RPSBLAST alignment for GI: 254780845 and conserved domain: PRK13967

>gnl|CDD|140023 PRK13967, nrdF1, ribonucleotide-diphosphate reductase subunit beta; Provisional. Length = 322
 Score = 60.1 bits (145), Expect = 7e-10
 Identities = 63/292 (21%), Positives = 120/292 (41%), Gaps = 42/292 (14%)

Query: 32  NQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFAS 91
           N+LL  K    WE+      N W+P ++P+ +DLA W++ +       + +   L    +
Sbjct: 15  NRLLDAKDLQVWERL---TGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDT 71

Query: 92  SESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDE--GELFNMY 149
           +++ V     +A+      P     L   AF E+VH+ ++  I ++L   +   + F+  
Sbjct: 72  AQATVG---AVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWS 128

Query: 150 REVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQIL 209
            + P +  KA   + Y +   +      +               V+ E   FY+GF   +
Sbjct: 129 EQNPYLQRKAQIIVDYYRGDDALKRKASS---------------VMLESFLFYSGFYLPM 173

Query: 210 SLGRANKMVGIAEQYQYIMRDESLHLNF-------GIDVINQIKIENPHLWTKEFQQKSR 262
                 K+   A+  + I+RDE++H  +       G+  +   +  +   +T E      
Sbjct: 174 YWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCE------ 227

Query: 263 TMLHEATLLEIAYAHETMPK-GFVGLNAPSCEQYMQFIANRRCHQIGLEPLF 313
            +LH     EI YAH+   + G+     P    YM++ AN+    +G +P F
Sbjct: 228 -LLHTLYANEIDYAHDLYDELGWTDDVLP----YMRYNANKALANLGYQPAF 274