HHsearch alignment for GI: 254780848 and conserved domain: KOG1641

>KOG1641 consensus.
Probab=99.94  E-value=8.1e-27  Score=169.52  Aligned_cols=100  Identities=32%  Similarity=0.553  Sum_probs=90.5

Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCEECCCCCEECCEECCCCEEEEECCCC
Q ss_conf             86523242517847999974754212255799457655465302479998238708678879022031378899705686
Q gi|254780848|r    2 VGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSG   81 (111)
Q Consensus         2 ~~~~~~~ikPl~drVLVk~~~~e~~T~~GgI~lp~~~~ek~~~~~G~VvavG~g~~~~~G~~~p~~vkvGD~Vl~~~~~g   81 (111)
T Consensus         4 ~~~~~kk~vPl~DRVLVqr~~a~~KT~-gGilLPEks~~K--~~~g~VvavGpG~~~~~G~~v~~~Vk~Gd~VLlpeygG   80 (104)
T KOG1641           4 TSWEIKKVVPLLDRVLVQRIEAPTKTA-GGILLPEKSVGK--LLQGTVVAVGPGSRDKGGEIVPVSVKVGDRVLLPEYGG   80 (104)
T ss_pred             HHHHHHHCCCCCCEEEEEEEECCCCCC-CEEEECCCCCCC--CCEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCC
T ss_conf             214365401410102456430354114-406841334465--21489999747742678879375116798788513487


Q ss_pred             CEEEECCCCEEEEEEHHHEEEEE
Q ss_conf             08897699779998530178998
Q gi|254780848|r   82 TEIKLNDGEEYLVMQESDIMGIV  104 (111)
Q Consensus        82 ~~v~~~dg~~y~i~~e~dIlavi  104 (111)
T Consensus        81 t~V~l~~~~~~~~fr~e~~l~~~  103 (104)
T KOG1641          81 TKVKLGDEDEYHLFRDEDDLLAI  103 (104)
T ss_pred             CEEECCCCCEEEEECCHHHHHHH
T ss_conf             17862677216896242454320