN
Sbjct: 219 SRIINIIVEAVSIEKSFLTTALPVKLIGMNCELMCQYIEFVADRLLSELGCTKIFK-SEN 277

Query: 319 PFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           PF +M E I L+ + NFFE RV++YQ+   + 
Sbjct: 278 PFDFM-ESISLEGKTNFFEKRVSDYQKMGIMS 308


>gi|296116311|ref|ZP_06834927.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977130|gb|EFG83892.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 334

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 87/330 (26%), Positives = 157/330 (47%), Gaps = 20/330 (6%)

Query: 24  MLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIK 83
           +L A        P +Y WA++ +L+    HW+P EVP+ DD+  W     LT+ ER ++ 
Sbjct: 18  LLTANP---VYKPFRYPWAYDAWLTQQQVHWLPEEVPLADDVKDWH--RSLTESERHLVT 72

Query: 84  RNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG 143
           +   FF  S+  V N  +    +     E    L   +  E +H   + +++ ++G+ E 
Sbjct: 73  QIFRFFTQSDVEVNNCYMKHYSQVFKPTEVLMMLSAFSNIETIHIAAYSHLLDTIGMPES 132

Query: 144 ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYT 203
           E ++ + +   +  K ++  ++            +     E  + L  F    EG+  + 
Sbjct: 133 E-YSAFLKYKEMKDKYDYMQEF------------SVSNKYEIARTLAAFGAFTEGLQLFA 179

Query: 204 GFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRT 263
            FA +L+  R NK+ G+ +   + +RDE+LH      +      ENP +WT++ Q   R 
Sbjct: 180 SFAILLNFPRFNKLKGMGQIVSWSVRDETLHCVSMARLFRVFVQENPEIWTQKLQDDIRQ 239

Query: 264 MLHEATLLEIAYAHETMPKG-FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPW 322
           +  +    E A+   +   G   GL+A   ++Y++F+ANRR  Q+GL+ L+    NP PW
Sbjct: 240 ICRDIVEHEDAFIDLSFEMGPVEGLDAAQVKRYIRFVANRRLGQLGLDGLYDVATNPLPW 299

Query: 323 MSEVIDLKKEKNFFETRVTEYQQ-GAELKW 351
           + E+++  +  NFFE R TEY +   +  W
Sbjct: 300 VDEMVNAVEHANFFENRSTEYSRAATQGTW 329


>gi|89890041|ref|ZP_01201552.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
 gi|89518314|gb|EAS20970.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
          Length = 330

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 157/337 (46%), Gaps = 28/337 (8%)

Query: 17  VNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTD 76
           +    + +L    D   + P+++   WE Y       W   E+ +Q D+  W+  N L  
Sbjct: 1   MQTTQEPILQENPDRFVIFPIQHDDLWEWYKKQQACIWTAEEIDLQVDITDWQ--NSLNS 58

Query: 77  DERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIIT 136
           DER  IK  L FFA+S+ +V  N+       +   E + +   Q   E +HS T+  +I 
Sbjct: 59  DERYFIKHILAFFAASDGIVNENLAENFVNEVQYSEAKFFYGFQIMMENIHSETYSLLID 118

Query: 137 SLGLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFY 193
           +   D+ E   LF      P+I  KA+WA+++ ++                F + L  F 
Sbjct: 119 TYVKDDAEKDQLFRAIENFPAIKLKADWAMKWIES--------------PSFAERLIAFA 164

Query: 194 VVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 253
            V EG++F   F  I  L +   M G+    + I RDE +H +F + + N          
Sbjct: 165 AV-EGIFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGMHCDFAVHLHNHHL------V 217

Query: 254 TKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            K  +++   ++ +A  +E  +  E++P   +G+NA    QY++F+ +R   ++  +P++
Sbjct: 218 NKVPKERITEIIVDALNIEREFITESLPASLIGMNAKLMTQYLEFVTDRLLGELECDPVY 277

Query: 314 KYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
             T NPF +M  +I ++ + NFFE RV EYQ+   + 
Sbjct: 278 NVT-NPFDFMD-LIGMEGKTNFFEKRVGEYQKAGVMN 312


>gi|255724924|ref|XP_002547391.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           tropicalis MYA-3404]
 gi|240135282|gb|EER34836.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           tropicalis MYA-3404]
          Length = 387

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 88/333 (26%), Positives = 150/333 (45%), Gaps = 27/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +L        + P+KY   W  Y  +  + W   E+ +  D   W+  N +  DER 
Sbjct: 63  NEPLLREDPSRRTVFPIKYPEIWTFYKKSVASFWTAEEIDLSKDFDDWE--NKMNKDERF 120

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N+V      +  PE +     Q   E +HS T+  +I +   
Sbjct: 121 FISRVLAFFAASDGIVNENLVENFCTEVKLPEAKSVYKFQIMMENIHSETYSLLIETYFK 180

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +  I  KA+WA+++ Q            D +  F + L   +   E
Sbjct: 181 DPKEADFLFNAIDNIKYIGEKADWAIRWIQ------------DEEALFAERLVA-FAAIE 227

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE +H ++   + + ++ +         
Sbjct: 228 GIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGIHTDYACLLFSYLENKPDP------ 281

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
                 ++ EA  +E  Y  + +P   +G+N     QY+++ A+R     G +  +  T 
Sbjct: 282 -SIIEKIITEAVSIEKKYFSDALPVSLLGMNCDLMCQYVEYCADRLLVAFGNDKYYNVT- 339

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M E I L  + NFFE RV++YQ+   ++
Sbjct: 340 NPFDFM-ENISLAGKTNFFEKRVSDYQRAGVME 371


>gi|226294144|gb|EEH49564.1| ribonucleotide reductase R2 subunit variant [Paracoccidioides
           brasiliensis Pb18]
          Length = 325

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 90/313 (28%), Positives = 148/313 (47%), Gaps = 27/313 (8%)

Query: 40  GWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLVANN 99
              W+ Y  A  + W   EV +  DL  W   N L DDER  I   L FFA+S+ +V  N
Sbjct: 9   KQIWQMYKKAEASFWTAEEVDLSKDLHDWN--NRLNDDERYFISHVLAFFAASDGIVNEN 66

Query: 100 IVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREVPSIT 156
           +V      +  PE R +   Q   E +HS T+  +I +   +  +   LF+    +P I 
Sbjct: 67  LVERFSGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPKQRTYLFDAIDTIPCIR 126

Query: 157 AKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRANK 216
            KA+WA+++ +            D +  F Q L  F  V EG++F   FA I  L +   
Sbjct: 127 KKADWAIRWIE------------DKESTFAQRLVAFAAV-EGIFFSGSFASIFWLKKRGL 173

Query: 217 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 276
           M G+    + I RDE LH +F   + + ++        +   +  + ++ EA  +E  + 
Sbjct: 174 MPGLTFSNELISRDEGLHTDFACLLFSHLR-------HRPSPEAVQKIITEAVAIEQEFL 226

Query: 277 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 336
            + +P   +G+NA    QY++F+A+R    +G + ++  + NPF +M   I L  + NFF
Sbjct: 227 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKVYN-STNPFDFMD-NISLTGKTNFF 284

Query: 337 ETRVTEYQQGAEL 349
           E RV +YQ+   +
Sbjct: 285 EKRVGDYQKAGVM 297


>gi|40556174|ref|NP_955259.1| CNPV236 ribonucleotide reductase small subunit [Canarypox virus]
 gi|40233999|gb|AAR83582.1| CNPV236 ribonucleotide reductase small subunit [Canarypox virus]
          Length = 323

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 89/335 (26%), Positives = 147/335 (43%), Gaps = 28/335 (8%)

Query: 19  VDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDE 78
           +  + +L    D   + P+++G  W  Y  A  + W   EV +  DL  WK    L  +E
Sbjct: 1   MSSEPLLVNNPDRFVIFPIQHGDIWRMYKQAVASFWTVEEVDLSYDLIDWK---NLKPEE 57

Query: 79  RLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSL 138
           R  I   L FFA S+ +V  N+V    + +  PE R +   Q   E +HS  +  +I + 
Sbjct: 58  RRFISYILAFFAVSDGIVNENLVEKFCQEVQIPEARCFYGFQIAIENIHSEMYSLLIDTY 117

Query: 139 GLDEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVV 195
             D  E   LF+  R +  +  K+ WAL++                D     +  V +  
Sbjct: 118 IDDNNEKKRLFSSMRTMDCVRKKSEWALKWIN--------------DSAPYGERLVAFAA 163

Query: 196 FEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK 255
            EG++F   FA I  L +   M G+    + I RDE LH +F   +        P     
Sbjct: 164 VEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLFTNYLSHKP----- 218

Query: 256 EFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY 315
             Q +   ++  A  +E  +  E +    +G+N+ S  +Y++F+++R    +G    +  
Sbjct: 219 -SQDRVYEIIDSAVSVETEFLTEALSIDLIGMNSKSMIEYIKFVSDRLLVSLGFSKKYNV 277

Query: 316 TENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
            ENPF +M E I L+ + NFFE RV+ YQ+   + 
Sbjct: 278 -ENPFSFM-ENISLEGKANFFEKRVSNYQKMGVMS 310


>gi|238023979|ref|YP_002908211.1| Ribonucleotide reductase subunit beta [Burkholderia glumae BGR1]
 gi|237878644|gb|ACR30976.1| Ribonucleotide reductase, beta subunit [Burkholderia glumae BGR1]
          Length = 337

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 134/337 (39%), Positives = 187/337 (55%), Gaps = 5/337 (1%)

Query: 15  KRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGL 74
           K   V+DKR++N   D+NQL P +Y WAWE +LSA  NHW P E+ M DD+  +  +  L
Sbjct: 5   KPARVEDKRVVNGAGDINQLAPFRYAWAWECFLSANKNHWTPLEISMSDDVHDFHHR--L 62

Query: 75  TDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYI 134
           +  E+ + +  L +  +S+ L   NI LA+   ++ PE + Y  RQ +EEA+H+ T+Q+ 
Sbjct: 63  SPAEKHVFENVLAYLTTSDILAMRNIGLAVMEKMTAPELQIYQARQVYEEALHTWTYQHC 122

Query: 135 ITSLGLDEGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYV 194
           I SLGLD+ E++N YR VP I AK   + +    +  P      +D   EF      F  
Sbjct: 123 IESLGLDQQEIYNRYRVVPQIHAKIALSNRRLNRMLEPGLDLHDRDTLHEFALAYLFFAA 182

Query: 195 VFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT 254
           VFEG WFY GF+ + +L R   M   A+Q+QYIMRDE LH  FGI VI Q+  E      
Sbjct: 183 VFEGTWFYNGFSPVFALQRRGLMKATAQQFQYIMRDEVLHCGFGIRVIRQLLEEE---HL 239

Query: 255 KEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK 314
           +      + +  EA   E AYA   +    +G +A    +  +FIANRR  Q+ +   F 
Sbjct: 240 RLDPHAVQQIWEEAEAAERAYAQYILRDPILGYSAELHCEQFRFIANRRATQLSMPAPFP 299

Query: 315 YTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKW 351
              N  PW+ E  +L+KEKNFFETRVT+YQ G  L W
Sbjct: 300 GATNALPWLDEQANLRKEKNFFETRVTDYQSGGALDW 336


>gi|302536805|ref|ZP_07289147.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
 gi|302445700|gb|EFL17516.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
          Length = 356

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 103/323 (31%), Positives = 174/323 (53%), Gaps = 9/323 (2%)

Query: 33  QLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASS 92
            L P++Y   +E+Y  A  N W   EV +  D+A       LT  E+ MI R + FFA+ 
Sbjct: 35  TLRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVAD---LAKLTPAEQHMIGRLVAFFATG 91

Query: 93  ESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMY 149
           +S+V+NN+VL +Y+H+++PE R YL RQ FEEAVH