RPSBLAST alignment of GI: 254780845 and protein with PDBid: 1jk0

>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Length = 345
 Score =  265 bits (677), Expect = 1e-71
 Identities = 72/319 (22%), Positives = 131/319 (41%), Gaps = 27/319 (8%)

Query: 34  LLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSE 93
           + P+KY   W  Y     + W   E+ +  D   ++    LTDD++  I   L    SS+
Sbjct: 37  MFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQK---LTDDQKTYIGNLLALSISSD 93

Query: 94  SLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEGE--LFNMYRE 151
           +LV   ++      L NPE + +   Q   E ++S  +  ++ +   D     LF     
Sbjct: 94  NLVNKYLIENFSAQLQNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDPKNIPLFKEIAN 153

Query: 152 VPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSL 211
           +P +  KA +  ++                D     +  V +   EG++    +A +  L
Sbjct: 154 LPEVKHKAAFIERWISN-------------DDSLYAERLVAFAAKEGIFQAGNYASMFWL 200

Query: 212 GRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLL 271
                M G+A   + I RD   + +F   +         HL TK   +    ++ EA  +
Sbjct: 201 TDKKIMPGLAMANRNICRDRGAYTDFSCLLFA-------HLRTKPNPKIIEKIITEAVEI 253

Query: 272 EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 331
           E  Y   ++P    G++  S   Y++F+A+      G E  +    NPF +M +V    K
Sbjct: 254 EKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYN-AVNPFEFMEDVATAGK 312

Query: 332 EKNFFETRVTEYQQGAELK 350
              FFE +V++YQ+ +++ 
Sbjct: 313 -TTFFEKKVSDYQKASDMS 330