RPSBLAST alignment for GI: 254780845 and conserved domain: pfam00268

>gnl|CDD|144013 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, small chain. Length = 281
 Score =  140 bits (355), Expect = 5e-34
 Identities = 77/292 (26%), Positives = 123/292 (42%), Gaps = 26/292 (8%)

Query: 36  PLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESL 95
           P+++   WE Y  A  N W+  EV +  D+  W+    L + ER        F A+++ +
Sbjct: 13  PIQHPDIWELYKKAEANRWLAEEVDLSKDIPDWEK---LNEAEREFYSFVFAFLAAADGI 69

Query: 96  VANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE---LFNMYREV 152
           V  N+   +       +   Y   Q   E VHS  +  I  +L  DE E    FN     
Sbjct: 70  VNENLAERLSAEFQQKDILHYYGEQIAIENVHSEVYSLIQLTLFNDEKERDAYFNAIETD 129

Query: 153 PSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLG 212
           P+I  KA W L+                 D E L +  + + + EG++F + FA I  L 
Sbjct: 130 PAIQRKAQWLLR--------------WVRDAESLAEKLIAFALVEGIFFSSSFASIAYLR 175

Query: 213 RANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 272
           +   M G  +  + I RDE+LH +    + N           K   ++   +  EA  +E
Sbjct: 176 KRGLMPGTCQSNELISRDEALHTDAACLLYNNYLGLE-----KPEPKRIYKLFREAVEIE 230

Query: 273 IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMS 324
           I +     P    G+N  + +QY++F A+R    IG +PLF    NPF  ++
Sbjct: 231 IEFIEAAAPVDVHGMNVRAIKQYIEFSADRLLVAIGYKPLFN-VPNPFFPLA 281