RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] (324 letters) >gnl|CDD|30545 COG0196, RibF, FAD synthase [Coenzyme metabolism]. Length = 304 Score = 272 bits (698), Expect = 8e-74 Identities = 125/311 (40%), Positives = 187/311 (60%), Gaps = 13/311 (4%) Query: 1 MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIA--NNSPITVLSFNPH 58 + HNI + L+G V+ IGNFDG+HLGH +L QA++ A P+ V++F PH Sbjct: 4 IRGTHNIPED------LRGCVLTIGNFDGVHLGHQKLLAQALEAAEKRGLPVVVITFEPH 57 Query: 59 PRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEV 118 PR +++ P L+P + ++L G AL+ F LE AN SAE+F++ +LVE L V Sbjct: 58 PRELLKPDKPPTRLTPLREKIRLLAGYGVDALVVLDFDLEFANLSAEEFVE-LLVEKLNV 116 Query: 119 KTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGH 178 K ++ G FRFGK R G+ +L++ G+K GF + ++ +SS+ IR AL +G Sbjct: 117 KHIVVGFDFRFGKGRQGNAELLRELGQK-GFEVTIVPKINEEG-IRISSTAIRQALREGD 174 Query: 179 VLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSY 238 + A LLG ++IE V+HG+K+GRTLGFPTAN+ L ++L GVYA+R + Y Sbjct: 175 LEEANKLLGRPYSIEGKVVHGQKLGRTLGFPTANIYLKDNVLPAFGVYAVRVKLDGGV-Y 233 Query: 239 SGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYM 298 GVAN G PT+ LE I DF+ ++YG+R V F ++R E KF +++LK + Sbjct: 234 PGVANVGYRPTVD-GSERSLEVHILDFNGDLYGERVKVRFLKFIRDEKKFDSLDELKEQI 292 Query: 299 GEDEKKARKIL 309 +D ++ARK+L Sbjct: 293 EKDIERARKLL 303 >gnl|CDD|185679 cd02064, FAD_synthetase_N, FAD synthetase, N-terminal domain of the bifunctional enzyme. FAD synthetase_N. N-terminal domain of the bifunctional riboflavin biosynthesis protein riboflavin kinase/FAD synthetase. These enzymes have both ATP:riboflavin 5'-phosphotransferase and ATP:FMN-adenylyltransferase activities. The N-terminal domain is believed to play a role in the adenylylation reaction of FAD synthetases. The C-terminal domain is thought to have kinase activity. FAD synthetase is present among all kingdoms of life. However, the bifunctional enzyme is not found in mammals, which use separate enzymes for FMN and FAD formation. Length = 180 Score = 173 bits (441), Expect = 5e-44 Identities = 74/181 (40%), Positives = 108/181 (59%), Gaps = 4/181 (2%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIA--NNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQ 78 VVAIGNFDG+HLGH +++ KIA P VL+F+PHPR + L+ + Sbjct: 2 VVAIGNFDGVHLGHQALIKTLKKIARERGLPSAVLTFDPHPREVFLPDKAPPRLTTLEEK 61 Query: 79 EKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRG 138 ++LE +G L+ F E A+ SAE+F++ +LV+ L K V+ G FRFGK R+GD Sbjct: 62 LELLESLGVDYLLVLPFDKEFASLSAEEFVEDLLVK-LNAKHVVVGFDFRFGKGRSGDAE 120 Query: 139 ILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIH 198 +L++ G+KYGF + + + + VSS+ IR AL +G V A LLG ++IE V+H Sbjct: 121 LLKELGKKYGFEVTVVPPVTLD-GERVSSTRIREALAEGDVELANELLGRPYSIEGRVVH 179 Query: 199 G 199 G Sbjct: 180 G 180 >gnl|CDD|145043 pfam01687, Flavokinase, Riboflavin kinase. This family represents the C-terminal region of the bifunctional riboflavin biosynthesis protein known as RibC in Bacillus subtilis. The RibC protein from Bacillus subtilis has both flavokinase and flavin adenine dinucleotide synthetase (FAD-synthetase) activities. RibC plays an essential role in the flavin metabolism. This domain is thought to have kinase activity. Length = 125 Score = 150 bits (382), Expect = 4e-37 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 3/127 (2%) Query: 185 LLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILL-KEGVYAIRFRTQDQTSYSGVAN 243 LLG ++I V+HG+ GRTLGFPTAN+ L D LL K GVYA+R + + Y GVAN Sbjct: 1 LLGRPYSISGTVVHGKGRGRTLGFPTANLSLPKDKLLPKNGVYAVRVKIDGKV-YPGVAN 59 Query: 244 FGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEK 303 G NPT +E I DF ++YG+ V F +LRPE KF +E+LK + +D + Sbjct: 60 IGVNPT-FGGTKPTIEVHILDFDGDLYGEEIRVEFLKFLRPEKKFDSLEELKAQIEKDIE 118 Query: 304 KARKILE 310 +ARKIL Sbjct: 119 QARKILA 125 >gnl|CDD|38320 KOG3110, KOG3110, KOG3110, Riboflavin kinase [Coenzyme transport and metabolism]. Length = 153 Score = 50.7 bits (121), Expect = 6e-07 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 5/129 (3%) Query: 188 YRFTIESDVIHG-EKIGRTLGFPTANMQLS--PDIL--LKEGVYAIRFRTQDQTSYSGVA 242 +V+ G + + LG PTAN + P + L GVY + V Sbjct: 11 LPLFFGGEVVRGFGRGSKELGIPTANFPENVVPKLPEDLPSGVYFGWAHVDKGDVFKMVM 70 Query: 243 NFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDE 302 + G NP + I DF ++ YG+ V Y+RPE+ F +E L + D Sbjct: 71 SIGWNPYYKNKKKTMELHLIHDFGEDFYGETLKVIIVGYIRPELNFDSLESLIEAIHGDI 130 Query: 303 KKARKILES 311 + A+K+L+ Sbjct: 131 EVAKKVLDL 139 >gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain. Cytidylyltransferase-like domain. Many of these proteins are known to use CTP or ATP and release pyrophosphate. Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown. Length = 143 Score = 37.4 bits (87), Expect = 0.006 Identities = 28/157 (17%), Positives = 60/157 (38%), Gaps = 19/157 (12%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEK 80 + IG F+ HLGH ++++A++ A + + ++ + P P S+ E+ Sbjct: 2 GIIIGRFEPFHLGHLKLIKEALEEALDE-VIIIIVSNPP-------KKKRNKDPFSLHER 53 Query: 81 ILE-KMGFSALIR---YKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGD 136 + K ++ F + ++ +L + V+ G F FGK+ Sbjct: 54 VEMLKEILKDRLKVVPVDFPEVKILLAVVFILKILLK--VGPDKVVVGEDFAFGKNA--- 108 Query: 137 RGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTA 173 K ++ ++ R + +SS+ IR Sbjct: 109 --SYNKDLKELFLDIEIVEVPRVRDGKKISSTLIREL 143 >gnl|CDD|144891 pfam01467, CTP_transf_2, Cytidylyltransferase. This family includes: Cholinephosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase. Length = 148 Score = 35.5 bits (82), Expect = 0.022 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 22 VAIGNFDGIHLGHHLILEQAIKIANNSPITVL 53 + G FD IHLGH +LEQA ++ + I + Sbjct: 1 LFGGTFDPIHLGHLRLLEQAKELFDLDKIVGV 32 >gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase. Nicotinamide/nicotinate mononucleotide (NMN/ NaMN)adenylyltransferase (NMNAT). NMNAT represents the primary bacterial and eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide. It is an indispensable enzyme in the biosynthesis of NAD(+) and NADP(+). Nicotinamide-nucleotide adenylyltransferase synthesizes NAD via the salvage pathway, while nicotinate-nucleotide adenylyltransferase synthesizes the immediate precursor of NAD via the de novo pathway. Human NMNAT displays unique dual substrate specificity toward both NMN and NaMN, and can participate in both de novo and salvage pathways of NAD synthesis. Length = 192 Score = 32.6 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 25 GNFDGIHLGHHLILEQAIKIANNSP-ITVLSFNP 57 G+FD HLGH I E+A++ + + S NP Sbjct: 6 GSFDPPHLGHLAIAEEALEELGLDRVLLLPSANP 39 >gnl|CDD|173915 cd02164, PPAT_CoAS, phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes. The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions. The final two steps of the CoA biosynthesis pathway are catalyzed by phosphopantetheine adenylyltransferase (PPAT) and dephospho-CoA (dPCoA) kinase (DPCK). The PPAT reaction involves the reversible adenylation of 4'-phosphopantetheine to form 3'-dPCoA and PPi, and DPCK catalyses phosphorylation of the 3'-hydroxy group of the ribose moiety of dPCoA. In eukaryotes the two enzymes are part of a large multienzyme complex . Studies in Corynebacterium ammoniagenes suggested that separate enzymes were present, and this was confirmed through identification of the bacterial PPAT/CoAD. Length = 143 Score = 30.7 bits (70), Expect = 0.57 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIANN 47 V G FD +H GH ++L A +A Sbjct: 2 VAVGGTFDRLHDGHKILLSVAFLLAGE 28 >gnl|CDD|31729 COG1540, COG1540, Uncharacterized proteins, homologs of lactam utilization protein B [General function prediction only]. Length = 252 Score = 30.2 bits (68), Expect = 0.84 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 15/91 (16%) Query: 144 GEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIG 203 GE +G + DE +VSS+NI +A L R T+ +G IG Sbjct: 11 GEGFGAWRMGDDE---ALLPLVSSANIACGF------HAGDPLTMRRTVRLAKENGVAIG 61 Query: 204 RTLGFPT------ANMQLSPDILLKEGVYAI 228 G+P M LSP+ L + +Y I Sbjct: 62 AHPGYPDLVGFGRREMALSPEELYAQVLYQI 92 >gnl|CDD|31222 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only]. Length = 158 Score = 29.8 bits (67), Expect = 1.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIANNSPITVLS 54 V G FD +H GH +LE A +I + I + S Sbjct: 8 VAVGGTFDRLHDGHKKLLEVAFEIGDRVTIGLTS 41 >gnl|CDD|31257 COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism]. Length = 197 Score = 29.5 bits (66), Expect = 1.1 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 25 GNFDGIHLGHHLILEQAIKIANNSPITVL--SFNPHPRTIIQSSS 67 G+FD H GH LI E+A+ + L PH + +S+ Sbjct: 10 GSFDPPHYGHLLIAEEALDQLGLDKVIFLPSPVPPHKKKKELASA 54 >gnl|CDD|37597 KOG2386, KOG2386, KOG2386, mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification]. Length = 393 Score = 29.5 bits (66), Expect = 1.4 Identities = 12/71 (16%), Positives = 18/71 (25%), Gaps = 2/71 (2%) Query: 251 VPNGPLLLESFIFD--FSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKI 308 +G I Y + F RP K +Y + K+ Sbjct: 131 CTHGLNRTGYLICAYLADVGGYSSSEAIKRFADARPPGIEKQDYIDALYSRYHDIFPFKV 190 Query: 309 LESSYPLSERD 319 S P +R Sbjct: 191 SCPSMPDWKRS 201 >gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase. The cytidylyltransferase family includes cholinephosphate cytidylyltransferase (CCT), glycerol-3-phosphate cytidylyltransferase, RafE and phosphoethanolamine cytidylyltransferase (ECT). All enzymes catalyze the transfer of a cytidylyl group from CTP to various substrates. Length = 136 Score = 28.8 bits (65), Expect = 2.0 Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIANNSPITVLS 54 V A G FD IH GH LE+A K+ + + V Sbjct: 4 VYAAGTFDIIHPGHIRFLEEAKKLGDYLIVGVAR 37 >gnl|CDD|30960 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism]. Length = 140 Score = 28.7 bits (64), Expect = 2.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 21 VVAIGNFDGIHLGHHLILEQAIKIAN 46 V A G FD +H GH L QA K+ + Sbjct: 4 VWADGTFDILHPGHIEFLRQAKKLGD 29 >gnl|CDD|173941 cd08182, HEPD, Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP). Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) with either NADH or NADPH as a cofactor. NADH is the preferred cofactor. PnAA is a biosynthetic intermediate for several phosphonates such as the antibiotic fosfomycin, phosphinothricin tripeptide (PTT), and 2-aminoethylphosphonate (AEP). This enzyme is named PhpC in PTT biosynthesis pathway in Streptomyces hygroscopicus and S. viridochromogenes. Members of this family are only found in bacteria. Length = 367 Score = 28.4 bits (64), Expect = 2.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 8/41 (19%) Query: 168 SNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGF 208 SN RT AAH + Y T V HG TL Sbjct: 248 SNTRTT--------AAHAISYPLTSRYGVPHGLACALTLPA 280 >gnl|CDD|37702 KOG2491, KOG2491, KOG2491, Nuclear matrix protein [Nuclear structure]. Length = 674 Score = 28.1 bits (62), Expect = 3.1 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Query: 279 FDYLRPEIKFKDI-----EKLKIYMGEDEKKARKILESSYPLSER 318 F YL+ + KFK ++ +++ E EK+ K+LE + P +R Sbjct: 331 FQYLKAQSKFKSSKYVLSDEQALWLKECEKRVYKLLEETPPDGKR 375 >gnl|CDD|30392 COG0043, UbiD, 3-polyprenyl-4-hydroxybenzoate decarboxylase and related decarboxylases [Coenzyme metabolism]. Length = 477 Score = 28.3 bits (63), Expect = 3.2 Identities = 19/98 (19%), Positives = 40/98 (40%), Gaps = 7/98 (7%) Query: 2 HVFHN---IEINQSLPNHLKGGVVAIGNFDGIHLGHHLIL-EQAIKIANNSPIT---VLS 54 FH + I + P H K ++A + +I+ + I + + + + Sbjct: 346 GCFHLLAVVSIKKRYPGHAKRVMLAAWGAGQLSYTKFVIVVDDDIDVRDWNEVIWAIATR 405 Query: 55 FNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIR 92 F+P +I ++P +L P S + + K+G A + Sbjct: 406 FDPDRDLVIIPNTPGDSLDPASPKSGLGSKLGIDATKK 443 >gnl|CDD|37514 KOG2303, KOG2303, KOG2303, Predicted NAD synthase, contains CN hydrolase domain [Coenzyme transport and metabolism, General function prediction only]. Length = 706 Score = 28.0 bits (62), Expect = 3.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 72 LSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQF 107 LSP + EK+ + ++ R+K T+ T +Y AE + Sbjct: 627 LSPRQVAEKVKRFFSYYSINRHKMTVLTPSYHAENY 662 >gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism]. Length = 159 Score = 27.4 bits (61), Expect = 5.7 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Query: 25 GNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTL 72 G+FD I GH I+++A + + + V NP + P+F+L Sbjct: 9 GSFDPITNGHLDIIKRASALFDEVIVAVA-INPSKK-------PLFSL 48 >gnl|CDD|146404 pfam03746, LamB_YcsF, LamB/YcsF family. This family includes LamB. The lam locus of Aspergillus nidulans consists of two divergently transcribed genes, lamA and lamB, involved in the utilisation of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression. The exact molecular function of the proteins in this family is unknown. Length = 242 Score = 27.3 bits (61), Expect = 5.8 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 19/93 (20%) Query: 144 GEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKG--HVLNAAHLLGYRFTIESDVIHGEK 201 GE +G T+ DE +V+S+NI G V+ T+ HG + Sbjct: 9 GESFGAWTMGDDE---ALLPLVTSANIACGFHAGDPSVMRR--------TVRLAAEHGVR 57 Query: 202 IGRTLGFPT------ANMQLSPDILLKEGVYAI 228 IG G+P M LS + L +Y I Sbjct: 58 IGAHPGYPDLVGFGRRAMALSAEELYALVLYQI 90 >gnl|CDD|147039 pfam04683, Proteasom_Rpn13, Proteasome complex subunit Rpn13 ubiquitin receptor. This family was thought originally to be involved in cell-adhesion, but the members are now known to be proteasome subunit Rpn13, a novel ubiquitin receptor. The 26S proteasome is a huge macromolecular protein-degradation machine consisting of a proteolytically active 20S core, in the form of four disc-like proteins, and one or two 19S regulatory particles. The regulatory particle(s) sit on the top and or bottom of the core, de-ubiquitinate the substrate peptides, unfold them and guide them into the narrow channel through the centre of the core. Rpn13 and its homologues dock onto the regulatory particle through the N-terminal region which binds Rpn2. The C-terminal part of the domain binds de-ubiquitinating enzyme Uch37/UCHL5 and enhances its isopeptidase activity. Rpn13 binds ubiquitin via a conserved amino-terminal region called the pleckstrin-like receptor for ubiquitin, termed Pru, domain. The domain forms two contiguous anti-parallel beta-sheets with a configuration similar to the pleckstrin-homology domain (PHD) fold. Rpn13's ability to bind ubiquitin and the proteasome subunit Rpn2/S1 simultaneously supports evidence of its role as a ubiquitin receptor. Finally, when complexed to di-ubiquitin, via the Pru, and Uch37 via the C-terminal part, it frees up the distal ubiquitin for de-ubiquitination by the Uch37. Length = 263 Score = 27.3 bits (61), Expect = 6.1 Identities = 22/97 (22%), Positives = 34/97 (35%), Gaps = 20/97 (20%) Query: 229 RFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIY---------GQRCTVSFF 279 + + Q S + A P P+ L D Q I Q TV Sbjct: 134 QSGSLAQPSITSAAEGSSTPAS-AANPIQLS----DALQNILANLSADGAGRQGPTVDLA 188 Query: 280 DYLRPEIK---FKD---IEKLKIYMGEDEKKARKILE 310 + L PE+ +D E+L ++ E + A +LE Sbjct: 189 EILTPELLAPLLRDEEVQERLMEHLPEGHQNAEDLLE 225 >gnl|CDD|173927 cd07766, DHQ_Fe-ADH, Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH). Dehydroquinate synthase-like. This superfamily divides into two subgroups: the dehydroquinate synthase-like, and a large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. Dehydroquinate synthase (DHQS) catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP) to dehydroquinate (DHQ) in the second step of the shikimate pathway. This pathway involves seven sequential enzymatic steps in the conversion of erythrose 4-phosphate and phosphoenolpyruvate into chorismate for subsequent synthesis of aromatic compounds. Dehydroquinate synthase-like group includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase. The alcohol dehydrogenases in this superfamily contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases; insect-type, or short-chain alcohol dehydrogenases; iron-containing alcohol dehydrogenases, and others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H. Length = 332 Score = 27.4 bits (61), Expect = 6.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 180 LNAAHLLGYRFTIESDVIHGEKIG 203 L AAH +G+ T + HGE + Sbjct: 233 LGAAHAIGHALTALEGIPHGEAVA 256 >gnl|CDD|37142 KOG1931, KOG1931, KOG1931, Putative transmembrane protein [General function prediction only]. Length = 1156 Score = 26.5 bits (58), Expect = 9.4 Identities = 11/61 (18%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Query: 259 ESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSER 318 +F+F ++ ++ + E+ + E L ++ + +LESS PL Sbjct: 292 YFTLFEFRLYLFERQTLLLLKLNRPFEVASRAYELLFSFL-----QELSLLESSVPLGAL 346 Query: 319 D 319 Sbjct: 347 K 347 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.404 Gapped Lambda K H 0.267 0.0695 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,970,324 Number of extensions: 212126 Number of successful extensions: 520 Number of sequences better than 10.0: 1 Number of HSP's gapped: 508 Number of HSP's successfully gapped: 28 Length of query: 324 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 230 Effective length of database: 4,232,491 Effective search space: 973472930 Effective search space used: 973472930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.8 bits)