RPSBLAST alignment of GI: 254780845 and SCOP domain: d1jk0a_

Alignment
>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Length = 334
 Score =  202 bits (515), Expect = 4e-53
 Identities = 83/306 (27%), Positives = 139/306 (45%), Gaps = 26/306 (8%)

Query: 21  DKRMLNARSDVNQLLPLKYGWAWEKYLSACNNHWMPTEVPMQDDLALWKSKNGLTDDERL 80
           ++ +LN   +   L P+KY   W+ Y  A  + W   E+ +  D+  W ++  + ++ER 
Sbjct: 50  EEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNR--MNENERF 107

Query: 81  MIKRNLGFFASSESLVANNIVLAIYRHLSNPECRQYLLRQAFEEAVHSHTFQYIITSLGL 140
            I R L FFA+S+ +V  N+V      +  PE + +   Q   E +HS T+  +I +   
Sbjct: 108 FISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIK 167

Query: 141 DEG---ELFNMYREVPSITAKANWALQYTQTLSSPSFTTGTKDADQEFLQDLFVFYVVFE 197
           D      LFN    +P I  KA WAL++ Q                    +  V +   E
Sbjct: 168 DPKESEFLFNAIHTIPEIGEKAEWALRWIQD-------------ADALFGERLVAFASIE 214

Query: 198 GMWFYTGFAQILSLGRANKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF 257
           G++F   FA I  L +   M G+    + I RDE LH +F   +   +K +      ++ 
Sbjct: 215 GVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEK- 273

Query: 258 QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 317
                 ++ EA  +E  Y  + +P   +G+NA    QY++F+A+R     G +  +K  E
Sbjct: 274 ------IVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VE 326

Query: 318 NPFPWM 323
           NPF +M
Sbjct: 327 NPFDFM 332

SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]