RPSBLAST alignment of GI: 254780845 and protein with PDBid: 3mjo

>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Length = 296
 Score =  209 bits (532), Expect = 1e-54
 Identities = 53/290 (18%), Positives = 109/290 (37%), Gaps = 24/290 (8%)

Query: 37  LKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERLMIKRNLGFFASSESLV 96
           +      E +     N W+P ++P+ +D+  W     +T  E+L   R        +++ 
Sbjct: 23  IPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWNK---MTPQEQLATMRVFTGLTLLDTIQ 79

Query: 97  ANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGLDEG--ELFNMYREVPS 154
                +++                AF E+VH+ ++  I  +L       E F    E  +
Sbjct: 80  GTVGAISLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENEN 139

Query: 155 ITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFEGMWFYTGFAQILSLGRA 214
           +  KA   + Y                + +      V   + E   FY+GF   + L   
Sbjct: 140 LQRKAKIIMSYY---------------NGDDPLKKKVASTLLESFLFYSGFYLPMYLSSR 184

Query: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIA 274
            K+   A+  + I+RDES+H  +      Q   +      +E++  +  ++++    EI 
Sbjct: 185 AKLTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIE 244

Query: 275 YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF-PWM 323
           Y  +      +G      ++++++ AN+  + +G E LF   E    P +
Sbjct: 245 YTEDIYDD--LGWTE-DVKRFLRYNANKALNNLGYEGLFPTDETKVSPAI 291