RPSBLAST alignment of GI: 254780845 and protein with PDBid: 1jk0

>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Length = 419
 Score =  275 bits (704), Expect = 1e-74
 Identities = 95/333 (28%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W ++  + ++ER 
Sbjct: 95  EEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNR--MNENERF 152

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   
Sbjct: 153 FISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIK 212

Query: 141 DEGE---LFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D  E   LFN    +P I  KA WAL++ Q                    +  V +   E
Sbjct: 213 DPKESEFLFNAIHTIPEIGEKAEWALRWIQD-------------ADALFGERLVAFASIE 259

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +   +K +      ++ 
Sbjct: 260 GVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEK- 318

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
                 ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  E
Sbjct: 319 ------IVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VE 371

Query: 318 NPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK 350
           NPF +M E I L  + NFFE RV++YQ+   + 
Sbjct: 372 NPFDFM-ENISLAGKTNFFEKRVSDYQKAGVMS 403