RPSBLAST alignment of GI: 254780845 and protein with PDBid: 2o1z

>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Length = 311
 Score =  202 bits (514), Expect = 1e-52
 Identities = 77/306 (25%), Positives = 140/306 (45%), Gaps = 28/306 (9%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++++L+  +D   L P+ Y   W+ Y  A  + W   E+ +  DL  ++    L D+E+ 
Sbjct: 29  NEKILSKETDRFTLYPILYPDVWDFYKKAEASFWTAEEIDLSSDLKDFEK---LNDNEKH 85

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            IK  L FFA+S+ +V  N+     R +   E +++   Q   E +HS T+  +I +   
Sbjct: 86  FIKHVLAFFAASDGIVLENLASKFLRQVKITEAKKFYAFQIAVENIHSETYSLLIDNYIK 145

Query: 141 D---EGELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D      LF+    +P++  KA WA ++                D     +  V     E
Sbjct: 146 DEKERMNLFHAIENIPAVKNKALWAAKWIN--------------DTNSFAERIVANACVE 191

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G+ F   F  I    + NK+ G+    + I RDE LH +F   + + ++ + P    +  
Sbjct: 192 GILFSGSFCAIFWFKKQNKLHGLTFSNELISRDEGLHTDFNCLIYSLLENKLPEEVVQN- 250

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
                 ++ EA  +E ++  E++P   +G+N+    QY++F+A+R    +G   +F   +
Sbjct: 251 ------IVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECLGSPKIFH-AK 303

Query: 318 NPFPWM 323
           NPF WM
Sbjct: 304 NPFNWM 309