HHsearch results for GI: 254780848 and protein with PDBid: 1p3h_A

>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A
Probab=99.97  E-value=3.5e-31  Score=192.58  Aligned_cols=98  Identities=38%  Similarity=0.714  Sum_probs=89.2

Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCEECCC-CCEECCEECCCCEEEEECCCCCE
Q ss_conf             23242517847999974754212255799457655465302479998238708678-87902203137889970568608
Q gi|254780848|r    5 HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS-GKVIEPEVSKGDIVLFGKWSGTE   83 (111)
Q Consensus         5 ~~~~ikPl~drVLVk~~~~e~~T~~GgI~lp~~~~ek~~~~~G~VvavG~g~~~~~-G~~~p~~vkvGD~Vl~~~~~g~~   83 (111)
                      ++|+|+||||||||++.+.+++|+ |||+||+++++++  ++|+|+|||+|+++.+ +..+|++||+||+|+|++|+|++
T Consensus         1 ~k~~ikPlgdrVLVk~~~~e~kT~-gGIiLp~~~~~~~--~~G~VvavG~g~~~~~~~~~~p~~vk~GD~Vl~~~~~g~~   77 (99)
T 1p3h_A            1 AKVNIKPLEDKILVQANEAETTTA-SGLVIPDTAKEKP--QEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTE   77 (99)
T ss_dssp             CCCEEEECTTEEEEEECCCCCBCT-TSCBCCCSSCCSE--EEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEE
T ss_pred             CCCCCEECCCEEEEEECCCCCEEE-EEEEECHHHCCCC--EEEEEEEECCEEECCCCCEECCCEEECCCEEEECCCCCEE
T ss_conf             984457758999999821056441-0499880660674--5899999714078168989728878569899980548759


Q ss_pred             EEECCCCEEEEEEHHHEEEEEEC
Q ss_conf             89769977999853017899845
Q gi|254780848|r   84 IKLNDGEEYLVMQESDIMGIVVE  106 (111)
Q Consensus        84 v~~~dg~~y~i~~e~dIlavi~~  106 (111)
                      |++ ||++|++++++||||++++
T Consensus        78 v~~-~g~~y~ii~e~dIlAvi~e   99 (99)
T 1p3h_A           78 IKY-NGEEYLILSARDVLAVVSK   99 (99)
T ss_dssp             EEE-TTEEEEEEEGGGEEEEEEC
T ss_pred             EEE-CCEEEEEEEHHHEEEEEEC
T ss_conf             999-9999999997878999949