RPSBLAST alignment of GI: 254780845 and protein with PDBid: 1h0o

>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Length = 390
 Score =  272 bits (696), Expect = 1e-73
 Identities = 92/342 (26%), Positives = 155/342 (45%), Gaps = 28/342 (8%)

Query: 14  EKRVNVDDKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNG 73
               +V+D+ +L        + P++Y   W+ Y  A  + W   EV +  D+  W++   
Sbjct: 63  PTNPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEA--- 119

Query: 74  LTDDERLMIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQY 133
           L  DER  I   L FFA+S+ +V  N+V    + +   E R +   Q   E +HS  +  
Sbjct: 120 LKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSL 179

Query: 134 IITSLGLDEGELFNM---YREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLF 190
           +I +   D  E   +      +P +  KA+WAL++                 +    +  
Sbjct: 180 LIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWI-------------GDKEATYGERV 226

Query: 191 VFYVVFEGMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENP 250
           V +   EG++F   FA I  L +   M G+    + I RDE LH +F   +         
Sbjct: 227 VAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK------- 279

Query: 251 HLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 310
           HL  K  +Q+ R ++  A  +E  +  E +P   +G+N    +QY++F+A+R   ++G  
Sbjct: 280 HLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFN 339

Query: 311 PLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELKWD 352
            +F+  ENPF +M   I L+ + NFFE RV EYQ+   +   
Sbjct: 340 KIFR-VENPFDFMEN-ISLEGKTNFFEKRVGEYQRMGVMSNS 379