BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780848|ref|YP_003065261.1| co-chaperonin GroES
[Candidatus Liberibacter asiaticus str. psy62]
         (111 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040525|gb|ACT57321.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62]
          Length = 111

 Score =  222 bits (566), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS
Sbjct: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
           GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
Sbjct: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111


>gi|315122728|ref|YP_004063217.1| co-chaperonin GroES [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496130|gb|ADR52729.1| co-chaperonin GroES [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 107

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (85%), Gaps = 1/104 (0%)

Query: 5   HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVI 64
            K YLRP+RGRVV+RRLQSE  T +G ++IPDTVSEKPSA  GE++WVGAGV DQSGKVI
Sbjct: 3   DKRYLRPSRGRVVIRRLQSETMTESG-LIIPDTVSEKPSACGGEVVWVGAGVTDQSGKVI 61

Query: 65  EPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEK 108
           EPEV  GD+VLFGKWSGTEIKL   EEYLVMQESDI+G+VV ++
Sbjct: 62  EPEVKPGDVVLFGKWSGTEIKLGSDEEYLVMQESDIIGVVVGDR 105


>gi|90419969|ref|ZP_01227878.1| chaperonin groES [Aurantimonas manganoxydans SI85-9A1]
 gi|90336010|gb|EAS49758.1| chaperonin groES [Aurantimonas manganoxydans SI85-9A1]
          Length = 98

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+KLN GE+ L+M+ESDIMG+V
Sbjct: 63  KAGDRVLFGKWSGTEVKLN-GEDLLIMKESDIMGVV 97


>gi|13476777|ref|NP_108346.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|23813799|sp|Q983S3|CH104_RHILO RecName: Full=10 kDa chaperonin 4; AltName: Full=GroES protein 4;
           AltName: Full=Protein Cpn10 4
 gi|14027538|dbj|BAB53807.1| 10kDa chaperonin; GroES [Mesorhizobium loti MAFF303099]
          Length = 98

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/99 (59%), Positives = 75/99 (75%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D+SGK++ 
Sbjct: 3   KSKFRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDESGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+ESDIMGI+
Sbjct: 60  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKESDIMGII 97


>gi|114705803|ref|ZP_01438706.1| co-chaperonin GroES [Fulvimarina pelagi HTCC2506]
 gi|114538649|gb|EAU41770.1| co-chaperonin GroES [Fulvimarina pelagi HTCC2506]
          Length = 98

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D SGKV+  +V
Sbjct: 6   FRPLHDRVLVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEIVAVGSGARDDSGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFGKWSGTE+KLN GE+ L+M+ESDIMGIV
Sbjct: 63  KQGDRVLFGKWSGTEVKLN-GEDLLIMKESDIMGIV 97


>gi|260461327|ref|ZP_05809575.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
 gi|259032864|gb|EEW34127.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
          Length = 130

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 75/99 (75%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D++GK++ 
Sbjct: 35  KSKFRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDEAGKLVP 91

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+ESD+MGI+
Sbjct: 92  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKESDVMGII 129


>gi|260463303|ref|ZP_05811504.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
 gi|259030893|gb|EEW32168.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
          Length = 112

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 75/99 (75%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D++GK++ 
Sbjct: 17  KSKFRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDEAGKLVP 73

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+ESDIMGI+
Sbjct: 74  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKESDIMGII 111


>gi|13488366|ref|NP_085868.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|319784304|ref|YP_004143780.1| chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|23813798|sp|Q981K0|CH105_RHILO RecName: Full=10 kDa chaperonin 5; AltName: Full=GroES protein 5;
           AltName: Full=Protein Cpn10 5
 gi|14028117|dbj|BAB54709.1| chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|20804204|emb|CAD31230.1| PROBABLE CHAPERONIN PROTEIN GROES [Mesorhizobium loti R7A]
 gi|317170192|gb|ADV13730.1| Chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 98

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 75/99 (75%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D++GK++ 
Sbjct: 3   KSKFRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+ESDIMGI+
Sbjct: 60  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKESDIMGII 97


>gi|319785492|ref|YP_004144968.1| chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317171380|gb|ADV14918.1| Chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 98

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 75/99 (75%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D++GK++ 
Sbjct: 3   KSKFRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+ESD+MGI+
Sbjct: 60  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKESDVMGII 97


>gi|239833539|ref|ZP_04681867.1| chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301]
 gi|239821602|gb|EEQ93171.1| chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301]
          Length = 121

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VGAG  D++GK+I  EV
Sbjct: 29  FRPLHDRVVVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEIVAVGAGARDEAGKLIALEV 85

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+  GE+ L+M+ESDI+GIV
Sbjct: 86  KAGDKVLFGKWSGTEVKIG-GEDLLIMKESDILGIV 120


>gi|13474838|ref|NP_106408.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|23813800|sp|Q98AX8|CH103_RHILO RecName: Full=10 kDa chaperonin 3; AltName: Full=GroES protein 3;
           AltName: Full=Protein Cpn10 3
 gi|14025594|dbj|BAB52194.1| chaperonin GroES [Mesorhizobium loti MAFF303099]
          Length = 98

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 76/99 (76%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           ++ LRP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG+G  D++GK++ 
Sbjct: 3   QSNLRPLHDRVVVRRVESESKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD +LFGKWSGTE+KLN GE+ L+M+E+DIMGI+
Sbjct: 60  LDVKAGDRILFGKWSGTEVKLN-GEDLLIMKEADIMGII 97


>gi|153010350|ref|YP_001371564.1| chaperonin Cpn10 [Ochrobactrum anthropi ATCC 49188]
 gi|151562238|gb|ABS15735.1| chaperonin Cpn10 [Ochrobactrum anthropi ATCC 49188]
          Length = 121

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VGAG  D++GK+I  EV
Sbjct: 29  FRPLHDRVVVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEIVAVGAGARDEAGKLIALEV 85

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+  GE+ L+M+ESDI+GIV
Sbjct: 86  KAGDKVLFGKWSGTEVKIG-GEDLLIMKESDILGIV 120


>gi|209965872|ref|YP_002298787.1| chaperonin GroS, putative [Rhodospirillum centenum SW]
 gi|226704028|sp|B6IU97|CH10_RHOCS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|209959338|gb|ACI99974.1| chaperonin GroS, putative [Rhodospirillum centenum SW]
          Length = 103

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R++SE KTA G I+IPDT  EKP    GEI+ VG+G  D+SGK+I  +V
Sbjct: 3   FRPLHDRVVVKRVESEQKTA-GGIIIPDTAKEKPQ--EGEIIAVGSGARDESGKLIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG EYL+M+ESDIMG++
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGVEYLIMKESDIMGVL 94


>gi|218516737|ref|ZP_03513577.1| co-chaperonin GroES [Rhizobium etli 8C-3]
          Length = 107

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+E+DIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKEADIMGII 97


>gi|332188340|ref|ZP_08390066.1| chaperonin 10 Kd subunit [Sphingomonas sp. S17]
 gi|332011653|gb|EGI53732.1| chaperonin 10 Kd subunit [Sphingomonas sp. S17]
          Length = 101

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 75/104 (72%), Gaps = 4/104 (3%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV VRR+++E KTA G I+IPDT  EKP    GE++ VG G  D++GK++E  
Sbjct: 2   HFRPLHDRVAVRRIEAEEKTA-GGIIIPDTAKEKPQ--EGEVVAVGPGARDETGKLVELS 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
           V  GD VLFGKWSG+E+K+ DGEE L+M+ESDI+GIV  E  +K
Sbjct: 59  VKAGDRVLFGKWSGSEVKI-DGEELLIMKESDILGIVETEASSK 101


>gi|319899295|ref|YP_004159390.1| chaperonin, 10 kDa [Bartonella clarridgeiae 73]
 gi|319403261|emb|CBI76820.1| chaperonin, 10 kDa [Bartonella clarridgeiae 73]
          Length = 98

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG GV+D +GK I  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEIIAVGNGVLDDNGKRIPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KAGDRILFGKWSGTEVKIN-GEDLLIMKESDIMGIL 97


>gi|319782609|ref|YP_004142085.1| chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168497|gb|ADV12035.1| Chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 104

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRRL++E KT +G I+IPDT  EKP    GE++ VG G  D SGK++E +V
Sbjct: 3   FRPLHDRILVRRLEAEEKT-SGGIIIPDTAKEKPQ--EGEVLAVGPGARDDSGKLVELDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD +LFGKWSGTEIKL DGE+ L+M+ESD+MGI+ E
Sbjct: 60  KVGDRILFGKWSGTEIKL-DGEDLLIMKESDVMGIIDE 96


>gi|116250658|ref|YP_766496.1| co-chaperonin GroES [Rhizobium leguminosarum bv. viciae 3841]
 gi|209548078|ref|YP_002279995.1| co-chaperonin GroES [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|241203264|ref|YP_002974360.1| co-chaperonin GroES [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|226704027|sp|B5ZRD7|CH10_RHILW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1946290|emb|CAA73086.1| cpn10-1 [Rhizobium leguminosarum]
 gi|115255306|emb|CAK06381.1| putative 10 kda chaperonin (protein cpn10) [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|209533834|gb|ACI53769.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|240857154|gb|ACS54821.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 98

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEAKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+E+DIMGI+
Sbjct: 63  KAGDRILFGKWSGTEVKI-DGEDLLIMKEADIMGII 97


>gi|222085004|ref|YP_002543533.1| co-chaperonin GroES [Agrobacterium radiobacter K84]
 gi|221722452|gb|ACM25608.1| co-chaperonin GroES [Agrobacterium radiobacter K84]
          Length = 98

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+KLN GE+ L+M+E+DIMGI+
Sbjct: 63  KVGDRVLFGKWSGTEVKLN-GEDLLIMKEADIMGII 97


>gi|86356475|ref|YP_468367.1| co-chaperonin GroES [Rhizobium etli CFN 42]
 gi|190890536|ref|YP_001977078.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|86280577|gb|ABC89640.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
 gi|190695815|gb|ACE89900.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|327191135|gb|EGE58180.1| co-chaperonin GroES [Rhizobium etli CNPAF512]
          Length = 98

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+E+DIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKEADIMGII 97


>gi|15888026|ref|NP_353707.1| co-chaperonin GroES [Agrobacterium tumefaciens str. C58]
 gi|325292066|ref|YP_004277930.1| co-chaperonin GroES [Agrobacterium sp. H13-3]
 gi|20141228|sp|P30780|CH10_AGRT5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|15155642|gb|AAK86492.1| co-chaperonin GroES [Agrobacterium tumefaciens str. C58]
 gi|325059919|gb|ADY63610.1| co-chaperonin GroES [Agrobacterium sp. H13-3]
          Length = 98

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D++GKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEAKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDEAGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+KL DGE+ L+M+E+DIMGI+
Sbjct: 63  KVGDRVLFGKWSGTEVKL-DGEDLLIMKEADIMGII 97


>gi|148557953|ref|YP_001257247.1| co-chaperonin GroES [Brucella ovis ATCC 25840]
 gi|166233985|sp|A5VTU2|CH10_BRUO2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|148369238|gb|ABQ62110.1| chaperonin, 10 kDa [Brucella ovis ATCC 25840]
          Length = 98

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP  GRV+VRR++SE KTA G I+IPDT  EKP    GE++  GAG  D++GK++  +V
Sbjct: 6   FRPLHGRVIVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEVVAAGAGARDEAGKLVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+  GE+ L+M+ESDI+GIV
Sbjct: 63  KAGDRVLFGKWSGTEVKIG-GEDLLIMKESDILGIV 97


>gi|110632719|ref|YP_672927.1| chaperonin Cpn10 [Mesorhizobium sp. BNC1]
 gi|110283703|gb|ABG61762.1| chaperonin Cpn10 [Chelativorans sp. BNC1]
          Length = 98

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG G  D+SGK++  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKTA-GGIIIPDTAKEKPQ--EGEVIAVGPGARDESGKLVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+KLN G++ L+M+ESDIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKLN-GQDLLIMKESDIMGII 97


>gi|319409220|emb|CBI82864.1| chaperonin, 10 kDa [Bartonella schoenbuchensis R1]
          Length = 98

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEVIAVGNGALDNNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GEE L+M+ESDIMGI+
Sbjct: 63  KAGDRILFGKWSGTEVKIN-GEELLIMKESDIMGIL 97


>gi|163758404|ref|ZP_02165492.1| co-chaperonin GroES [Hoeflea phototrophica DFL-43]
 gi|162284693|gb|EDQ34976.1| co-chaperonin GroES [Hoeflea phototrophica DFL-43]
          Length = 98

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 72/99 (72%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVVRR++SE KT  G I+IPDT  EKP    GE++ VG GV D +GK++ 
Sbjct: 3   KTKFRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGTGVRDDAGKLVA 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTE+KL DGE+ L+M+ESDIMG++
Sbjct: 60  LDVKAGDRVLFGKWSGTEVKL-DGEDLLIMKESDIMGVL 97


>gi|227818755|ref|YP_002822726.1| co-chaperonin GroES [Sinorhizobium fredii NGR234]
 gi|36959009|gb|AAQ87434.1| 10 kDa chaperonin GroES [Sinorhizobium fredii NGR234]
 gi|227337754|gb|ACP21973.1| 10 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 104

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (70%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+++E KTA G I+IPDT  EKP    GE++ VG G  D  GK++E +V
Sbjct: 3   FRPLHDRILVRRIEAEEKTA-GGIIIPDTAKEKPQ--EGEVIAVGPGARDDGGKLVELDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIKLN GE+ L+M+ESD+MG++  E   K
Sbjct: 60  KAGDRILFGKWSGTEIKLN-GEDLLIMKESDVMGVIESEASAK 101


>gi|218659938|ref|ZP_03515868.1| co-chaperonin GroES [Rhizobium etli IE4771]
          Length = 93

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 1   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+E+DIMGI+
Sbjct: 58  KAGDRVLFGKWSGTEVKIN-GEDLLIMKEADIMGII 92


>gi|319406167|emb|CBI79804.1| chaperonin, 10 kDa [Bartonella sp. AR 15-3]
          Length = 98

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEIIAVGNGALDDNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKESDIMGIL 97


>gi|319404659|emb|CBI78261.1| chaperonin, 10 kDa [Bartonella rochalimae ATCC BAA-1498]
 gi|319404678|emb|CBI78280.1| chaperonin, 10 kDa [Bartonella rochalimae ATCC BAA-1498]
 gi|319407641|emb|CBI81290.1| chaperonin, 10 kDa [Bartonella sp. 1-1C]
          Length = 98

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEIIAVGNGALDDNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKESDIMGIL 97


>gi|218673795|ref|ZP_03523464.1| co-chaperonin GroES [Rhizobium etli GR56]
          Length = 96

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (74%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLFGKWSGTE+K+N GE+ L+M+E+DIMGI
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKEADIMGI 96


>gi|227820988|ref|YP_002824958.1| co-chaperonin GroES [Sinorhizobium fredii NGR234]
 gi|227339987|gb|ACP24205.1| 10 kDa chaperonin Cpn10 [Sinorhizobium fredii NGR234]
          Length = 98

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+E+DIMGI+
Sbjct: 63  KAGDRVLFGKWSGTEVKIN-GEDLLIMKEADIMGII 97


>gi|121601908|ref|YP_989431.1| co-chaperonin GroES [Bartonella bacilliformis KC583]
 gi|166233983|sp|A1UTX8|CH10_BARBK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|50404497|gb|AAT76911.1| chaperonin GroES [Bartonella bacilliformis]
 gi|120614085|gb|ABM44686.1| chaperonin GroS [Bartonella bacilliformis KC583]
          Length = 98

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG GV++ +G+ +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAQEKPQ--EGEVIAVGNGVLNDNGQRVSLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD +LFGKWSGTE+K+N GEE L+M+ESDIMGI+
Sbjct: 63  KEGDRILFGKWSGTEVKIN-GEELLIMKESDIMGIL 97


>gi|163793753|ref|ZP_02187727.1| co-chaperonin GroES [alpha proteobacterium BAL199]
 gi|159180864|gb|EDP65381.1| co-chaperonin GroES [alpha proteobacterium BAL199]
          Length = 105

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++++ KTA G I+IPDTV EKP    GEI+ VG G  D+SGK+   +V
Sbjct: 3   FRPLHDRVVVRRIEADKKTA-GGIIIPDTVKEKPQ--EGEILAVGPGARDESGKIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGVL 94


>gi|49474598|ref|YP_032640.1| co-chaperonin GroES [Bartonella quintana str. Toulouse]
 gi|81695996|sp|Q6FYU9|CH10_BARQU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|49240102|emb|CAF26543.1| Chaperonin protein groES [Bartonella quintana str. Toulouse]
          Length = 98

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GEI+ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEIIAVGNGALDDNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KTGDRILFGKWSGTEVKIN-GEDLLIMKESDIMGIL 97


>gi|15964546|ref|NP_384899.1| co-chaperonin GroES [Sinorhizobium meliloti 1021]
 gi|307314736|ref|ZP_07594332.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
 gi|307322962|ref|ZP_07602235.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|543987|sp|P35473|CH101_RHIME RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|152234|gb|AAA26284.1| groES [Sinorhizobium meliloti]
 gi|643067|gb|AAA61954.1| GroES [Sinorhizobium meliloti]
 gi|1946293|emb|CAA73088.1| cpn10-2 [Rhizobium leguminosarum]
 gi|15073724|emb|CAC45365.1| 10 KD chaperonin A [Sinorhizobium meliloti 1021]
 gi|306891393|gb|EFN22306.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|306898960|gb|EFN29606.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
          Length = 98

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+E+DIMG++
Sbjct: 63  KAGDRILFGKWSGTEVKIN-GEDLLIMKEADIMGVI 97


>gi|49476035|ref|YP_034076.1| co-chaperonin GroES [Bartonella henselae str. Houston-1]
 gi|49203112|emb|CAG44446.1| heat shock protein [Bartonella henselae str. Houston-1]
 gi|49238843|emb|CAF28127.1| Chaperonin protein groES [Bartonella henselae str. Houston-1]
 gi|183179296|gb|ACC44139.1| GroES [Bartonella clarridgeiae]
          Length = 98

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEVIAVGNGALDDNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KTGDRILFGKWSGTEVKIN-GEDLLIMKESDIMGIL 97


>gi|254719933|ref|ZP_05181744.1| co-chaperonin GroES [Brucella sp. 83/13]
 gi|265984940|ref|ZP_06097675.1| chaperonin [Brucella sp. 83/13]
 gi|306838521|ref|ZP_07471359.1| co-chaperonin GroES [Brucella sp. NF 2653]
 gi|264663532|gb|EEZ33793.1| chaperonin [Brucella sp. 83/13]
 gi|306406388|gb|EFM62629.1| co-chaperonin GroES [Brucella sp. NF 2653]
          Length = 98

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++  GAG  D++GK++  +V
Sbjct: 6   FRPLHDRVVVRRIESEAKTA-GGIIIPDTAKEKPQ--EGEVVAAGAGARDEAGKLVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+  GE+ L+M+ESDI+GIV
Sbjct: 63  KAGDRVLFGKWSGTEVKIG-GEDLLIMKESDILGIV 97


>gi|254503816|ref|ZP_05115967.1| chaperonin GroS [Labrenzia alexandrii DFL-11]
 gi|307941715|ref|ZP_07657070.1| chaperonin GroS [Roseibium sp. TrichSKD4]
 gi|222439887|gb|EEE46566.1| chaperonin GroS [Labrenzia alexandrii DFL-11]
 gi|307775323|gb|EFO34529.1| chaperonin GroS [Roseibium sp. TrichSKD4]
          Length = 95

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+ SE KTA G I+IPDT  EKP    GEI+ VG G  D SG V+  +V
Sbjct: 3   FRPLHDRVVVRRVDSEEKTA-GGIIIPDTAKEKPQ--EGEIVAVGNGARDDSGNVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGVI 94


>gi|288957186|ref|YP_003447527.1| chaperonin GroES [Azospirillum sp. B510]
 gi|288909494|dbj|BAI70983.1| chaperonin GroES [Azospirillum sp. B510]
          Length = 96

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+RL+S+ KT  G I+IPDT  EKP    GE++ VG G  D+SGKV+  +V
Sbjct: 3   FRPLHDRVVVKRLESDTKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDESGKVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ +GE++L+M+ESDIMG++
Sbjct: 60  KAGDRILFGKWSGTEVKI-EGEDFLIMKESDIMGVI 94


>gi|150378065|ref|YP_001314660.1| co-chaperonin GroES [Sinorhizobium medicae WSM419]
 gi|150395634|ref|YP_001326101.1| co-chaperonin GroES [Sinorhizobium medicae WSM419]
 gi|150027149|gb|ABR59266.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419]
 gi|150032612|gb|ABR64727.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419]
          Length = 98

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+E+DIMG++
Sbjct: 63  KAGDRILFGKWSGTEVKI-DGEDLLIMKEADIMGVI 97


>gi|163869041|ref|YP_001610272.1| co-chaperonin GroES [Bartonella tribocorum CIP 105476]
 gi|240851181|ref|YP_002972584.1| co-chaperonin GroES [Bartonella grahamii as4aup]
 gi|189044093|sp|A9IY12|CH10_BART1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|161018719|emb|CAK02277.1| chaperonin, 10 kDa [Bartonella tribocorum CIP 105476]
 gi|240268304|gb|ACS51892.1| co-chaperonin GroES [Bartonella grahamii as4aup]
          Length = 98

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG G +D +GK +  EV
Sbjct: 6   FRPLHDRVVVRRVESENKTA-GGIIIPDTAKEKPQ--EGEVIAVGNGALDDNGKRVPLEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDIMGI+
Sbjct: 63  KTGDRILFGKWSGTEVKIN-GEDLLIMKESDIMGIM 97


>gi|260466932|ref|ZP_05813115.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
 gi|259029328|gb|EEW30621.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
          Length = 112

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 76/108 (70%), Gaps = 4/108 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E++   RP   R++VRR+ +E KTA G I+IPDT  EKP    GE++ VG G  D  GK+
Sbjct: 6   ENEMAFRPLHDRILVRRIDAEEKTA-GGIIIPDTAKEKPQ--EGEVLAVGPGARDDGGKL 62

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
           +E +V  GD +LFGKWSGTEI+L DG++ LVM+ESD+MG++ E  + K
Sbjct: 63  VELDVKVGDRILFGKWSGTEIRL-DGQDLLVMKESDVMGVIEEAAQIK 109


>gi|17989392|ref|NP_542025.1| co-chaperonin GroES [Brucella melitensis bv. 1 str. 16M]
 gi|23499957|ref|NP_699397.1| co-chaperonin GroES [Brucella suis 1330]
 gi|62317143|ref|YP_222996.1| co-chaperonin GroES [Brucella abortus bv. 1 str. 9-941]
 gi|83269128|ref|YP_418419.1| co-chaperonin GroES [Brucella melitensis biovar Abortus 2308]
 gi|161620275|ref|YP_001594161.1| co-chaperonin GroES [Brucella canis ATCC 23365]
 gi|163844384|ref|YP_001622039.1| co-chaperonin GroES [Brucella suis ATCC 23445]
 gi|189022404|ref|YP_001932145.1| co-chaperonin GroES [Brucella abortus S19]
 gi|225628659|ref|ZP_03786693.1| chaperonin [Brucella ceti str. Cudo]
 gi|225686051|ref|YP_002734023.1| co-chaperonin GroES [Brucella melitensis ATCC 23457]
 gi|237816704|ref|ZP_04595696.1| chaperonin Cpn10 [Brucella abortus str. 2308 A]
 gi|254691371|ref|ZP_05154625.1| co-chaperonin GroES [Brucella abortus bv. 6 str. 870]
 gi|254695329|ref|ZP_05157157.1| co-chaperonin GroES [Brucella abortus bv. 3 str. Tulya]
 gi|254698425|ref|ZP_05160253.1| co-chaperonin GroES [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699489|ref|ZP_05161317.1| co-chaperonin GroES [Brucella suis bv. 5 str. 513]
 gi|254702613|ref|ZP_05164441.1| co-chaperonin GroES [Brucella suis bv. 3 str. 686]
 gi|254706255|ref|ZP_05168083.1| co-chaperonin GroES [Brucella pinnipedialis M163/99/10]
 gi|254711450|ref|ZP_05173261.1| co-chaperonin GroES [Brucella pinnipedialis B2/94]
 gi|254712053|ref|ZP_05173864.1| co-chaperonin GroES [Brucella ceti M644/93/1]
 gi|254715122|ref|ZP_05176933.1| co-chaperonin GroES [Brucella ceti M13/05/1]
 gi|254731872|ref|ZP_05190450.1| co-chaperonin GroES [Brucella abortus bv. 4 str. 292]
 gi|256014982|ref|YP_003104991.1| co-chaperonin GroES [Brucella microti CCM 4915]
 gi|256029919|ref|ZP_05443533.1| co-chaperonin GroES [Brucella pinnipedialis M292/94/1]
 gi|256043116|ref|ZP_05446059.1| co-chaperonin GroES [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059569|ref|ZP_05449768.1| co-chaperonin GroES [Brucella neotomae 5K33]
 gi|256111900|ref|ZP_05452856.1| co-chaperonin GroES [Brucella melitensis bv. 3 str. Ether]
 gi|256158088|ref|ZP_05456006.1| co-chaperonin GroES [Brucella ceti M490/95/1]
 gi|256252957|ref|ZP_05458493.1| co-chaperonin GroES [Brucella ceti B1/94]
 gi|256256556|ref|ZP_05462092.1| co-chaperonin GroES [Brucella abortus bv. 9 str. C68]
 gi|256262826|ref|ZP_05465358.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260166979|ref|ZP_05753790.1| co-chaperonin GroES [Brucella sp. F5/99]
 gi|260544379|ref|ZP_05820200.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260564340|ref|ZP_05834825.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568479|ref|ZP_05838948.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260756984|ref|ZP_05869332.1| co-chaperonin groES protein [Brucella abortus bv. 6 str. 870]
 gi|260759642|ref|ZP_05871990.1| co-chaperonin groES protein [Brucella abortus bv. 4 str. 292]
 gi|260762885|ref|ZP_05875217.1| groES protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882795|ref|ZP_05894409.1| chaperonin [Brucella abortus bv. 9 str. C68]
 gi|261215699|ref|ZP_05929980.1| groES protein [Brucella abortus bv. 3 str. Tulya]
 gi|261216830|ref|ZP_05931111.1| chaperonin [Brucella ceti M13/05/1]
 gi|261220049|ref|ZP_05934330.1| chaperonin [Brucella ceti B1/94]
 gi|261313700|ref|ZP_05952897.1| chaperonin [Brucella pinnipedialis M163/99/10]
 gi|261319058|ref|ZP_05958255.1| chaperonin [Brucella pinnipedialis B2/94]
 gi|261319697|ref|ZP_05958894.1| chaperonin [Brucella ceti M644/93/1]
 gi|261323537|ref|ZP_05962734.1| chaperonin [Brucella neotomae 5K33]
 gi|261749943|ref|ZP_05993652.1| chaperonin [Brucella suis bv. 5 str. 513]
 gi|261753196|ref|ZP_05996905.1| chaperonin [Brucella suis bv. 3 str. 686]
 gi|261756365|ref|ZP_06000074.1| predicted protein [Brucella sp. F5/99]
 gi|265986938|ref|ZP_06099495.1| chaperonin [Brucella pinnipedialis M292/94/1]
 gi|265989548|ref|ZP_06102105.1| chaperonin [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993349|ref|ZP_06105906.1| chaperonin [Brucella melitensis bv. 3 str. Ether]
 gi|265996603|ref|ZP_06109160.1| chaperonin [Brucella ceti M490/95/1]
 gi|294853213|ref|ZP_06793885.1| chaperonin GroS [Brucella sp. NVSL 07-0026]
 gi|297249913|ref|ZP_06933614.1| chaperonin GroS [Brucella abortus bv. 5 str. B3196]
 gi|306840974|ref|ZP_07473715.1| co-chaperonin GroES [Brucella sp. BO2]
 gi|306845513|ref|ZP_07478082.1| co-chaperonin GroES [Brucella sp. BO1]
 gi|61220908|sp|P0A342|CH10_BRUME RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|61220910|sp|P0A343|CH10_BRUSU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123727283|sp|Q2YIJ2|CH10_BRUA2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189044094|sp|A9MDV2|CH10_BRUC2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189044095|sp|A9WXQ1|CH10_BRUSI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701731|sp|B2SCZ5|CH10_BRUA1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813830|sp|C0RKD6|CH10_BRUMB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|259585874|sp|P0CB34|CH10_BRUAB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|144107|gb|AAA22994.1| heat shock protein [Brucella abortus]
 gi|144110|gb|AAA22996.1| GroES [Brucella abortus]
 gi|17985266|gb|AAL54289.1| 10 kDa chaperonin groES [Brucella melitensis bv. 1 str. 16M]
 gi|23463537|gb|AAN33402.1| chaperonin, 10 kDa [Brucella suis 1330]
 gi|62197336|gb|AAX75635.1| GroES [Brucella abortus bv. 1 str. 9-941]
 gi|82939402|emb|CAJ12356.1| Chaperonin Cpn10 [Brucella melitensis biovar Abortus 2308]
 gi|161337086|gb|ABX63390.1| 10 kDa chaperonin [Brucella canis ATCC 23365]
 gi|163675107|gb|ABY39217.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189020978|gb|ACD73699.1| Chaperonin Cpn10 [Brucella abortus S19]
 gi|225616505|gb|EEH13553.1| chaperonin [Brucella ceti str. Cudo]
 gi|225642156|gb|ACO02069.1| chaperonin Cpn10 [Brucella melitensis ATCC 23457]
 gi|237787517|gb|EEP61733.1| chaperonin Cpn10 [Brucella abortus str. 2308 A]
 gi|255997642|gb|ACU49329.1| co-chaperonin GroES [Brucella microti CCM 4915]
 gi|260097650|gb|EEW81524.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260151983|gb|EEW87076.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155144|gb|EEW90225.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260669960|gb|EEX56900.1| co-chaperonin groES protein [Brucella abortus bv. 4 str. 292]
 gi|260673306|gb|EEX60127.1| groES protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677092|gb|EEX63913.1| co-chaperonin groES protein [Brucella abortus bv. 6 str. 870]
 gi|260872323|gb|EEX79392.1| chaperonin [Brucella abortus bv. 9 str. C68]
 gi|260917306|gb|EEX84167.1| groES protein [Brucella abortus bv. 3 str. Tulya]
 gi|260918633|gb|EEX85286.1| chaperonin [Brucella ceti B1/94]
 gi|260921919|gb|EEX88487.1| chaperonin [Brucella ceti M13/05/1]
 gi|261292387|gb|EEX95883.1| chaperonin [Brucella ceti M644/93/1]
 gi|261298281|gb|EEY01778.1| chaperonin [Brucella pinnipedialis B2/94]
 gi|261299517|gb|EEY03014.1| chaperonin [Brucella neotomae 5K33]
 gi|261302726|gb|EEY06223.1| chaperonin [Brucella pinnipedialis M163/99/10]
 gi|261736349|gb|EEY24345.1| predicted protein [Brucella sp. F5/99]
 gi|261739696|gb|EEY27622.1| chaperonin [Brucella suis bv. 5 str. 513]
 gi|261742949|gb|EEY30875.1| chaperonin [Brucella suis bv. 3 str. 686]
 gi|262550900|gb|EEZ07061.1| chaperonin [Brucella ceti M490/95/1]
 gi|262764219|gb|EEZ10251.1| chaperonin [Brucella melitensis bv. 3 str. Ether]
 gi|263000217|gb|EEZ12907.1| chaperonin [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092648|gb|EEZ16869.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264659135|gb|EEZ29396.1| chaperonin [Brucella pinnipedialis M292/94/1]
 gi|294818868|gb|EFG35868.1| chaperonin GroS [Brucella sp. NVSL 07-0026]
 gi|297173782|gb|EFH33146.1| chaperonin GroS [Brucella abortus bv. 5 str. B3196]
 gi|306273834|gb|EFM55661.1| co-chaperonin GroES [Brucella sp. BO1]
 gi|306289031|gb|EFM60296.1| co-chaperonin GroES [Brucella sp. BO2]
 gi|326410376|gb|ADZ67440.1| co-chaperonin GroES [Brucella melitensis M28]
 gi|326553669|gb|ADZ88308.1| co-chaperonin GroES [Brucella melitensis M5-90]
          Length = 98

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++  GAG  D++GK++  +V
Sbjct: 6   FRPLHDRVVVRRVESEAKTA-GGIIIPDTAKEKPQ--EGEVVAAGAGARDEAGKLVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+  GE+ L+M+ESDI+GIV
Sbjct: 63  KAGDRVLFGKWSGTEVKIG-GEDLLIMKESDILGIV 97


>gi|148256590|ref|YP_001241175.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1]
 gi|146408763|gb|ABQ37269.1| 10kDa chaperonin (protein Cpn10) (groES protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 104

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (71%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GE++ VG G  D+SGK++  +V
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEVIAVGPGARDESGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +    K
Sbjct: 60  QVGDRVLFGKWSGTEVKI-DGQELLIMKESDIMGVLTDTASKK 101


>gi|148261487|ref|YP_001235614.1| chaperonin Cpn10 [Acidiphilium cryptum JF-5]
 gi|326404971|ref|YP_004285053.1| 10 kDa chaperonin [Acidiphilium multivorum AIU301]
 gi|189081994|sp|A5G1G3|CH10_ACICJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|146403168|gb|ABQ31695.1| chaperonin Cpn10 [Acidiphilium cryptum JF-5]
 gi|325051833|dbj|BAJ82171.1| 10 kDa chaperonin [Acidiphilium multivorum AIU301]
          Length = 104

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL +E KTA G I+IPDT  EKP    GE++ VG G  +++G V+  +V
Sbjct: 3   FRPLHDRVVVRRLNAEEKTA-GGIIIPDTAKEKPM--EGEVIAVGPGARNEAGAVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGEE L+M+ESDIMGI+
Sbjct: 60  KAGDRILFGKWSGTEVKI-DGEELLIMKESDIMGII 94


>gi|16262849|ref|NP_435642.1| co-chaperonin GroES [Sinorhizobium meliloti 1021]
 gi|20137877|sp|Q92ZQ3|CH104_RHIME RecName: Full=10 kDa chaperonin 4; AltName: Full=GroES protein 4;
           AltName: Full=Protein Cpn10 4
 gi|14523486|gb|AAK65054.1| groES2 chaperonin [Sinorhizobium meliloti 1021]
          Length = 98

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G ++IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGVIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+E+DIMG++
Sbjct: 63  KAGDRILFGKWSGTEVKIN-GEDLLIMKEADIMGVI 97


>gi|307315739|ref|ZP_07595257.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
 gi|306898602|gb|EFN29271.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
          Length = 98

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G ++IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGVIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+E+DIMG++
Sbjct: 63  KAGDRILFGKWSGTEVKIN-GEDLLIMKEADIMGVI 97


>gi|304393171|ref|ZP_07375099.1| chaperonin GroS [Ahrensia sp. R2A130]
 gi|303294178|gb|EFL88550.1| chaperonin GroS [Ahrensia sp. R2A130]
          Length = 98

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 73/99 (73%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVVRR++++ KTA G I+IPD   EKP+   GEI+ VG+G  D++GK++ 
Sbjct: 3   KTKFRPLHDRVVVRRVEADTKTA-GGIIIPDAAQEKPA--EGEIVSVGSGARDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTE+K+  GE+ L+M+ESDIMGI+
Sbjct: 60  LDVKAGDRVLFGKWSGTEVKIG-GEDLLIMKESDIMGII 97


>gi|146342933|ref|YP_001207981.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278]
 gi|148253203|ref|YP_001237788.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1]
 gi|146195739|emb|CAL79766.1| 10kDa chaperonin (Protein Cpn10) (groES protein) [Bradyrhizobium
           sp. ORS278]
 gi|146405376|gb|ABQ33882.1| 10kDa chaperonin (protein Cpn10) (groES protein) [Bradyrhizobium
           sp. BTAi1]
          Length = 98

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 73/99 (73%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVV+R+ +E KT  G I+IPD+  EKPS   GE++ VG G  D+SGK+I 
Sbjct: 3   KSKFRPLHDRVVVKRIDAEEKT-KGGIIIPDSAKEKPS--QGEVVAVGPGGRDESGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTE+KL DGEE L+M+ESDIMG+V
Sbjct: 60  IDVKVGDRVLFGKWSGTEVKL-DGEELLIMKESDIMGVV 97


>gi|146339891|ref|YP_001204939.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278]
 gi|146192697|emb|CAL76702.1| 10kDa chaperonin (Protein Cpn10) (groES protein) [Bradyrhizobium
           sp. ORS278]
          Length = 104

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (71%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GE++ VG G  D+SGK++  +V
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEVIAVGPGARDESGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +    K
Sbjct: 60  QVGDRVLFGKWSGTEVKI-DGQELLIMKESDIMGVLTDAGAKK 101


>gi|13472183|ref|NP_103750.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|23813802|sp|Q98II0|CH102_RHILO RecName: Full=10 kDa chaperonin 2; AltName: Full=GroES protein 2;
           AltName: Full=Protein Cpn10 2
 gi|14022928|dbj|BAB49536.1| heat shock protein GroES [Mesorhizobium loti MAFF303099]
          Length = 104

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+++E KTA G I+IPDT  EKP    GE++ +G G  D+SGK+   +V
Sbjct: 3   FRPLHDRILVRRIEAEEKTA-GGIIIPDTAKEKPQ--EGEVIAIGPGARDESGKLTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIKLN GE+ L+M+ESD+MG++
Sbjct: 60  KAGDRILFGKWSGTEIKLN-GEDLLIMKESDVMGVI 94


>gi|163850180|ref|YP_001638223.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
 gi|163661785|gb|ABY29152.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
          Length = 95

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++ E KT  G I+IPDTV EKP    GE++ VG G  D++G++  P+V
Sbjct: 3   FRPLHDRVVVRRIEGEEKT-KGGIIIPDTVKEKPQ--EGEVIAVGPGARDEAGRINAPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG+V
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVV 94


>gi|85373659|ref|YP_457721.1| co-chaperonin GroES [Erythrobacter litoralis HTCC2594]
 gi|84786742|gb|ABC62924.1| heat shock protein groES [Erythrobacter litoralis HTCC2594]
          Length = 104

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 72/97 (74%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV+VRR+++E KT TG I+IPDT  EKP    GE++ VG G  D +GK++E  
Sbjct: 2   HFRPLHDRVLVRRIEAEEKT-TGGIIIPDTAKEKPM--EGEVVAVGPGARDDAGKLVELA 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD +LFGKWSGTE+++ DGE+ L+M+ESDI+GI+
Sbjct: 59  VKAGDRILFGKWSGTEVRI-DGEDLLIMKESDILGII 94


>gi|90424662|ref|YP_533032.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB18]
 gi|90106676|gb|ABD88713.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB18]
          Length = 105

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (75%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GEI+ VG G  D+SGK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEILSVGPGGRDESGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD VLFGKWSGTE+KL DG+E L+M+ESDIMG++ +
Sbjct: 60  AVGDRVLFGKWSGTEVKL-DGQEVLIMKESDIMGVLTD 96


>gi|154245113|ref|YP_001416071.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2]
 gi|154159198|gb|ABS66414.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2]
          Length = 96

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+++E KTA G I+IPDT  EKP    GE++ VGAG  D++GK++  +V
Sbjct: 3   FRPLHDRVVVKRIEAEQKTA-GGIIIPDTAKEKPQ--EGEVIAVGAGARDEAGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDI+G++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDILGVI 94


>gi|294085463|ref|YP_003552223.1| chaperonin Cpn10 [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665038|gb|ADE40139.1| chaperonin Cpn10 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 95

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R++SE KTA G I+IPDT  EKP    G+++  GAG  D++GKV   +V
Sbjct: 3   FRPLHDRVVVQRIESEEKTA-GGIIIPDTAKEKPM--EGKVIAAGAGARDETGKVQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++YL+M+ESDIMG++
Sbjct: 60  KAGDSVLFGKWSGTEVKI-DGQDYLIMKESDIMGVI 94


>gi|258542858|ref|YP_003188291.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-01]
 gi|256633936|dbj|BAH99911.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-01]
 gi|256636995|dbj|BAI02964.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-03]
 gi|256640048|dbj|BAI06010.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-07]
 gi|256643104|dbj|BAI09059.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-22]
 gi|256646159|dbj|BAI12107.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-26]
 gi|256649212|dbj|BAI15153.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-32]
 gi|256652199|dbj|BAI18133.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655256|dbj|BAI21183.1| heat shock protein GroES [Acetobacter pasteurianus IFO 3283-12]
          Length = 123

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL+ E KTA G I+IPDT  EKP    GE++ VG G  ++ G+++  +V
Sbjct: 30  FRPLHDRVVVRRLEGEQKTA-GGIIIPDTAQEKPM--EGEVVAVGPGARNEQGQIVALDV 86

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMG+V
Sbjct: 87  KAGDRVLFGKWSGTEVKI-DGEELLIMKESDIMGVV 121


>gi|307322721|ref|ZP_07602045.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|306891639|gb|EFN22501.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
          Length = 98

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D+SGKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSG+E+K+ DGE+ L+M+E+DIMG++
Sbjct: 63  KAGDRILFGKWSGSEVKI-DGEDLLIMKEADIMGVI 97


>gi|29839340|sp|Q8GBD3|CH10_ACEP3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|23096061|dbj|BAC16231.1| groES [Acetobacter aceti]
          Length = 97

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL+ E KTA G I+IPDT  EKP    GE++ VG G  ++ G+++  +V
Sbjct: 4   FRPLHDRVVVRRLEGEQKTA-GGIIIPDTAQEKPM--EGEVVAVGPGARNEQGQIVALDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMG+V
Sbjct: 61  KAGDRVLFGKWSGTEVKI-DGEELLIMKESDIMGVV 95


>gi|209884643|ref|YP_002288500.1| chaperonin GroS [Oligotropha carboxidovorans OM5]
 gi|209872839|gb|ACI92635.1| chaperonin GroS [Oligotropha carboxidovorans OM5]
          Length = 104

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (75%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEILSVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GDIVLFGKWSGTE+K+ DG++ L+M+ESDI+G++ +
Sbjct: 60  KVGDIVLFGKWSGTEVKI-DGQDLLIMKESDILGVLTD 96


>gi|39094|emb|CAA48330.1| groES [Agrobacterium tumefaciens str. C58]
          Length = 98

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG+G  D++GKV+  +V
Sbjct: 6   FRPLHDRVVVRRVESEAKT-KGGIIIPDTAKEKPQ--EGEIVAVGSGARDEAGKVVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+WSGTE+KL DGE+  +M+E+DIMGI+
Sbjct: 63  KVGDRVLFGQWSGTEVKL-DGEDSSIMKEADIMGII 97


>gi|329114549|ref|ZP_08243308.1| 10 kDa chaperonin [Acetobacter pomorum DM001]
 gi|326696029|gb|EGE47711.1| 10 kDa chaperonin [Acetobacter pomorum DM001]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL+ E KTA G I+IPDT  EKP    GE++ VG G  ++ G+++  +V
Sbjct: 30  FRPLHDRVVVRRLEGEQKTA-GGIIIPDTAQEKPM--EGEVVAVGPGARNEQGQIVALDV 86

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMG+V
Sbjct: 87  KAGDRVLFGKWSGTEVKI-DGEELLIMKESDIMGVV 121


>gi|39935234|ref|NP_947510.1| co-chaperonin GroES [Rhodopseudomonas palustris CGA009]
 gi|192290842|ref|YP_001991447.1| co-chaperonin GroES [Rhodopseudomonas palustris TIE-1]
 gi|42558896|sp|P60367|CH102_RHOPA RecName: Full=10 kDa chaperonin 2; AltName: Full=GroES protein 2;
           AltName: Full=Protein Cpn10 2
 gi|39649085|emb|CAE27606.1| chaperonin GroES2, cpn10 [Rhodopseudomonas palustris CGA009]
 gi|192284591|gb|ACF00972.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1]
          Length = 104

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEIVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGKELLIMKESDIMGVITD 96


>gi|114328845|ref|YP_746002.1| co-chaperonin GroES [Granulibacter bethesdensis CGDNIH1]
 gi|114317019|gb|ABI63079.1| 10 kDa chaperonin GROES [Granulibacter bethesdensis CGDNIH1]
          Length = 101

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL +E KT +G I+IPDT  EKP    GEI+ VGAG  ++ G++   +V
Sbjct: 9   FRPLHDRVVVRRLNAEEKT-SGGIIIPDTAKEKPM--EGEIVAVGAGARNEQGQIQPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMGI+
Sbjct: 66  KAGDRVLFGKWSGTEVKI-DGEELLIMKESDIMGII 100


>gi|296447221|ref|ZP_06889151.1| Chaperonin Cpn10 [Methylosinus trichosporium OB3b]
 gi|296255280|gb|EFH02377.1| Chaperonin Cpn10 [Methylosinus trichosporium OB3b]
          Length = 118

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 74/102 (72%), Gaps = 4/102 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E     RP   RVVV+RL+ E KT  G I+IPDT  EKP+   G+++ VG G  D+SGK+
Sbjct: 21  EDDMAFRPLHDRVVVKRLEGEDKT-KGGIIIPDTAKEKPA--EGKVIAVGPGSRDESGKL 77

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           +  +V +GD VLFGKWSGTE+K+ DGE+ L+M+ESDI+G++V
Sbjct: 78  VALDVKEGDRVLFGKWSGTEVKI-DGEDLLIMKESDILGVIV 118


>gi|27382089|ref|NP_773618.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110]
 gi|543988|sp|P35863|CH102_BRAJA RecName: Full=10 kDa chaperonin 2; AltName: Full=GroES protein 2;
           AltName: Full=Protein Cpn10 2
 gi|312978|emb|CAA80317.1| GroES2 [Bradyrhizobium japonicum]
 gi|27355259|dbj|BAC52243.1| chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 104

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDTV EKPS   GE++ VG G  D+SGK+I  +V
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTVKEKPS--QGEVIAVGPGGRDESGKLIPIDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ D +E L+M+ESDIMG++ +
Sbjct: 60  RVGDRVLFGKWSGTEVKI-DTQELLIMKESDIMGVLAD 96


>gi|85709558|ref|ZP_01040623.1| co-chaperonin GroES [Erythrobacter sp. NAP1]
 gi|85688268|gb|EAQ28272.1| co-chaperonin GroES [Erythrobacter sp. NAP1]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++++ KTA G I+IPD+  EKPS   GEI+ VG G  D +G  +  +V
Sbjct: 3   FRPLHDRVVVRRIEADTKTA-GGIIIPDSAQEKPS--EGEIVSVGEGARDDAGNRVAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDIMGI+
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGII 94


>gi|316934680|ref|YP_004109662.1| chaperonin Cpn10 [Rhodopseudomonas palustris DX-1]
 gi|315602394|gb|ADU44929.1| Chaperonin Cpn10 [Rhodopseudomonas palustris DX-1]
          Length = 104

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (71%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GE++ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEVVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +    K
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGKELLIMKESDIMGVITDAGAKK 101


>gi|170743665|ref|YP_001772320.1| chaperonin Cpn10 [Methylobacterium sp. 4-46]
 gi|168197939|gb|ACA19886.1| chaperonin Cpn10 [Methylobacterium sp. 4-46]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+++E KT  G I+IPDT  EKP    GE++ VG G  D+SGKV   +V
Sbjct: 3   FRPLHDRVVVRRIEAEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDESGKVAPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTE++L DG++ L+M+ESDIMG++ 
Sbjct: 60  KAGDRVLFGKWSGTEVRL-DGQDLLIMKESDIMGVLA 95


>gi|92116747|ref|YP_576476.1| co-chaperonin GroES [Nitrobacter hamburgensis X14]
 gi|91799641|gb|ABE62016.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14]
          Length = 105

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDTV EKPS   GEI  VG G  D++G +I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEDKTA-GGIIIPDTVKEKPS--QGEITAVGPGGRDEAGNLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+KL DG++ L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKL-DGQDLLIMKESDIMGVLTD 96


>gi|85714224|ref|ZP_01045212.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A]
 gi|85698671|gb|EAQ36540.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A]
          Length = 98

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPDT  EKPS   GE++ VG G  D++GK+  
Sbjct: 3   KTKFRPLHDRVVVKRIDAEEKTK-GGIIIPDTAKEKPS--QGEVVAVGPGGRDETGKLTP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTEIKL DG+E L+M+ESDIMG+V
Sbjct: 60  IDVKVGDKVLFGKWSGTEIKL-DGQELLIMKESDIMGVV 97


>gi|220920708|ref|YP_002496009.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
 gi|219945314|gb|ACL55706.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
          Length = 95

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG G  D++GK++  +V
Sbjct: 3   FRPLHDRVVVRRIESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGPGARDETGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVL 94


>gi|158422049|ref|YP_001523341.1| chaperonin [Azorhizobium caulinodans ORS 571]
 gi|158328938|dbj|BAF86423.1| chaperonin [Azorhizobium caulinodans ORS 571]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+++E KTA G I+IPDT  EKP    GE++ VG G  D++GKV+  +V
Sbjct: 3   FRPLHDRVVVKRIEAEQKTA-GGIIIPDTAKEKPQ--EGEVVAVGPGARDENGKVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDI+G++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDILGVI 94


>gi|170740039|ref|YP_001768694.1| chaperonin Cpn10 [Methylobacterium sp. 4-46]
 gi|168194313|gb|ACA16260.1| chaperonin Cpn10 [Methylobacterium sp. 4-46]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG G  D++GKV   +V
Sbjct: 3   FRPLHDRVVVRRIESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGPGARDETGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVL 94


>gi|92118106|ref|YP_577835.1| co-chaperonin GroES [Nitrobacter hamburgensis X14]
 gi|91801000|gb|ABE63375.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14]
          Length = 105

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (76%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E K+A G I+IPDTV EKPS   GEI+ VG G  D++GK+I  +V
Sbjct: 3   FRPLHDRVVVKRIDAEEKSA-GGIIIPDTVKEKPS--QGEIVAVGPGGRDEAGKLIPIDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG++ +
Sbjct: 60  NVGDKVLFGKWSGTEVKI-DGQDLLIMKESDIMGVLTD 96


>gi|298290626|ref|YP_003692565.1| chaperonin Cpn10 [Starkeya novella DSM 506]
 gi|296927137|gb|ADH87946.1| Chaperonin Cpn10 [Starkeya novella DSM 506]
          Length = 98

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 73/99 (73%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   R+VV+RL +E KTA G I+IPD+  EKPS   GE++ VG G  D++GK++ 
Sbjct: 3   KLKFRPLHDRIVVKRLDAEEKTA-GGIIIPDSAKEKPS--QGEVVAVGPGGRDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTE+K+ DG++ L+M+ESD+MGIV
Sbjct: 60  LDVKAGDKVLFGKWSGTEVKI-DGQDLLIMKESDVMGIV 97


>gi|58040331|ref|YP_192295.1| co-chaperonin GroES [Gluconobacter oxydans 621H]
 gi|58002745|gb|AAW61639.1| Chaperonin GroES [Gluconobacter oxydans 621H]
          Length = 100

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL  E KTA G I+IPDT  +KP+   GE++ VG G  ++ G+V+  +V
Sbjct: 8   FRPLHDRVVVRRLTGEEKTA-GGIIIPDTAKDKPT--EGEVVSVGPGARNEQGQVVALDV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMG++
Sbjct: 65  KAGDKVLFGKWSGTEVKI-DGEELLIMKESDIMGVI 99


>gi|86748960|ref|YP_485456.1| co-chaperonin GroES [Rhodopseudomonas palustris HaA2]
 gi|86571988|gb|ABD06545.1| Chaperonin Cpn10 [Rhodopseudomonas palustris HaA2]
          Length = 98

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD+  EKP    GE++ VG G  D++GK+I 
Sbjct: 3   KLNFRPLHDRVVVKRIDAETKT-KGGIIIPDSAKEKPQ--EGEVVAVGPGGRDEAGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTEIKL DG+E L+M+ESDIMG+V
Sbjct: 60  IDVKAGDRVLFGKWSGTEIKL-DGQELLIMKESDIMGVV 97


>gi|77539352|dbj|BAE46548.1| GroES [Gluconobacter oxydans]
          Length = 96

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL  E KTA G I+IPDT  +KP+   GE++ VG G  ++ G+V+  +V
Sbjct: 4   FRPLHDRVVVRRLTGEEKTA-GGIIIPDTAKDKPT--EGEVVSVGPGARNEQGQVVALDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGEE L+M+ESDIMG++
Sbjct: 61  KAGDKVLFGKWSGTEVKI-DGEELLIMKESDIMGVI 95


>gi|227818821|ref|YP_002822792.1| 10 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
 gi|36959079|gb|AAQ87504.1| 10 kDa chaperonin GroES [Sinorhizobium fredii NGR234]
 gi|227337820|gb|ACP22039.1| 10 kDa chaperonin 2 [Sinorhizobium fredii NGR234]
          Length = 104

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+++E KTA G I+IPDT  EKP    GE++  G G  D SG++  P+V
Sbjct: 3   FRPLHDRILVRRIEAEEKTA-GGIIIPDTAKEKPQ--EGEVVATGPGARDDSGQLRPPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D +LFGKWSGTEIKL DGE+ L+M+ESD+MG++
Sbjct: 60  KVADRILFGKWSGTEIKL-DGEDLLIMKESDVMGVI 94


>gi|118590678|ref|ZP_01548079.1| co-chaperonin GroES [Stappia aggregata IAM 12614]
 gi|118436654|gb|EAV43294.1| co-chaperonin GroES [Stappia aggregata IAM 12614]
          Length = 95

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+ SE KTA G I+IPDT  EKP    GEI+ +G G    +G+++  +V
Sbjct: 3   FRPLHDRVVVRRVDSEAKTA-GGIIIPDTAKEKPQ--EGEIIAIGTGARKDNGEIVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGVI 94


>gi|75676300|ref|YP_318721.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255]
 gi|74421170|gb|ABA05369.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255]
          Length = 104

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RVVVRR+ +E KT TG I+IPDT  EKP    GEI+  G G  ++ G+++  +
Sbjct: 2   HFRPLHDRVVVRRIDAEEKT-TGGIIIPDTAKEKPQ--EGEIVAAGPGARNEKGELVPLD 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD +LFGKWSGTE+K+ DGEE L+M+ESDI+G+V
Sbjct: 59  VKAGDHILFGKWSGTEVKI-DGEELLIMKESDILGVV 94


>gi|86750344|ref|YP_486840.1| co-chaperonin GroES [Rhodopseudomonas palustris HaA2]
 gi|86573372|gb|ABD07929.1| Chaperonin Cpn10 [Rhodopseudomonas palustris HaA2]
          Length = 105

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEIVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGKELLIMKESDIMGVITD 96


>gi|296115121|ref|ZP_06833762.1| heat shock protein GroES [Gluconacetobacter hansenii ATCC 23769]
 gi|295978222|gb|EFG84959.1| heat shock protein GroES [Gluconacetobacter hansenii ATCC 23769]
          Length = 96

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL+ E KTA G I+IP+T  EKP    GE++ VGAG  ++ G+++  +V
Sbjct: 4   FRPLHDRVVVRRLKGEEKTA-GGIIIPETAKEKPM--EGEVISVGAGARNEQGQIVALDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DGEE L+M+ESDIMG+V
Sbjct: 61  KAGDRVLFGKWSGTEVTI-DGEELLIMKESDIMGVV 95


>gi|27377171|ref|NP_768700.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110]
 gi|543989|sp|P35864|CH103_BRAJA RecName: Full=10 kDa chaperonin 3; AltName: Full=GroES protein 3;
           AltName: Full=Protein Cpn10 3
 gi|12620754|gb|AAG61030.1|AF322013_149 GroES3 [Bradyrhizobium japonicum]
 gi|312975|emb|CAA80315.1| GroES3 [Bradyrhizobium japonicum]
 gi|27350314|dbj|BAC47325.1| GroES3 chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 104

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GE++ VG G  D SGK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEVIAVGPGGHDDSGKLIPIDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ DG++ L+M+ESD+MG++ +
Sbjct: 60  EVGDRVLFGKWSGTEVKI-DGQDLLIMKESDVMGVLTD 96


>gi|158423935|ref|YP_001525227.1| heat shock protein [Azorhizobium caulinodans ORS 571]
 gi|158330824|dbj|BAF88309.1| heat shock protein [Azorhizobium caulinodans ORS 571]
          Length = 104

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+++E KTA G I+IPDT  EKP    GE++ VGAGV ++ G+++  +V
Sbjct: 3   FRPLHDRVVVKRIEAEQKTA-GGIIIPDTAKEKPQ--EGEVVAVGAGVRNEKGELVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDI+G+V
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDILGVV 94


>gi|91976705|ref|YP_569364.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB5]
 gi|91683161|gb|ABE39463.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB5]
          Length = 105

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEIVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ DG+E L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGKELLIMKESDIMGVITD 96


>gi|298292071|ref|YP_003694010.1| chaperonin Cpn10 [Starkeya novella DSM 506]
 gi|296928582|gb|ADH89391.1| Chaperonin Cpn10 [Starkeya novella DSM 506]
          Length = 104

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E K+A G I+IPD+  EKPS   GE++ VG G  D++GK++  +V
Sbjct: 3   FRPLHDRVVVKRIDAEEKSA-GGIIIPDSAKEKPS--QGEVVAVGPGARDEAGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG +YL+M+E+DI+G++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGTDYLIMKEADILGVL 94


>gi|300024053|ref|YP_003756664.1| chaperonin Cpn10 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525874|gb|ADJ24343.1| Chaperonin Cpn10 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 104

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R++ E KTA G I+IPDT  EKP    GEI+ VG G  D++GKV   +V
Sbjct: 3   FRPLHDRVVVKRIEEEAKTA-GGIIIPDTAKEKPQ--QGEIVAVGPGARDEAGKVNALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSG+E+K+ DGE+ L+M+ESDI+GI+
Sbjct: 60  KVGDRVLFGKWSGSEVKI-DGEDLLIMKESDILGIL 94


>gi|110635425|ref|YP_675633.1| chaperonin Cpn10 [Mesorhizobium sp. BNC1]
 gi|110286409|gb|ABG64468.1| chaperonin Cpn10 [Chelativorans sp. BNC1]
          Length = 104

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 75/103 (72%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+++E KTA G ++IPDT  EKP    GE++ VG GV D+ G++I  EV
Sbjct: 3   FRPLHDRLLVRRIEAEEKTA-GGVIIPDTAKEKPQ--EGEVLAVGPGVRDEKGELIALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEI+L  GE+ L+M+ESD++GI+ +E + K
Sbjct: 60  KVGDRILFGKWSGTEIRLQ-GEDLLIMKESDVLGILDKEAEVK 101


>gi|209886383|ref|YP_002290240.1| chaperonin GroS [Oligotropha carboxidovorans OM5]
 gi|209874579|gb|ACI94375.1| chaperonin GroS [Oligotropha carboxidovorans OM5]
          Length = 98

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 72/99 (72%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+RL +E KT  G I+IPDT  EKPS   G+++ VG G  D++GK+I 
Sbjct: 3   KTTFRPLHDRVVVKRLDAEEKTK-GGIIIPDTAKEKPS--EGKVVAVGPGGRDETGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  GD VLFGKWSGTE+KL DGE+ L+M+ESDIMG++
Sbjct: 60  IDLKVGDRVLFGKWSGTEVKL-DGEDLLIMKESDIMGVL 97


>gi|90426196|ref|YP_534566.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB18]
 gi|90108210|gb|ABD90247.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB18]
          Length = 98

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD+  EKP    G+++ VG G  D++GK+I 
Sbjct: 3   KTNFRPLHDRVVVKRIDAESKT-KGGIIIPDSAKEKPQ--EGQVVAVGPGGRDEAGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  GD VLFGKWSGTEIKL DGEE L+M+ESDIMG++
Sbjct: 60  IDIKTGDRVLFGKWSGTEIKL-DGEELLIMKESDIMGVL 97


>gi|328545071|ref|YP_004305180.1| 10 kDa chaperonin [polymorphum gilvum SL003B-26A1]
 gi|326414813|gb|ADZ71876.1| 10 kDa chaperonin [Polymorphum gilvum SL003B-26A1]
          Length = 95

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+ SE KTA G I+IPDT  EKP    GE++ VG G   ++G +I  +V
Sbjct: 3   FRPLHDRVVVRRVNSEEKTA-GGIIIPDTAKEKPQ--EGEVVAVGPGARKENGDLIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GE+ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKIN-GEDLLIMKESDIMGVI 94


>gi|92118661|ref|YP_578390.1| co-chaperonin GroES [Nitrobacter hamburgensis X14]
 gi|91801555|gb|ABE63930.1| chaperonin Cpn10 [Nitrobacter hamburgensis X14]
          Length = 98

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPDT  EKPS   GE++ VG G  D++GK++ 
Sbjct: 3   KTKFRPLHDRVVVKRIDAEEKT-KGGIIIPDTAREKPS--QGEVIAVGPGGRDEAGKLVP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  GD VLFGKWSGTEIKL DG++ L+M+ESDIMG++
Sbjct: 60  IDIKVGDKVLFGKWSGTEIKL-DGQDVLIMKESDIMGVL 97


>gi|91978587|ref|YP_571246.1| co-chaperonin GroES [Rhodopseudomonas palustris BisB5]
 gi|91685043|gb|ABE41345.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisB5]
          Length = 98

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ ++ KT  G I+IPD+  EKP    G+++ VG G  D++GK+I 
Sbjct: 3   KLNFRPLHDRVVVKRIDADTKT-KGGIIIPDSAKEKPQ--EGQVVAVGPGGRDEAGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTEIKL DGEE L+M+ESDIMG+V
Sbjct: 60  IDVKAGDRVLFGKWSGTEIKL-DGEELLIMKESDIMGVV 97


>gi|162147834|ref|YP_001602295.1| co-chaperonin GroES [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542455|ref|YP_002274684.1| co-chaperonin GroES [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786411|emb|CAP55993.1| 10 kDa chaperonin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530132|gb|ACI50069.1| chaperonin Cpn10 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL  E KTA G I+IPDT  EKP    GE++  G G  ++ G+++  +V
Sbjct: 4   FRPLHDRVVVRRLTGEEKTA-GGIIIPDTAKEKPM--EGEVISAGPGARNEQGQIVALDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+N GEE L+M+ESDIMG++
Sbjct: 61  KAGDKVLFGKWSGTEVKIN-GEELLIMKESDIMGVI 95


>gi|115522887|ref|YP_779798.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53]
 gi|115516834|gb|ABJ04818.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53]
          Length = 98

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 4/100 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RV+V+R+ +E KT  G I+IPD+  EKPS   GEI+ VG G  D++GK++ 
Sbjct: 3   KTNFRPLHDRVLVKRVDAETKT-KGGIIIPDSAKEKPS--QGEIVAVGPGGRDEAGKLLP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            ++  GD VLFGKWSGTEIKL DG+E L+M+ESDIMG++ 
Sbjct: 60  IDLKVGDRVLFGKWSGTEIKL-DGQELLIMKESDIMGVLA 98


>gi|75676757|ref|YP_319178.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255]
 gi|74421627|gb|ABA05826.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255]
          Length = 98

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD+  EKPS   GE++ VG G  D++GK+  
Sbjct: 3   KTKFRPLHDRVVVKRIDAEEKTK-GGIIIPDSAKEKPS--QGEVVAVGPGGRDETGKLTP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  GD VLFGKWSGTEIKL DG+E L+M+ESDIMG+V
Sbjct: 60  VDIKVGDKVLFGKWSGTEIKL-DGQELLIMKESDIMGVV 97


>gi|170746969|ref|YP_001753229.1| chaperonin Cpn10 [Methylobacterium radiotolerans JCM 2831]
 gi|226704013|sp|B1LVA1|CH10_METRJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|170653491|gb|ACB22546.1| chaperonin Cpn10 [Methylobacterium radiotolerans JCM 2831]
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GE++ VG G  D+ G+V   +V
Sbjct: 3   FRPLHDRVVVRRIESEEKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARDEQGRVNALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG+V
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVV 94


>gi|27380337|ref|NP_771866.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110]
 gi|27353501|dbj|BAC50491.1| heat shock protein [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV+VRR+ +E KTA G I+IPDT  EKP    GEI+  G+G  ++ G++I  +
Sbjct: 4   HFRPLHDRVLVRRIDAEEKTA-GGIIIPDTAKEKPQ--EGEIIAAGSGGRNEQGQLIPID 60

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGKWSGTE+K+ DG++YL+M+ESD++G+V
Sbjct: 61  VKPGDRVLFGKWSGTEVKI-DGQDYLIMKESDLLGVV 96


>gi|2493652|sp|P77828|CH101_BRAJA RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|1613781|gb|AAC44752.1| heat shock protein GroES1 [Bradyrhizobium japonicum]
          Length = 104

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV+VRR+ +E KTA G I+IPDT  EKP    GEI+  G+G  ++ G++I  +
Sbjct: 2   HFRPLHDRVLVRRIDAEEKTA-GGIIIPDTAKEKPQ--EGEIIAAGSGGRNEQGQLIPID 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGKWSGTE+K+ DG++YL+M+ESD++G+V
Sbjct: 59  VKPGDRVLFGKWSGTEVKI-DGQDYLIMKESDLLGVV 94


>gi|188584509|ref|YP_001927954.1| co-chaperonin GroES [Methylobacterium populi BJ001]
 gi|226704012|sp|B1ZAU6|CH10_METPB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|179348007|gb|ACB83419.1| chaperonin Cpn10 [Methylobacterium populi BJ001]
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG G  D+ G+V   +V
Sbjct: 3   FRPLHDRVVVRRIESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGPGARDEQGRVNALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG+V
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVV 94


>gi|294677999|ref|YP_003578614.1| chaperonin GroS [Rhodobacter capsulatus SB 1003]
 gi|2493657|sp|P95677|CH10_RHOCA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1699435|gb|AAB37531.1| Cpn10 [Rhodobacter capsulatus]
 gi|294476819|gb|ADE86207.1| chaperonin GroS [Rhodobacter capsulatus SB 1003]
          Length = 95

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V+R+QSE KT  G ++IPDT  EKP+   GE++ VGAG    SG++I P V
Sbjct: 3   FKPLHDRVLVKRVQSEEKT-KGGLIIPDTAKEKPA--EGEVVAVGAGARKDSGELIAPAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD +LFGKWSGTE+ L DG E L+M+ESDIMGI+
Sbjct: 60  AVGDRILFGKWSGTEVTL-DGVEMLIMKESDIMGII 94


>gi|296532319|ref|ZP_06895057.1| chaperone GroES [Roseomonas cervicalis ATCC 49957]
 gi|296267343|gb|EFH13230.1| chaperone GroES [Roseomonas cervicalis ATCC 49957]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E     RP   RVVVRRL +E KTA G I+IPDT  EKP    GEI+ VG+G  ++ G V
Sbjct: 8   ERAMKFRPLHDRVVVRRLTAEEKTA-GGIIIPDTAKEKPM--EGEIVAVGSGARNEQGVV 64

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  +V  GD VLFGKWSGTE+K++ GEE L+M+ESD+MG++
Sbjct: 65  VALDVKVGDRVLFGKWSGTEVKIS-GEELLIMKESDLMGVI 104


>gi|323135630|ref|ZP_08070713.1| Chaperonin Cpn10 [Methylocystis sp. ATCC 49242]
 gi|322398721|gb|EFY01240.1| Chaperonin Cpn10 [Methylocystis sp. ATCC 49242]
          Length = 95

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+RL+ E KT  G I+IPDT  EKP    G+++ VG G  D+SGK++  +V
Sbjct: 3   FRPLHDRVVVKRLEGEEKT-KGGIIIPDTAKEKPQ--EGKVISVGPGARDESGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDI+GIV
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDILGIV 94


>gi|319782424|ref|YP_004141900.1| chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168312|gb|ADV11850.1| Chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 120

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR + +IK+  G I+IPDT  EKP    GE++ VG G  D++G ++  +V
Sbjct: 3   FRPLHDRVVIRRAEGDIKS-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDENGALVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+E+DIMG++
Sbjct: 60  KAGDFILFGKWSGTEVKI-DGEDLLIMKEADIMGVI 94


>gi|299135339|ref|ZP_07028530.1| Chaperonin Cpn10 [Afipia sp. 1NLS2]
 gi|298590316|gb|EFI50520.1| Chaperonin Cpn10 [Afipia sp. 1NLS2]
          Length = 104

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (70%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KT  G I+IPD   EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKT-KGGIIIPDNAKEKPS--QGEIVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD+VLFGKWSGTE+K+ DG++ L+M+ESDIMG++ +    K
Sbjct: 60  KVGDVVLFGKWSGTEVKI-DGQDVLIMKESDIMGVITDAGSKK 101


>gi|220914717|ref|YP_002490025.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
 gi|219952468|gb|ACL62858.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
          Length = 95

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+++E KT  G I+IPDT  EKP    GEI+ VG G  D++GK++  +V
Sbjct: 3   FRPLHDRVVVRRIEAEEKTK-GGIIIPDTAKEKPQ--EGEIVAVGPGARDETGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+++ DG++ L+M+ESDIMG++
Sbjct: 60  KTGDRVLFGKWSGTEVRI-DGQDLLIMKESDIMGVL 94


>gi|163854179|ref|YP_001642222.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
 gi|218533124|ref|YP_002423940.1| co-chaperonin GroES [Methylobacterium chloromethanicum CM4]
 gi|240141639|ref|YP_002966119.1| 10 kDa chaperonin (protein Cpn10, groES protein) [Methylobacterium
           extorquens AM1]
 gi|254564147|ref|YP_003071242.1| 10 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|163665784|gb|ABY33151.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
 gi|218525427|gb|ACK86012.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4]
 gi|240011616|gb|ACS42842.1| 10 kDa chaperonin (protein Cpn10, groES protein) [Methylobacterium
           extorquens AM1]
 gi|254271425|emb|CAX27439.1| 10 kDa chaperonin (protein Cpn10, groES protein) [Methylobacterium
           extorquens DM4]
          Length = 96

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KT  G I+IPDT  EKP    GEI+ VG G  D+ G+V   +V
Sbjct: 3   FRPLHDRVVVRRIESEEKT-KGGIIIPDTAKEKPQ--EGEIVAVGPGARDEQGRVNALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG+V
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVV 94


>gi|119387311|ref|YP_918345.1| co-chaperonin GroES [Paracoccus denitrificans PD1222]
 gi|119377886|gb|ABL72649.1| chaperonin Cpn10 [Paracoccus denitrificans PD1222]
          Length = 95

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+QS+ KT  G ++IPD+  EKP+   GEI+ VG G    SG++I P V
Sbjct: 3   FRPLHDRVLVRRVQSDEKT-KGGLIIPDSAKEKPA--EGEIIAVGEGARKDSGELIAPAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTE+ + DGEE L+M+ESDI+GI+ 
Sbjct: 60  KAGDRVLFGKWSGTEVTV-DGEELLIMKESDILGIIA 95


>gi|83591925|ref|YP_425677.1| chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170]
 gi|83574839|gb|ABC21390.1| Chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+RL+ E KTA G I+IPDT  EKP    GE++ VG+G     GKV+  +V
Sbjct: 3   FRPLHDRVLVKRLEGEEKTA-GGIIIPDTAKEKPM--EGEVVAVGSGARGDDGKVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG ++L+M+ESDIMGIV
Sbjct: 60  KAGDRILFGKWSGTEVKI-DGTDFLIMKESDIMGIV 94


>gi|144898662|emb|CAM75526.1| Chaperonin Cpn10 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+RL +E KTA G I+IPDT  EKP    GE++ VG+GV  + GK++  +V
Sbjct: 3   FRPLHDRVLVKRLDAEEKTA-GGIIIPDTAKEKPM--QGEVIAVGSGVRGEDGKIVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+ESDI+GI+
Sbjct: 60  KAGDRILFGKWSGTEVKI-DGEDLLIMKESDILGIL 94


>gi|85715614|ref|ZP_01046594.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A]
 gi|85697553|gb|EAQ35430.1| co-chaperonin GroES [Nitrobacter sp. Nb-311A]
          Length = 105

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GE++ VG G  D+SGK++  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEVVAVGPGGRDESGKLLPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ DG++ L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGQDLLIMKESDIMGVLTD 96


>gi|182678710|ref|YP_001832856.1| co-chaperonin GroES [Beijerinckia indica subsp. indica ATCC 9039]
 gi|226701727|sp|B2ICU3|CH10_BEII9 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|182634593|gb|ACB95367.1| chaperonin Cpn10 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+RL+SE KT  G I+IPD+  EKP    GEI+ VG G  D+SGK+I  +V
Sbjct: 3   FRPLHDRVVVKRLESEEKT-KGGIIIPDSAKEKPQ--EGEIIAVGPGGRDESGKLIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG++ L+M+ESDI+G+V
Sbjct: 60  KAGDKILFGKWSGTEVKI-DGQDLLIMKESDILGVV 94


>gi|149185485|ref|ZP_01863801.1| 10 kDa chaperonin, GroES [Erythrobacter sp. SD-21]
 gi|148830705|gb|EDL49140.1| 10 kDa chaperonin, GroES [Erythrobacter sp. SD-21]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKPS   GEI+ VG+G   + G V   +V
Sbjct: 3   FRPLHDRVLVRRIEAEEKTA-GGIIIPDSAKEKPS--EGEIVAVGSGSKAEDGTVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEIKL DGE+ L+M+ESDIMGI+
Sbjct: 60  KAGDRVLFGKWSGTEIKL-DGEDLLIMKESDIMGIM 94


>gi|103487559|ref|YP_617120.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256]
 gi|98977636|gb|ABF53787.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256]
          Length = 104

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RVVVRR+++E K+ +G I+IPDT  EKP    GE++ VG G   + G V  P+
Sbjct: 2   HFRPLHDRVVVRRIEAEEKS-SGGIIIPDTAKEKPQ--EGEVVAVGPGARAEDGTVTAPD 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGKWSGTE+++ DGE+ L+M+ESDI+G++
Sbjct: 59  VRVGDRVLFGKWSGTEVRI-DGEDLLIMKESDILGVI 94


>gi|222082176|ref|YP_002541541.1| co-chaperonin GroES [Agrobacterium radiobacter K84]
 gi|221726855|gb|ACM29944.1| chaperonin [Agrobacterium radiobacter K84]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR + ++K+  G I+IPDT  EKP    GE++ VG G+ ++ G +I  +V
Sbjct: 3   FRPLHDRVVIRRAEGDLKS-KGGIIIPDTAKEKPQ--EGEVIAVGPGIRNEGGALIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+ DGEE L+M+E+DIMGIV
Sbjct: 60  KTGDTILFGKWSGTEIKI-DGEELLIMKEADIMGIV 94


>gi|254473680|ref|ZP_05087076.1| chaperonin GroS [Pseudovibrio sp. JE062]
 gi|211957392|gb|EEA92596.1| chaperonin GroS [Pseudovibrio sp. JE062]
          Length = 95

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++SE KTA G I+IPDT  EKP    GE++ VG G    +G++I  ++
Sbjct: 3   FRPLHDRVVVRRIESEEKTA-GGIIIPDTAKEKPQ--EGEVVAVGPGARKDNGELIAIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGVL 94


>gi|312115564|ref|YP_004013160.1| chaperonin Cpn10 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220693|gb|ADP72061.1| Chaperonin Cpn10 [Rhodomicrobium vannielii ATCC 17100]
          Length = 109

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRRL+ E +T  G I+IPDT  EKP    GE++ VG G  ++ GK++  +V
Sbjct: 5   FRPLHDRVVVRRLEEEERT-KGGIIIPDTAKEKPQ--QGEVIAVGPGARNEEGKLVALDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFGKWSGTE+K+ DGE+ L+M+ESDI+GI+
Sbjct: 62  KEGDRVLFGKWSGTEVKI-DGEDLLIMKESDILGIL 96


>gi|116249308|ref|YP_765149.1| putative 10 kDa chaperonin [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253958|emb|CAK12353.1| putative 10 kDa chaperonin [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 104

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  +++G+++  +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNEAGQILALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+
Sbjct: 60  KPGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGII 94


>gi|27382643|ref|NP_774172.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110]
 gi|27355815|dbj|BAC52797.1| 10 KD chaperonin (protein CPN10) [Bradyrhizobium japonicum USDA
           110]
          Length = 98

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K+  RP   RVVV+R+ +E KT  G I+IPDT  EKPS   GE++ VG G  D++GK+I 
Sbjct: 3   KSKFRPLHDRVVVKRIDAEEKT-KGGIIIPDTAKEKPS--QGEVVAVGPGGRDETGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  GD VLFGKWSGTE+K+ D EE L+M+ESDIMG++
Sbjct: 60  IDLKVGDRVLFGKWSGTEVKI-DNEELLIMKESDIMGVM 97


>gi|222102160|ref|YP_002546750.1| heat shock protein groES [Agrobacterium radiobacter K84]
 gi|221728277|gb|ACM31286.1| heat shock protein groES [Agrobacterium radiobacter K84]
          Length = 95

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RRL+SE KT  G I+IPDT  EKP    G ++ VG G+ D+SGK+   +V
Sbjct: 3   FRPLHDRVVIRRLESEEKT-RGGIIIPDTAKEKPQ--EGAVVAVGPGLRDESGKLAPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEIK+ DGE+ L+++E+DI+G+V
Sbjct: 60  KAGDRVLFGKWSGTEIKI-DGEDLLIVKEADILGVV 94


>gi|170743559|ref|YP_001772214.1| co-chaperonin GroES [Methylobacterium sp. 4-46]
 gi|168197833|gb|ACA19780.1| chaperonin Cpn10 [Methylobacterium sp. 4-46]
          Length = 104

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RVVVRR+ +E KT  G I+IPDT  EKP    GE++ VG G  D++GK++  +V
Sbjct: 3   FQPLHDRVVVRRIDAEEKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARDEAGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTE+++ DG++ L+M+ESDI+GI+V
Sbjct: 60  KAGDRVLFGKWSGTEVRI-DGQDLLIMKESDILGILV 95


>gi|190890942|ref|YP_001977484.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190696221|gb|ACE90306.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|327191347|gb|EGE58376.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CNPAF512]
          Length = 104

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  D +G+V   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDDAGQVQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGII 94


>gi|239834972|ref|ZP_04683300.1| chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301]
 gi|239823035|gb|EEQ94604.1| chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301]
          Length = 129

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 72/103 (69%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 28  FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQALDV 84

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 85  KAGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGIIETQAEQK 126


>gi|283856581|ref|YP_163663.2| co-chaperonin GroES [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775590|gb|AAV90552.2| chaperonin Cpn10 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 121

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 72/102 (70%), Gaps = 5/102 (4%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
           GE  N+ RP   RV+VRR+ +E KTA G I+IPDT  EKP    GE++  G G   + GK
Sbjct: 24  GEDMNF-RPLHDRVLVRRVAAEEKTA-GGIIIPDTAKEKPQ--EGEVIAAGNGTHSEDGK 79

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+  +V  GD VLFGKWSGTE+++ DGE+ L+M+ESDI+GI+
Sbjct: 80  VVPLDVKAGDRVLFGKWSGTEVRV-DGEDLLIMKESDILGII 120


>gi|75676376|ref|YP_318797.1| co-chaperonin GroES [Nitrobacter winogradskyi Nb-255]
 gi|74421246|gb|ABA05445.1| chaperonin Cpn10 [Nitrobacter winogradskyi Nb-255]
          Length = 105

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GE++ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEVVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ +G++ L+M+ESDIMG++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-EGQDLLIMKESDIMGVLTD 96


>gi|39934216|ref|NP_946492.1| co-chaperonin GroES [Rhodopseudomonas palustris CGA009]
 gi|192289742|ref|YP_001990347.1| co-chaperonin GroES [Rhodopseudomonas palustris TIE-1]
 gi|42558895|sp|P60366|CH101_RHOPA RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|39648064|emb|CAE26584.1| chaperonin GroES1, cpn10 [Rhodopseudomonas palustris CGA009]
 gi|192283491|gb|ACE99871.1| chaperonin Cpn10 [Rhodopseudomonas palustris TIE-1]
          Length = 98

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 70/99 (70%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD+  EKP    G+++ VG G  D++GK+  
Sbjct: 3   KINFRPLHDRVVVKRIDAETKTK-GGIIIPDSAKEKPQ--EGQVIAVGPGGRDETGKLTP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTEIKL DGEE L+M+ESDIMG+V
Sbjct: 60  IDVKVGDRVLFGKWSGTEIKL-DGEELLIMKESDIMGVV 97


>gi|218461505|ref|ZP_03501596.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli Kim 5]
          Length = 104

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  D +G+V   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDDAGQVQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGIIEAQSEGK 101


>gi|310815424|ref|YP_003963388.1| groES protein [Ketogulonicigenium vulgare Y25]
 gi|308754159|gb|ADO42088.1| groES protein [Ketogulonicigenium vulgare Y25]
          Length = 95

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RVVVRR+QSE KT  G ++IPD+  EKP+   GE++ VG G    SG++I P V
Sbjct: 3   FKPLHDRVVVRRVQSEEKT-KGGLIIPDSAKEKPA--EGEVVAVGEGARKDSGELIAPSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEI + +GEE L+M+ESDI+GI+
Sbjct: 60  KTGDRVLFGKWSGTEITV-EGEELLIMKESDILGII 94


>gi|316932685|ref|YP_004107667.1| chaperonin Cpn10 [Rhodopseudomonas palustris DX-1]
 gi|315600399|gb|ADU42934.1| Chaperonin Cpn10 [Rhodopseudomonas palustris DX-1]
          Length = 98

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 70/99 (70%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD+  EKP    G+++ VG G  D++GK+  
Sbjct: 3   KLNFRPLHDRVVVKRIDAETKTK-GGIIIPDSAKEKPQ--EGQVVAVGPGGRDETGKLTP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLFGKWSGTEIKL DGEE L+M+ESDIMG+V
Sbjct: 60  IDVKVGDRVLFGKWSGTEIKL-DGEELLIMKESDIMGVV 97


>gi|325168509|ref|YP_004280299.1| 10 kDa chaperonin, heat shock protein [Agrobacterium sp. H13-3]
 gi|325064232|gb|ADY67921.1| 10 kDa chaperonin, heat shock protein [Agrobacterium sp. H13-3]
          Length = 104

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (69%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG+G  +  G+V   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGSGARNDVGQVQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 60  KAGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGIIEAQAEQK 101


>gi|260462986|ref|ZP_05811189.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
 gi|259031107|gb|EEW32380.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075]
          Length = 111

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR + +IK+  G I+IPDT  EKP    GE++ +G G  D++G ++  +V
Sbjct: 3   FRPLHDRVVIRRAEGDIKS-KGGIIIPDTAKEKPQ--EGEVVAIGPGARDENGALVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++LFGKWSGTE+K+ DGE+ L+M+E+DIMG++
Sbjct: 60  KAGDLILFGKWSGTEVKI-DGEDLLIMKEADIMGVI 94


>gi|163795485|ref|ZP_02189451.1| chaperonin Cpn10 [alpha proteobacterium BAL199]
 gi|159179084|gb|EDP63617.1| chaperonin Cpn10 [alpha proteobacterium BAL199]
          Length = 95

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+  ++SE KTA G I+IPD   EKPS   G+++ VG G  D++GKV + +V
Sbjct: 3   FRPLHDRVVIEPIESETKTA-GGIIIPDNAKEKPS--QGKVLAVGPGARDEAGKVHKLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VL+GKWSGTE+KL DG+  ++M+ESD+MGIV
Sbjct: 60  KKGDTVLYGKWSGTEVKL-DGKTVMIMRESDLMGIV 94


>gi|218458912|ref|ZP_03499003.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli Kim 5]
          Length = 104

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  D +G+V   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARDDAGQVQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGII 94


>gi|148254000|ref|YP_001238585.1| chaperone Hsp10, part of GroE chaperone system [Bradyrhizobium sp.
           BTAi1]
 gi|146406173|gb|ABQ34679.1| chaperone Hsp10, part of GroE chaperone system [Bradyrhizobium sp.
           BTAi1]
          Length = 95

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR++   KT  G I+IPDT  EKP    GE++ VG+G  D++G+++  +V
Sbjct: 3   FRPLHDRVVIRRIEESAKT-KGGIIIPDTAKEKPQ--EGEVIAVGSGARDEAGRLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLFGKWSGTE+K+N GE+ L+++E+DI+G++
Sbjct: 60  KKGDRVLFGKWSGTEVKIN-GEDLLIVKEADILGVI 94


>gi|103485946|ref|YP_615507.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256]
 gi|98976023|gb|ABF52174.1| chaperonin Cpn10 [Sphingopyxis alaskensis RB2256]
          Length = 95

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPDT  EKP    GE++ VG G     GKV   +V
Sbjct: 3   FRPLHDRVLVRRIEAEEKTA-GGIIIPDTAKEKPQ--EGEVVSVGTGARADDGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGEE L+M+ESDI+G++
Sbjct: 60  KAGDRILFGKWSGTEVKV-DGEELLIMKESDILGVI 94


>gi|220921760|ref|YP_002497061.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
 gi|219946366|gb|ACL56758.1| chaperonin Cpn10 [Methylobacterium nodulans ORS 2060]
          Length = 95

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RVVVRR+++E KT  G I+IPDT  EKP    GEI+ VG G  D++GK++  +V
Sbjct: 3   FQPLHDRVVVRRIEAEEKTK-GGIIIPDTAKEKPQ--EGEIVAVGPGARDETGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+++ DG++ L+M+ESDIMG++
Sbjct: 60  KTGDRVLFGKWSGTEVRI-DGQDLLIMKESDIMGVL 94


>gi|154248185|ref|YP_001419143.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2]
 gi|154162270|gb|ABS69486.1| chaperonin Cpn10 [Xanthobacter autotrophicus Py2]
          Length = 104

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+++E KTA G I+IPD+  EKP    GE++ VG G  ++ G+++  +V
Sbjct: 3   FRPLHDRVVVKRIEAEQKTA-GGIIIPDSAKEKPQ--QGEVVSVGPGARNEKGELVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGKWSGTE+K+ DG++ L+M+ESDI+G++
Sbjct: 60  KAGDLVLFGKWSGTEVKI-DGQDLLIMKESDILGVL 94


>gi|115524295|ref|YP_781206.1| co-chaperonin GroES [Rhodopseudomonas palustris BisA53]
 gi|115518242|gb|ABJ06226.1| chaperonin Cpn10 [Rhodopseudomonas palustris BisA53]
          Length = 104

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPD+  EKPS   GEI+ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDSAKEKPS--QGEIVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+K+ D +E L+M+ESDI+G++ +
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DSQELLIMKESDILGVITD 96


>gi|254562512|ref|YP_003069607.1| 10 kDa chaperonin [Methylobacterium extorquens DM4]
 gi|254269790|emb|CAX25763.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Methylobacterium
           extorquens DM4]
          Length = 96

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV++RR++S+ +T  G I+IPDT  EKP    GE++ VG G  D  G+V  P+V
Sbjct: 3   FRPLHDRVLLRRIESDERT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARDDQGRVAAPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEIK+ DG++ L+++ESDI+G++
Sbjct: 60  KTGDRVLFGKWSGTEIKV-DGQDLLILKESDILGVI 94


>gi|6831504|sp|Q9Z463|CH10_PARDE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|4115771|dbj|BAA36515.1| chaperonin 10 [Paracoccus denitrificans]
          Length = 95

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 68/97 (70%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR+QS+ KT  G ++IPD+  EKP+   GEI  VG G    SG++I P V
Sbjct: 3   FKPLHDRVLVRRVQSDEKT-KGGLIIPDSAKEKPA--EGEITSVGEGARKDSGELIAPAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTE+ + DGEE L+M+ESDI+GI+ 
Sbjct: 60  KAGDRVLFGKWSGTEVTV-DGEELLIMKESDILGIIA 95


>gi|85375708|ref|YP_459770.1| 10 kDa chaperonin, GroES [Erythrobacter litoralis HTCC2594]
 gi|84788791|gb|ABC64973.1| 10 kDa chaperonin, GroES [Erythrobacter litoralis HTCC2594]
          Length = 95

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKPS   GEI+ VG+G   + G V   +V
Sbjct: 3   FRPLHDRVLVRRIEAEEKTA-GGIIIPDSAKEKPS--EGEIVSVGSGAKAEDGTVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DGEE L+M+ESDIMG++
Sbjct: 60  KAGDRVLFGKWSGTEVTV-DGEELLIMKESDIMGVI 94


>gi|16262518|ref|NP_435311.1| co-chaperonin GroES [Sinorhizobium meliloti 1021]
 gi|307300738|ref|ZP_07580513.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
 gi|307319149|ref|ZP_07598579.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|20143871|sp|Q930X9|CH103_RHIME RecName: Full=10 kDa chaperonin 3; AltName: Full=GroES protein 3;
           AltName: Full=Protein Cpn10 3
 gi|14523125|gb|AAK64723.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021]
 gi|306895256|gb|EFN26012.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|306904272|gb|EFN34857.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
          Length = 105

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR +   ++  G I+IPDT  EKP    GE++ VG G  D+SGK+I  +V
Sbjct: 3   FRPLLDRVVIRRAEGNTQS-KGGIIIPDTAKEKPQ--EGEVIAVGPGSRDESGKLIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+ESDIMGIV
Sbjct: 60  KIGDTILFGKWSGTEVKI-DGEDLLIMKESDIMGIV 94


>gi|217976979|ref|YP_002361126.1| co-chaperonin GroES [Methylocella silvestris BL2]
 gi|254813849|sp|B8ER19|CH10_METSB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|217502355|gb|ACK49764.1| chaperonin Cpn10 [Methylocella silvestris BL2]
          Length = 95

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 68/97 (70%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+RL+ E KT  G I+IPDT  EKP    GEI+ VG G  D SGK+   +V
Sbjct: 3   FRPLHDRVVVKRLEGEEKT-KGGIIIPDTAKEKPQ--EGEIIAVGPGGRDDSGKLTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTE+K+ DG++ L+M+ESDI+G+V 
Sbjct: 60  KAGDKVLFGKWSGTEVKI-DGQDLLIMKESDILGVVA 95


>gi|84516670|ref|ZP_01004029.1| Chaperonin Cpn10 (GroES) [Loktanella vestfoldensis SKA53]
 gi|84509706|gb|EAQ06164.1| Chaperonin Cpn10 (GroES) [Loktanella vestfoldensis SKA53]
          Length = 94

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++S+ KT  G +LIPDT  EKP+   GEI+ VG G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRIESDTKT-KGGLLIPDTAKEKPA--EGEIVSVGEGARKDSGELIPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+++ DGEE L+M+ESDI+GI+
Sbjct: 60  KAGDTVLFGKWSGTEVRI-DGEELLIMKESDILGIM 94


>gi|159045460|ref|YP_001534254.1| chaperonin 10 Kd subunit [Dinoroseobacter shibae DFL 12]
 gi|189044102|sp|A8LJQ0|CH10_DINSH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157913220|gb|ABV94653.1| chaperonin 10 Kd subunit [Dinoroseobacter shibae DFL 12]
          Length = 103

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR++SE KTA G ++IPD+  EKP+   G ++ VGAG  D  G  I  +V
Sbjct: 3   FTPLHDRVLVRRVESEEKTA-GGLIIPDSAKEKPA--EGLVIAVGAGAKDDDGDRIPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
            +GD +LFGKWSGTE+ + DGEE L+M+ESDI+GI+ +E   K
Sbjct: 60  KEGDKILFGKWSGTEVTV-DGEELLIMKESDILGIITDEAAAK 101


>gi|241518550|ref|YP_002979178.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862963|gb|ACS60627.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 104

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 73/103 (70%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ S+ KT  G I+IPDT  EKP    GE++ +G+G  +++G++   +V
Sbjct: 3   FRPLHDRILVRRVDSQEKT-KGGIIIPDTAKEKPQ--EGEVIAIGSGARNEAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGIIEAQAEQK 101


>gi|7578865|gb|AAF64159.1|AF239163_1 GroES [Rhizobium leguminosarum]
          Length = 104

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+
Sbjct: 60  KAGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGII 94


>gi|299134196|ref|ZP_07027389.1| Chaperonin Cpn10 [Afipia sp. 1NLS2]
 gi|298590943|gb|EFI51145.1| Chaperonin Cpn10 [Afipia sp. 1NLS2]
          Length = 98

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 71/99 (71%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   RP   RVVV+R+ +E KT  G I+IPD   EKPS   G+++ VG G  D+SGK+I 
Sbjct: 3   KTTFRPLHDRVVVKRIDAEAKT-KGGIIIPDNAKEKPS--EGQVVAVGPGGRDESGKLIP 59

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            ++  G+ VLFGKWSGTE+KL DGE+ L+M+ESDI+G++
Sbjct: 60  MDLKVGNRVLFGKWSGTEVKL-DGEDLLIMKESDILGVL 97


>gi|323700624|ref|ZP_08112536.1| Chaperonin Cpn10 [Desulfovibrio sp. ND132]
 gi|323460556|gb|EGB16421.1| Chaperonin Cpn10 [Desulfovibrio desulfuricans ND132]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL++E KTA G I IPD+  EKP    GE++ VG G +D+ GK ++P V
Sbjct: 3   LKPLNDRVLVKRLETEEKTA-GGIYIPDSAKEKPM--KGEVVAVGPGKLDEDGKRVKPTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVLF K++G+EI + DGEE+LVM+E DI+ IV
Sbjct: 60  KTGDIVLFAKYAGSEISI-DGEEHLVMREDDILAIV 94


>gi|294012112|ref|YP_003545572.1| chaperonin GroES [Sphingobium japonicum UT26S]
 gi|307293652|ref|ZP_07573496.1| Chaperonin Cpn10 [Sphingobium chlorophenolicum L-1]
 gi|292675442|dbj|BAI96960.1| chaperonin GroES [Sphingobium japonicum UT26S]
 gi|306879803|gb|EFN11020.1| Chaperonin Cpn10 [Sphingobium chlorophenolicum L-1]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPDT  EKP    GEI+ VG G   + GKV   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDTAKEKPQ--EGEIVSVGTGSKAEDGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+ESDI+G++
Sbjct: 60  KAGDRILFGKWSGTEVKV-DGEDLLIMKESDILGVI 94


>gi|241762557|ref|ZP_04760632.1| chaperonin Cpn10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753450|ref|YP_003226343.1| co-chaperonin GroES [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|59802830|sp|P48229|CH10_ZYMMO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|241372885|gb|EER62572.1| chaperonin Cpn10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552813|gb|ACV75759.1| chaperonin Cpn10 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+ +E KTA G I+IPDT  EKP    GE++  G G   + GKV+  +V
Sbjct: 3   FRPLHDRVLVRRVAAEEKTA-GGIIIPDTAKEKPQ--EGEVIAAGNGTHSEDGKVVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+++ DGE+ L+M+ESDI+GI+
Sbjct: 60  KAGDRVLFGKWSGTEVRV-DGEDLLIMKESDILGII 94


>gi|13472059|ref|NP_103626.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099]
 gi|23813804|sp|Q98IV4|CH101_RHILO RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|14022804|dbj|BAB49412.1| chaperonin GroES [Mesorhizobium loti MAFF303099]
          Length = 104

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 7/104 (6%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR + + K+  G I+IPD   EKP    GE++ VG G  D++G ++  +V
Sbjct: 3   FRPLHDRVVIRRAEGDTKS-KGGIIIPDNAKEKPQ--EGEVIAVGPGARDENGALVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV---VEEKK 109
             GD++LFGKWSGTE+K+ DGE+ L+M+E+DIMG++   VE KK
Sbjct: 60  KAGDLILFGKWSGTEVKI-DGEDLLIMKEADIMGVIDKSVEAKK 102


>gi|218672501|ref|ZP_03522170.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli GR56]
          Length = 104

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 60  KVGDRVLFGKWSGTEIKIN-GEDLLIMKESDVMGIIEAQSEGK 101


>gi|94497511|ref|ZP_01304081.1| 10 kDa chaperonin, GroES [Sphingomonas sp. SKA58]
 gi|94423142|gb|EAT08173.1| 10 kDa chaperonin, GroES [Sphingomonas sp. SKA58]
          Length = 95

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPDT  EKP    GEI+ VG G   + GKV   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDTAKEKPQ--EGEIVSVGTGSKAEDGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ L+M+ESDI+G++
Sbjct: 60  KTGDRILFGKWSGTEVKV-DGEDLLIMKESDILGVI 94


>gi|332187458|ref|ZP_08389196.1| chaperonin 10 Kd subunit [Sphingomonas sp. S17]
 gi|332012619|gb|EGI54686.1| chaperonin 10 Kd subunit [Sphingomonas sp. S17]
          Length = 95

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPDT  EKP    GE++  G G   + GKV   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDTAKEKPQ--EGEVVAAGTGAKAEDGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDI+GI+
Sbjct: 60  KAGDRILFGKWSGTEVKVN-GEDLLIMKESDILGII 94


>gi|254464423|ref|ZP_05077834.1| chaperonin GroS [Rhodobacterales bacterium Y4I]
 gi|206685331|gb|EDZ45813.1| chaperonin GroS [Rhodobacterales bacterium Y4I]
          Length = 95

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G ++  GAG    SG++IE  V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGVVVACGAGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGKWSGTEI + DGEE L+M+ESDIMGI+
Sbjct: 60  KSGDRIMFGKWSGTEITV-DGEELLMMKESDIMGII 94


>gi|148556277|ref|YP_001263859.1| chaperonin Cpn10 [Sphingomonas wittichii RW1]
 gi|189044122|sp|A5VBQ5|CH10_SPHWW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|148501467|gb|ABQ69721.1| chaperonin Cpn10 [Sphingomonas wittichii RW1]
          Length = 95

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKP    GE++ VG G   + GKV   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDSAKEKPQ--EGEVVAVGGGSKAEDGKVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+N GE+ L+M+ESDI+GIV
Sbjct: 60  KAGDKILFGKWSGTEVKIN-GEDLLIMKESDILGIV 94


>gi|291288718|ref|YP_003505534.1| chaperonin Cpn10 [Denitrovibrio acetiphilus DSM 12809]
 gi|290885878|gb|ADD69578.1| chaperonin Cpn10 [Denitrovibrio acetiphilus DSM 12809]
          Length = 97

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P + R++V+R +SE KTA+G I+IPD+  EKP    GEI+ VG G +  +G  +EP V
Sbjct: 4   IKPLQDRIIVKRFESEEKTASG-IIIPDSAKEKPF--EGEIIAVGQGKVFDNGTRVEPTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K  DGEEYL+M+E DI+GI+
Sbjct: 61  KPGDKVLFAKYAGTEVKF-DGEEYLIMREDDILGII 95


>gi|163737789|ref|ZP_02145206.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis BS107]
 gi|163742905|ref|ZP_02150289.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis 2.10]
 gi|161383869|gb|EDQ08254.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis 2.10]
 gi|161389315|gb|EDQ13667.1| chaperonin, 10 kDa [Phaeobacter gallaeciensis BS107]
          Length = 95

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G+++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGQVVATGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD +LFGKWSGTE+ + DGEE L+M+ESDIMGI+
Sbjct: 60  SAGDKILFGKWSGTEVTV-DGEELLMMKESDIMGII 94


>gi|222106810|ref|YP_002547601.1| 10 KD chaperonin (protein CPN10) [Agrobacterium vitis S4]
 gi|254813820|sp|B9K1Y7|CH10_AGRVS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|221737989|gb|ACM38885.1| 10 KD chaperonin (protein CPN10) [Agrobacterium vitis S4]
          Length = 98

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R++SE KT  G I+IPDT  EKP+   GEI+ VG G  D  G ++  +V
Sbjct: 6   FRPLHDRVVVKRVESEEKT-KGGIIIPDTAKEKPA--EGEIIAVGPGTRDDKGALVALDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+KL DG + L+M+E+DIMG++
Sbjct: 63  KVGDRVLFGKWSGTEVKL-DGVDLLIMKEADIMGVI 97


>gi|190894864|ref|YP_001985157.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
 gi|190700525|gb|ACE94607.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 652]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GEE L+M+E+D+MGI+
Sbjct: 60  KVGDHILFGKWSGTEIKIN-GEELLIMKENDVMGII 94


>gi|254466029|ref|ZP_05079440.1| chaperonin GroS [Rhodobacterales bacterium Y4I]
 gi|206686937|gb|EDZ47419.1| chaperonin GroS [Rhodobacterales bacterium Y4I]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR++ + KT +G ++IPDT  EKP    GEI+ VGAG  D+ G+ I  +V
Sbjct: 3   FTPLHDRVLVRRIEGDAKT-SGGLIIPDTAKEKPQ--EGEIVAVGAGAKDEDGERIAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIKL DGE+ ++M+ESDI+G++
Sbjct: 60  KAGDRILFGKWSGTEIKL-DGEDLMIMKESDILGVM 94


>gi|150396500|ref|YP_001326967.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419]
 gi|150028015|gb|ABR60132.1| chaperonin Cpn10 [Sinorhizobium medicae WSM419]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG G  ++ G+V   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNEQGQVQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK++ GE+ L+M+ESD+MGI+
Sbjct: 60  KAGDRILFGKWSGTEIKIH-GEDLLIMKESDVMGII 94


>gi|89055850|ref|YP_511301.1| co-chaperonin GroES [Jannaschia sp. CCS1]
 gi|123400978|sp|Q28LY6|CH10_JANSC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|88865399|gb|ABD56276.1| chaperonin Cpn10 [Jannaschia sp. CCS1]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P + RV+VRR++SE KTA G ++IP++  EKPS   GE++  G G    SG++IE  V
Sbjct: 3   LKPLQDRVLVRRVESEEKTA-GGLIIPESAKEKPS--EGEVVSCGDGARKDSGELIEMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+ L DGEE L+M+ESDI+GI+
Sbjct: 60  KTGDRILFGKWSGTEVTL-DGEELLMMKESDILGII 94


>gi|86361059|ref|YP_472946.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
 gi|86285161|gb|ABC94219.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+  + + K
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGIIEAQSERK 101


>gi|158520566|ref|YP_001528436.1| chaperonin Cpn10 [Desulfococcus oleovorans Hxd3]
 gi|226701754|sp|A8ZU47|CH10_DESOH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|158509392|gb|ABW66359.1| chaperonin Cpn10 [Desulfococcus oleovorans Hxd3]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++V+R++ E KT  G I+IPDT  EKP    G++M VG G + + GK+I  EV
Sbjct: 3   FRPLHDRILVKRVEEETKTK-GGIIIPDTAKEKPI--EGKVMAVGNGRLGEDGKLIPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLFGK+ GTE+K+ DG+EYL+M+E DI+GI+
Sbjct: 60  KKGDRVLFGKYGGTEVKM-DGQEYLIMREDDILGIL 94


>gi|149913712|ref|ZP_01902245.1| putative manganese-dependent inorganic pyrophosphatase [Roseobacter
           sp. AzwK-3b]
 gi|149812832|gb|EDM72661.1| putative manganese-dependent inorganic pyrophosphatase [Roseobacter
           sp. AzwK-3b]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KTA G ++IP++  EKP    GE++ +G G    SG++IE  V
Sbjct: 3   FKPLHDRVLVRRVESEEKTA-GGLIIPESAKEKPQ--EGEVVAIGEGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTEI L DGEE L+M+ESDI+G++ 
Sbjct: 60  KAGDKVLFGKWSGTEITL-DGEELLIMKESDILGVIA 95


>gi|27380736|ref|NP_772265.1| co-chaperonin GroES [Bradyrhizobium japonicum USDA 110]
 gi|27353901|dbj|BAC50890.1| 10 KD chaperonin [Bradyrhizobium japonicum USDA 110]
          Length = 104

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R+ +E KTA G I+IPDT  EKPS   GE++ VG G  D++GK+I  ++
Sbjct: 3   FRPLHDRVVVKRIDAEEKTA-GGIIIPDTAKEKPS--QGEVVAVGPGGRDEAGKLIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ D  + L+M+ESDIMG++
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DSVDLLIMKESDIMGVL 94


>gi|146339699|ref|YP_001204747.1| co-chaperonin GroES [Bradyrhizobium sp. ORS278]
 gi|146192505|emb|CAL76510.1| chaperone Hsp10 (GroES), part of GroE chaperone system
           [Bradyrhizobium sp. ORS278]
          Length = 104

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV+VRR+ +E KT  G I+IPDT  EKP    GEI+  G G  ++ G+++  +
Sbjct: 2   HFRPLHDRVLVRRIDAEEKT-KGGIIIPDTAKEKPQ--EGEIVAAGPGARNEQGQLVPLD 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGKWSGTE+K+ DG++ L+M+ESD++GIV
Sbjct: 59  VKPGDRVLFGKWSGTEVKI-DGKDLLIMKESDLLGIV 94


>gi|110678133|ref|YP_681140.1| chaperonin, 10 kDa [Roseobacter denitrificans OCh 114]
 gi|109454249|gb|ABG30454.1| chaperonin, 10 kDa [Roseobacter denitrificans OCh 114]
          Length = 103

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR+ S+ KTA G ++IPDT  EKP    GE++ VG G  D  G  I+  V
Sbjct: 3   FTPLHDRVLVRRVDSDEKTA-GGLIIPDTAKEKPG--RGEVIAVGPGARDAHGNQIDMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEI L DGEE L+M+ESDI+GI+
Sbjct: 60  KAGDHILFGKWSGTEITL-DGEEMLIMKESDILGII 94


>gi|83950580|ref|ZP_00959313.1| Chaperonin Cpn10 (GroES) [Roseovarius nubinhibens ISM]
 gi|83838479|gb|EAP77775.1| Chaperonin Cpn10 (GroES) [Roseovarius nubinhibens ISM]
          Length = 95

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KT +G ++IPD+  EKPS   GE++  G G    SG++IE  V
Sbjct: 3   FKPLHDRVLVRRVESEEKT-SGGLIIPDSAKEKPS--EGEVVACGDGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKWSGTEI + DGEE L+M+ESDI+G++ 
Sbjct: 60  KAGDRVLFGKWSGTEITI-DGEELLIMKESDILGVMA 95


>gi|197103236|ref|YP_002128614.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum
           HLK1]
 gi|196480512|gb|ACG80039.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum
           HLK1]
          Length = 97

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++ + KT  G I+IPDT  EKP    GE++ VG G  D+ G+ +EPE+
Sbjct: 3   FRPLGDRILVRRVEEDAKT-PGGIIIPDTAKEKPQ--QGEVLAVGPGARDKDGRRLEPEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  VLFGKWSG+E+++ DGE+ L+M+ESD++G++
Sbjct: 60  KAGQKVLFGKWSGSEVRI-DGEDLLIMKESDVLGVL 94


>gi|195970073|ref|YP_002122333.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021]
 gi|20141232|sp|P35474|CH105_RHIME RecName: Full=10 kDa chaperonin 5; AltName: Full=GroES protein 5;
           AltName: Full=Protein Cpn10 5
 gi|186929512|emb|CAQ51294.1| 10 kDa chaperonin [Sinorhizobium meliloti 1021]
          Length = 104

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG G   + G++   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVLAVGPGARGEQGQIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+ DGE+ L+M+ESD+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKI-DGEDLLIMKESDVMGII 94


>gi|307313306|ref|ZP_07592930.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
 gi|307320761|ref|ZP_07600172.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|306893579|gb|EFN24354.1| Chaperonin Cpn10 [Sinorhizobium meliloti AK83]
 gi|306899319|gb|EFN29954.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
          Length = 104

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG G   + G++   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVLAVGPGARGEKGQIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+ DGE+ L+M+ESD+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKI-DGEDLLIMKESDVMGII 94


>gi|163745714|ref|ZP_02153074.1| chaperonin, 10 kDa [Oceanibulbus indolifex HEL-45]
 gi|161382532|gb|EDQ06941.1| chaperonin, 10 kDa [Oceanibulbus indolifex HEL-45]
          Length = 95

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+R +SE KTA G ++IPD+  EKPS   GE++ VG G    +G++IE  V
Sbjct: 3   LKPLHDRVLVKRTESEEKTA-GGLIIPDSAKEKPS--EGEVVAVGTGARKDNGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + GD +LFGKWSGTE+ + +GEE L+M+ESDIMGI+ 
Sbjct: 60  APGDKILFGKWSGTEVTV-EGEEMLMMKESDIMGIIA 95


>gi|74316110|ref|YP_313850.1| co-chaperonin GroES [Thiobacillus denitrificans ATCC 25259]
 gi|123773101|sp|Q3SMK0|CH10_THIDA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|74055605|gb|AAZ96045.1| chaperonin GroES (Hsp10, Cpn10)) [Thiobacillus denitrificans ATCC
           25259]
          Length = 96

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ E KTA+G I+IPDT +EKP    GEI+ VGAG  D  GK+I  +V
Sbjct: 3   IRPLHDRVIVKRMEEERKTASG-IVIPDTAAEKPD--QGEIVAVGAGKKDDQGKLISLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ +GEE LVM+E DIMG+V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-EGEELLVMREEDIMGVV 94


>gi|254441244|ref|ZP_05054737.1| chaperonin GroS [Octadecabacter antarcticus 307]
 gi|198251322|gb|EDY75637.1| chaperonin GroS [Octadecabacter antarcticus 307]
          Length = 95

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR + E KTA G ++IPD   EKP+   GE++  G G+   SG+++E  V
Sbjct: 3   FKPLHDRVLVRRTEGEEKTA-GGLIIPDAAKEKPA--EGEVIACGEGLRKDSGELVEMGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEI L DGEE L+M+ESDIMGI+
Sbjct: 60  KSGDKVLFGKWSGTEITL-DGEELLIMKESDIMGIL 94


>gi|148254474|ref|YP_001239059.1| co-chaperonin GroES [Bradyrhizobium sp. BTAi1]
 gi|146406647|gb|ABQ35153.1| chaperone Hsp10 (GroES), part of GroE chaperone system
           [Bradyrhizobium sp. BTAi1]
          Length = 104

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           + RP   RV+VRR+ +E KT  G I+IPDT  EKP    GEI+  G G  ++ G+++  +
Sbjct: 2   HFRPLHDRVLVRRIDAEEKT-KGGIIIPDTAKEKPQ--EGEIVAAGPGARNEQGQLVPLD 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGKWSGTE+K+ DG++ L+M+ESD++GI+
Sbjct: 59  VKPGDRVLFGKWSGTEVKI-DGKDLLIMKESDLLGII 94


>gi|155595|gb|AAA62398.1| groES [Zymomonas mobilis subsp. mobilis CP4]
          Length = 95

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+ +E KTA G I+IPDT   KP    GE++  G G   + GKV+  +V
Sbjct: 3   FRPLHDRVLVRRVAAEEKTA-GGIIIPDTAKRKPQ--EGEVIAAGNGTHSEDGKVVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+++ DGE+ L+M+ESDI+GI+
Sbjct: 60  KAGDRVLFGKWSGTEVRV-DGEDLLIMKESDILGII 94


>gi|84499754|ref|ZP_00998042.1| chaperonin, 10 kDa [Oceanicola batsensis HTCC2597]
 gi|84392898|gb|EAQ05109.1| chaperonin, 10 kDa [Oceanicola batsensis HTCC2597]
          Length = 103

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V+R++SE KTA G ++IPD+  EKP+   GE++ VG G    +G++IE  V
Sbjct: 3   FKPLHDRVLVKRVESEEKTA-GGLIIPDSAKEKPA--EGEVVAVGEGARKDNGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGKWSGTE+ + DG+E L+M+ESDI+GI+ +
Sbjct: 60  KAGDKVLFGKWSGTEVTI-DGQELLIMKESDILGIITD 96


>gi|253998115|ref|YP_003050178.1| co-chaperonin GroES [Methylovorus sp. SIP3-4]
 gi|313200181|ref|YP_004038839.1| chaperonin cpn10 [Methylovorus sp. MP688]
 gi|253984794|gb|ACT49651.1| chaperonin Cpn10 [Methylovorus sp. SIP3-4]
 gi|312439497|gb|ADQ83603.1| chaperonin Cpn10 [Methylovorus sp. MP688]
          Length = 96

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPDT +EKP    GE++ VG G  D SGK I  +V
Sbjct: 3   IRPLHDRVIVKRLEEERKTASG-IVIPDTAAEKPD--QGEVIAVGPGKKDDSGKAIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+N GEE LV++E DI+G+V
Sbjct: 60  KVGDKVLFGKYAGQAVKVN-GEEVLVLREEDILGVV 94


>gi|218512205|ref|ZP_03509045.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli 8C-3]
          Length = 104

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G+V   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQVQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+E+D+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKENDVMGII 94


>gi|330813619|ref|YP_004357858.1| heat shock protein 60 family co-chaperone GroES [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486714|gb|AEA81119.1| heat shock protein 60 family co-chaperone GroES [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 96

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV++  L+SE KTA G I+IPDT  EKP    G+++ VG G   + GK I  +V
Sbjct: 3   FRPLHDRVLIESLESEEKTA-GGIIIPDTAKEKPQ--EGKVIAVGPGAKSEDGKAIPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG+EY +M+ESDIMG+V
Sbjct: 60  EVGDRVLFGKWSGTEVKV-DGKEYSIMKESDIMGVV 94


>gi|152237|gb|AAA26286.1| groES [Sinorhizobium meliloti]
          Length = 101

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    GE++ VG G   + G++   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGEVLAVGPGARGEQGQIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+ DGE+ L+M+ESD+MGI+
Sbjct: 60  KVGDRILFGKWSGTEIKI-DGEDLLIMKESDVMGII 94


>gi|86356878|ref|YP_468770.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
 gi|86280980|gb|ABC90043.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 104

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVRRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MG++
Sbjct: 60  KVGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGVI 94


>gi|85703817|ref|ZP_01034920.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. 217]
 gi|85671137|gb|EAQ25995.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. 217]
          Length = 95

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KTA G ++IPD+  EKPS   GE++  G G    +G++I   V
Sbjct: 3   FKPLHDRVLVRRVESEAKTA-GGLIIPDSAKEKPS--QGEVVSCGDGARKDNGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD +LFGKWSGTE+ + DGEE L+M+ESDI+G++ 
Sbjct: 60  KAGDTILFGKWSGTEVTV-DGEELLIMKESDILGVIA 95


>gi|260432853|ref|ZP_05786824.1| chaperonin GroS [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416681|gb|EEX09940.1| chaperonin GroS [Silicibacter lacuscaerulensis ITI-1157]
          Length = 103

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KTA G ++IPD+  EKPS   G ++  G G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRVESEEKTA-GGLIIPDSAKEKPS--EGIVVACGEGARKDSGELIPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD +LFGKWSGTE+ + DGEE L+M+ESDI+GIV
Sbjct: 60  SEGDKILFGKWSGTEVTI-DGEELLIMKESDILGIV 94


>gi|218888147|ref|YP_002437468.1| co-chaperonin GroES [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226701755|sp|B8DJC3|CH10_DESVM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|218759101|gb|ACL10000.1| chaperonin Cpn10 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 95

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE KTA G + IPDT  EKPS   GE++  G G + + GK+I   V
Sbjct: 3   LKPLNDRVLVKRLESEEKTA-GGLFIPDTAKEKPS--RGEVVAAGPGKVAEDGKLIAMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLF K++GTEIKL DG E+LVM+E DI+ I+
Sbjct: 60  KKGDTVLFSKYAGTEIKL-DGVEHLVMREDDILAII 94


>gi|23015494|ref|ZP_00055268.1| COG0234: Co-chaperonin GroES (HSP10) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 95

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+RL +E KTA G I+IPDT  EKP    GE++ VG+G     GK++  +V
Sbjct: 3   FRPLHDRVLVKRLDAEEKTA-GGIIIPDTAKEKPM--QGEVVAVGSGTRGDDGKLVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DG + L+M+ESDI+GI+
Sbjct: 60  KAGDRVLFGKWSGTEVKI-DGVDLLIMKESDILGIL 94


>gi|197106642|ref|YP_002132019.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum
           HLK1]
 gi|196480062|gb|ACG79590.1| heat shock protein Co-chaperonin,HSP10 [Phenylobacterium zucineum
           HLK1]
          Length = 103

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG G  D++GKV   +V
Sbjct: 3   FRPLGDRVLVKRVEEEEKT-RGGIIIPDTAKEKPQ--EGEVIAVGPGARDETGKVQPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD +LFGKWSGTE+KL  GE+ L+M+ESDI+G++  +K  K
Sbjct: 60  KVGDRILFGKWSGTEVKLG-GEDLLIMKESDILGVLEADKAAK 101


>gi|296282022|ref|ZP_06860020.1| 10 kDa chaperonin, GroES [Citromicrobium bathyomarinum JL354]
          Length = 95

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKPS   G I+ VG+G     G V   +V
Sbjct: 3   FRPLHDRVLVRRIEAEEKTA-GGIIIPDSAQEKPS--EGMIVAVGSGAKADDGTVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFGKW GTE+K+ DGE+ L+M+ESDIMGI+
Sbjct: 60  KEGDRVLFGKWGGTEVKI-DGEDLLIMKESDIMGII 94


>gi|241113379|ref|YP_002973214.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861587|gb|ACS59253.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 104

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++V R+ SE KT  G I+IPDT  EKP    GE++ VG G  + +G++   +V
Sbjct: 3   FRPLHDRILVHRVDSEEKT-KGGIIIPDTAKEKPQ--EGEVIAVGPGARNDAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEIK+N GE+ L+M+ESD+MGI+
Sbjct: 60  KPGDRILFGKWSGTEIKIN-GEDLLIMKESDVMGII 94


>gi|83945761|ref|ZP_00958105.1| co-chaperonin GroES [Oceanicaulis alexandrii HTCC2633]
 gi|83850851|gb|EAP88712.1| co-chaperonin GroES [Oceanicaulis alexandrii HTCC2633]
          Length = 95

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP + RVVV+R++ E KTA G I+IPDT  EKP    GE++ VG G  D  G++I  +V
Sbjct: 3   FRPLQDRVVVKRVEEESKTA-GGIIIPDTAKEKPQ--EGEVVAVGPGARDDKGELIAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTEI L +G++ L+M+ESDI+G+V
Sbjct: 60  KVGDRILFGKWSGTEITL-EGQDLLIMKESDILGVV 94


>gi|262276787|ref|ZP_06054580.1| chaperonin GroS [alpha proteobacterium HIMB114]
 gi|262223890|gb|EEY74349.1| chaperonin GroS [alpha proteobacterium HIMB114]
          Length = 97

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 69/99 (69%), Gaps = 4/99 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V  L+SE KTA G I+IPDT  EKP    G+++ VG G   + GK+   +V
Sbjct: 3   FRPLHDRVLVESLESEEKTA-GGIIIPDTAKEKPQ--EGKVVAVGPGAKSEDGKITPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
             GD +LFGKWSGTE+K+ DG+EY +M+ESDIMG++ ++
Sbjct: 60  KVGDQILFGKWSGTEVKI-DGKEYSIMKESDIMGVIAKK 97


>gi|254462479|ref|ZP_05075895.1| chaperonin GroS [Rhodobacterales bacterium HTCC2083]
 gi|206679068|gb|EDZ43555.1| chaperonin GroS [Rhodobacteraceae bacterium HTCC2083]
          Length = 95

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%), Gaps = 4/98 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
              P   RV+VR ++S+ KT +G ++IPDT  EKP    GE++ VGAG  D++G  I  +
Sbjct: 2   LFTPLHDRVLVRLIESDEKT-SGGLIIPDTAKEKPQ--EGEVVSVGAGAKDEAGARIAMD 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           V  GD +LFGKWSGTEIK+ DGEE ++M+ESDI+GI+ 
Sbjct: 59  VKAGDKILFGKWSGTEIKI-DGEELMIMKESDILGIMA 95


>gi|254452157|ref|ZP_05065594.1| chaperonin GroS [Octadecabacter antarcticus 238]
 gi|198266563|gb|EDY90833.1| chaperonin GroS [Octadecabacter antarcticus 238]
          Length = 95

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR + E KTA G ++IPD   EKP+   GE++  G G+   +G+++E  V
Sbjct: 3   FKPLHDRVLVRRTEGEEKTA-GGLIIPDAAKEKPA--EGEVIACGEGLRKDNGELVEMGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEI L DGEE L+M+ESDIMGI+
Sbjct: 60  KSGDKVLFGKWSGTEITL-DGEELLIMKESDIMGIL 94


>gi|241203781|ref|YP_002974877.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857671|gb|ACS55338.1| chaperonin Cpn10 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 105

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            R    RVV+RR + ++K+  G I+IPDT  EKP    GE++ VG G+ D+SG ++  +V
Sbjct: 3   FRSLHDRVVIRRAEGDVKS-KGGIIIPDTAKEKPQ--HGEVVAVGPGLRDKSGNLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++LFGKWSGTE+ + DGE  L+M+E+DIMGIV
Sbjct: 60  EVGDLILFGKWSGTEVTI-DGETLLIMKETDIMGIV 94


>gi|7578868|gb|AAF64161.1|AF239164_1 GroES [Rhizobium leguminosarum]
 gi|1946296|emb|CAA73090.1| cpn10-3 [Rhizobium leguminosarum]
          Length = 105

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            R    RVV+RR + ++K+  G I+IPDT  EKP    GE++ VG G+ D+SG ++  +V
Sbjct: 3   FRSLHDRVVIRRAEGDVKS-KGGIIIPDTAKEKPQ--QGEVVAVGPGLRDKSGNLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++LFGKWSGTE+ + DGE  L+M+E+DIMGIV
Sbjct: 60  EVGDLILFGKWSGTEVTI-DGETLLIMKETDIMGIV 94


>gi|86136483|ref|ZP_01055062.1| chaperonin, 10 kDa [Roseobacter sp. MED193]
 gi|85827357|gb|EAQ47553.1| chaperonin, 10 kDa [Roseobacter sp. MED193]
          Length = 95

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IP++  EKPS   G+++  G G    +G++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPESAKEKPS--EGQVVATGEGARKDNGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD +LFGKWSGTE+ + DGEE L+M+ESDIMGI+
Sbjct: 60  SAGDTILFGKWSGTEVTV-DGEELLMMKESDIMGII 94


>gi|163732279|ref|ZP_02139725.1| chaperonin, 10 kDa [Roseobacter litoralis Och 149]
 gi|161394577|gb|EDQ18900.1| chaperonin, 10 kDa [Roseobacter litoralis Och 149]
          Length = 103

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KT +G ++IP++  EKP+   G ++  G G    SG++IE  V
Sbjct: 3   FKPLHDRVLVRRVESEEKT-SGGLIIPESAKEKPA--EGVVVACGEGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD +LFGKWSGTE+ L DGEE L+M+ESDI+GI+
Sbjct: 60  SEGDTILFGKWSGTEVTL-DGEELLIMKESDILGII 94


>gi|83854817|ref|ZP_00948347.1| chaperonin, 10 kDa [Sulfitobacter sp. NAS-14.1]
 gi|83941340|ref|ZP_00953802.1| chaperonin, 10 kDa [Sulfitobacter sp. EE-36]
 gi|83842660|gb|EAP81827.1| chaperonin, 10 kDa [Sulfitobacter sp. NAS-14.1]
 gi|83847160|gb|EAP85035.1| chaperonin, 10 kDa [Sulfitobacter sp. EE-36]
          Length = 95

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR +SE KT  G ++IPD+  EKPS   GE++  G G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRTESEEKT-KGGLIIPDSAKEKPS--EGEVVSCGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ L DGEE L+M+ESDIMGI+
Sbjct: 60  KAGDKVLFGKWSGTEVTL-DGEELLMMKESDIMGIL 94


>gi|259418739|ref|ZP_05742656.1| chaperonin GroS [Silicibacter sp. TrichCH4B]
 gi|259344961|gb|EEW56815.1| chaperonin GroS [Silicibacter sp. TrichCH4B]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G ++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGVVVACGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            +GD +LFGKWSGTE+ + DGEE L+M+ESDIMG++V
Sbjct: 60  KEGDKILFGKWSGTEVTV-DGEELLMMKESDIMGVIV 95


>gi|254418124|ref|ZP_05031848.1| chaperonin GroS [Brevundimonas sp. BAL3]
 gi|196184301|gb|EDX79277.1| chaperonin GroS [Brevundimonas sp. BAL3]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG GV D+SGKV   E+
Sbjct: 3   FRPLGDRVLVKRVEEESKT-KGGIIIPDTAKEKPQ--EGEVVSVGPGVRDESGKVNALEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG++ ++M+ESD++G++
Sbjct: 60  KAGDRILFGKWSGTEVKI-DGDDLIIMKESDVLGVL 94


>gi|163852750|ref|YP_001640793.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
 gi|240140087|ref|YP_002964564.1| 10 kDa chaperonin (protein Cpn10, groES protein) [Methylobacterium
           extorquens AM1]
 gi|163664355|gb|ABY31722.1| chaperonin Cpn10 [Methylobacterium extorquens PA1]
 gi|240010061|gb|ACS41287.1| 10 kDa chaperonin (protein Cpn10, groES protein) [Methylobacterium
           extorquens AM1]
          Length = 96

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV++RR++S+ +T  G I+IPDT  EKP    GE++ VG G  D  G+V   +V
Sbjct: 3   FRPLHDRVLLRRIESDERT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARDDQGRVTALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEIK+ DG++ L+++ESDI+G++
Sbjct: 60  KTGDRVLFGKWSGTEIKV-DGQDLLILKESDILGVI 94


>gi|99080437|ref|YP_612591.1| co-chaperonin GroES [Ruegeria sp. TM1040]
 gi|123252533|sp|Q1GJ37|CH10_SILST RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|99036717|gb|ABF63329.1| chaperonin Cpn10 [Ruegeria sp. TM1040]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G ++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGVVVACGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            +GD +LFGKWSGTE+ + DGEE L+M+ESDIMG++V
Sbjct: 60  KEGDNILFGKWSGTEVTV-DGEELLMMKESDIMGVIV 95


>gi|329891116|ref|ZP_08269459.1| 10 kDa chaperonin [Brevundimonas diminuta ATCC 11568]
 gi|328846417|gb|EGF95981.1| 10 kDa chaperonin [Brevundimonas diminuta ATCC 11568]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG GV D+ GK +  E+
Sbjct: 3   FRPLGDRVLVKRVEEESKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGVRDEDGKFVALEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSG+E+K+ DGE+ ++M+ESD++G++
Sbjct: 60  KAGDRVLFGKWSGSEVKI-DGEDLIIMKESDVLGVL 94


>gi|218531591|ref|YP_002422407.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4]
 gi|218523894|gb|ACK84479.1| chaperonin Cpn10 [Methylobacterium chloromethanicum CM4]
          Length = 96

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV++RR++S+ +T  G I+IPDT  EKP    GE++ VG G  D  G+V   +V
Sbjct: 3   FRPLHDRVLLRRIESDERTK-GGIIIPDTAKEKPQ--EGEVVAVGPGARDDQGRVTALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTEIK+ DG++ L+++ESDI+G++
Sbjct: 60  KTGDRVLFGKWSGTEIKV-DGQDLLILKESDILGVI 94


>gi|149203313|ref|ZP_01880283.1| chaperonin Cpn10 [Roseovarius sp. TM1035]
 gi|149143146|gb|EDM31185.1| chaperonin Cpn10 [Roseovarius sp. TM1035]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KTA G ++IPD+  EKPS   G+++  G G    +G++I   V
Sbjct: 3   FKPLHDRVLVRRVESEAKTA-GGLIIPDSAKEKPS--QGQVVSCGDGARKDNGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+ + DGEE L+M+ESDI+G++
Sbjct: 60  KAGDTILFGKWSGTEVTV-DGEELLIMKESDILGVI 94


>gi|91774721|ref|YP_544477.1| chaperonin Cpn10 [Methylobacillus flagellatus KT]
 gi|123078960|sp|Q1H4F1|CH10_METFK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|91708708|gb|ABE48636.1| chaperonin Cpn10 [Methylobacillus flagellatus KT]
          Length = 96

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+RL+ E KTA+G I+IPDT +EKP    GE++ VG G  D +GK I  +V
Sbjct: 3   IRPLQDRVIVKRLEEERKTASG-IVIPDTAAEKPD--QGEVIAVGPGKKDDNGKSIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+N GEE LV++E DI+GIV
Sbjct: 60  KVGDKVLFGKYAGQAVKVN-GEEVLVLREDDILGIV 94


>gi|254477038|ref|ZP_05090424.1| chaperonin GroS [Ruegeria sp. R11]
 gi|214031281|gb|EEB72116.1| chaperonin GroS [Ruegeria sp. R11]
          Length = 95

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G ++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGVVVATGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            +GD +LFGKWSGTE+ + DGEE L+M+ESDIMG++V
Sbjct: 60  KEGDKILFGKWSGTEVTV-DGEELLMMKESDIMGVIV 95


>gi|56695788|ref|YP_166139.1| co-chaperonin GroES [Ruegeria pomeroyi DSS-3]
 gi|81676373|sp|Q5LV16|CH10_SILPO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|56677525|gb|AAV94191.1| chaperonin, 10 kDa [Ruegeria pomeroyi DSS-3]
          Length = 95

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IPD+  EKPS   G ++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPDSAKEKPS--EGVVVACGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DGEE L+M+ESDIMGI+
Sbjct: 60  KSGDRVLFGKWSGTEVTV-DGEELLMMKESDIMGII 94


>gi|126739872|ref|ZP_01755563.1| chaperonin, 10 kDa [Roseobacter sp. SK209-2-6]
 gi|126719104|gb|EBA15815.1| chaperonin, 10 kDa [Roseobacter sp. SK209-2-6]
          Length = 95

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +SE KTA G ++IP++  EKPS   G+++  G G    +G++I   V
Sbjct: 3   LKPLHDRVLVRRTESEEKTA-GGLIIPESAKEKPS--EGQVVATGEGARKDNGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD +LFGKWSGTE+ + DGEE L+M+ESDIMGI+
Sbjct: 60  SAGDNILFGKWSGTEVTV-DGEELLMMKESDIMGII 94


>gi|78357517|ref|YP_388966.1| co-chaperonin GroES [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123741234|sp|Q30YH5|CH10_DESDG RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78219922|gb|ABB39271.1| chaperonin, 10 kDa [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 95

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE KTA G + IPDT  EKPS   GE++ VG G     GKVI   V
Sbjct: 3   LKPLNDRVLVKRLESEEKTA-GGLYIPDTAKEKPS--RGEVIAVGPGKTADDGKVIAMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLF K++GTE+KL DG ++LVM+E DI+ I+
Sbjct: 60  KTGDVVLFNKYAGTEVKL-DGVDHLVMREDDILAII 94


>gi|42521742|ref|NP_967122.1| chaperonin groES [Bdellovibrio bacteriovorus HD100]
 gi|39574272|emb|CAE77776.1| chaperonin groES [Bdellovibrio bacteriovorus HD100]
          Length = 100

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++VRR+  E KTA G + IPDT  EKP    GEI+  G G + + GK++  EV
Sbjct: 8   VRPLHDRILVRRMAEEEKTA-GGLFIPDTAKEKPQ--KGEIIATGKGRVTEDGKILPLEV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+KL DG EYL+M+E DI+G+ 
Sbjct: 65  KVGDKVLFGKYAGTELKL-DGAEYLMMREEDILGVF 99


>gi|117923612|ref|YP_864229.1| chaperonin Cpn10 [Magnetococcus sp. MC-1]
 gi|117607368|gb|ABK42823.1| chaperonin Cpn10 [Magnetococcus sp. MC-1]
          Length = 97

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVV+R +S+ KTA G I+IPDT  EKP    GE++ VG+GV++ +G V   EV
Sbjct: 5   FRPLHDRVVVKRTESDAKTA-GGIIIPDTAKEKPV--QGEVLAVGSGVVNDAGNVRPLEV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+ GTE+++ DGEE L+M+ESDI+GI+
Sbjct: 62  KVGDKVLFSKYGGTEVRI-DGEELLIMRESDIVGIL 96


>gi|167648110|ref|YP_001685773.1| co-chaperonin GroES [Caulobacter sp. K31]
 gi|189044096|sp|B0SXR3|CH10_CAUSK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|167350540|gb|ABZ73275.1| chaperonin Cpn10 [Caulobacter sp. K31]
          Length = 96

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDTV EKP    GE++ VG G  +  G ++  +V
Sbjct: 3   FRPLGDRVLVKRVEEETKT-KGGIIIPDTVKEKPQ--EGEVVAVGPGARNDKGDIVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG++ L+M+ESD++GIV
Sbjct: 60  KAGDRILFGKWSGTEVKV-DGQDLLIMKESDVLGIV 94


>gi|83591501|ref|YP_425253.1| chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170]
 gi|83574415|gb|ABC20966.1| Chaperonin Cpn10 [Rhodospirillum rubrum ATCC 11170]
          Length = 104

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP + RV+VRRL+ + KT  G I+IPDT  EKP    GEI+  G G   + G +   +V
Sbjct: 3   FRPLQDRVLVRRLEEDEKTK-GGIIIPDTAKEKPM--RGEIIATGPGARGEDGVLHPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GDIVLFGKW+GTE+K+ DG EYL+M+ESDI+G++
Sbjct: 60  TSGDIVLFGKWTGTEVKI-DGVEYLIMKESDILGVI 94


>gi|110680678|ref|YP_683685.1| co-chaperonin GroES [Roseobacter denitrificans OCh 114]
 gi|109456794|gb|ABG32999.1| chaperonin, 10 kDa [Roseobacter denitrificans OCh 114]
          Length = 103

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++SE KT +G ++IP++  EKP+   G ++  G G    SG++IE  V
Sbjct: 3   FKPLHDRVLVRRVESEEKT-SGGLIIPESAKEKPA--EGIVVACGEGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD +LFGKWSGTE+ L DGEE L+M+ESDI+GI+
Sbjct: 60  SEGDKILFGKWSGTEVTL-DGEELLIMKESDILGII 94


>gi|116251178|ref|YP_767016.1| 10 kDa chaperonin 5 (GroES protein 5) [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255826|emb|CAK06907.1| putative 10 kda chaperonin 5 (GroES protein 5) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 105

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            R    RVV+RR + ++K+  G I+IPDT  EKP    GE++ VG G+ D+SG ++  +V
Sbjct: 3   FRSLHDRVVIRRAEGDVKS-KGGIIIPDTAKEKPQ--QGEVVAVGPGLRDKSGNLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++LFGKWSG+E+ + DGE  L+M+E+DIMGIV
Sbjct: 60  EVGDLILFGKWSGSEVTI-DGETLLIMKETDIMGIV 94


>gi|114330236|ref|YP_746458.1| co-chaperonin GroES [Nitrosomonas eutropha C91]
 gi|122314705|sp|Q0AJH8|CH10_NITEC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|114307250|gb|ABI58493.1| chaperonin Cpn10 [Nitrosomonas eutropha C91]
          Length = 96

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPDT +EKP    GEI+ VG G   + GK+   EV
Sbjct: 3   IRPLHDRVIVKRLEEERKTASG-IVIPDTAAEKPD--QGEIIAVGKGKAGEDGKIRTLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+  GEE+LVM+E DIMG++
Sbjct: 60  KVGDKVLFGKYAGQAVKIK-GEEFLVMREEDIMGVI 94


>gi|39998428|ref|NP_954379.1| co-chaperonin GroES [Geobacter sulfurreducens PCA]
 gi|81700923|sp|Q747C8|CH10_GEOSL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|39985375|gb|AAR36729.1| chaperonin, 10 kDa [Geobacter sulfurreducens PCA]
 gi|298507372|gb|ADI86095.1| chaperonin GroES [Geobacter sulfurreducens KN400]
          Length = 95

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++ E KTA G I IPDT  EKP    GEI+ VG G   + GKVI  ++
Sbjct: 3   LRPLQDRILVKRIEEETKTA-GGIFIPDTAKEKPQ--RGEIVAVGNGKKTEDGKVIPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GT+IK+ +G+E+L+M+E DI+G++
Sbjct: 60  KVGDKVLFGKYAGTDIKI-EGQEFLIMREDDILGVI 94


>gi|317050927|ref|YP_004112043.1| Chaperonin Cpn10 [Desulfurispirillum indicum S5]
 gi|316946011|gb|ADU65487.1| Chaperonin Cpn10 [Desulfurispirillum indicum S5]
          Length = 96

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++V+R+++E KTA+G I+IPDT  EKP    G +M VG G    +G  I P V
Sbjct: 3   IRPLQDRIIVKRIEAEEKTASG-IIIPDTAKEKPM--EGNVMAVGPGKALDNGNTIVPTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K+ DG+EY++M+E DI+G++
Sbjct: 60  KAGDKVLFSKYAGTEVKI-DGQEYIIMREDDILGVI 94


>gi|30248058|ref|NP_840128.1| co-chaperonin GroES [Nitrosomonas europaea ATCC 19718]
 gi|60389764|sp|Q82Y61|CH10_NITEU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|30179943|emb|CAD83938.1| Chaperonins cpn10 (10 Kd subunit) [Nitrosomonas europaea ATCC
           19718]
          Length = 96

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPDT +EKP    GEI+ VG G   + GK+   EV
Sbjct: 3   IRPLHDRVIVKRLEEERKTASG-IVIPDTAAEKPD--QGEIIAVGKGKTGEDGKIRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+  GEE+LVM+E DIMG++
Sbjct: 60  KVGDRVLFGKYAGQAVKIK-GEEFLVMREEDIMGVI 94


>gi|52840924|ref|YP_094723.1| co-chaperonin GroES [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54293670|ref|YP_126085.1| co-chaperonin GroES [Legionella pneumophila str. Lens]
 gi|54296711|ref|YP_123080.1| co-chaperonin GroES [Legionella pneumophila str. Paris]
 gi|148360661|ref|YP_001251868.1| chaperonin GroES [Legionella pneumophila str. Corby]
 gi|296106274|ref|YP_003617974.1| Co-chaperonin GroES (HSP10) [Legionella pneumophila 2300/99 Alcoy]
 gi|116197|sp|P26879|CH10_LEGPN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock protein A; AltName:
           Full=Protein Cpn10
 gi|81679282|sp|Q5WYL3|CH10_LEGPL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|81679534|sp|Q5X763|CH10_LEGPA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|81680517|sp|Q5ZXP4|CH10_LEGPH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198380|sp|A5IGM2|CH10_LEGPC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|149688|gb|AAA25297.1| htpA [Legionella pneumophila]
 gi|52628035|gb|AAU26776.1| Hsp10, 10 kDa chaperonin GroES [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750496|emb|CAH11890.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock
           protein A) [Legionella pneumophila str. Paris]
 gi|53753502|emb|CAH14957.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock
           protein A) [Legionella pneumophila str. Lens]
 gi|148282434|gb|ABQ56522.1| Hsp10, 10 kDa chaperonin GroES [Legionella pneumophila str. Corby]
 gi|295648175|gb|ADG24022.1| Co-chaperonin GroES (HSP10) [Legionella pneumophila 2300/99 Alcoy]
          Length = 96

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E +T  G I+IPD+ +EKP    GEI+ VGAG + ++G V    V
Sbjct: 3   IRPLHDRVVVRRMEEE-RTTAGGIVIPDSATEKPM--RGEIIAVGAGKVLENGDVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SGTE+K+ DG+E +VM+E DIMG++
Sbjct: 60  KVGDVVLFGKYSGTEVKV-DGKELVVMREDDIMGVI 94


>gi|270157769|ref|ZP_06186426.1| chaperonin GroS [Legionella longbeachae D-4968]
 gi|289163962|ref|YP_003454100.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock
           protein A) [Legionella longbeachae NSW150]
 gi|269989794|gb|EEZ96048.1| chaperonin GroS [Legionella longbeachae D-4968]
 gi|288857135|emb|CBJ10951.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) (Heat shock
           protein A) [Legionella longbeachae NSW150]
          Length = 96

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E +T  G I+IPD+ +EKP    GEI+ VGAG +  +G V    V
Sbjct: 3   IRPLHDRVVVRRMEEE-RTTAGGIVIPDSATEKPM--RGEIIAVGAGKILDNGDVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SGTE+K+ DG+E +VM+E DIMG++
Sbjct: 60  KVGDVVLFGKYSGTEVKI-DGKELVVMREDDIMGVI 94


>gi|167565157|ref|ZP_02358073.1| co-chaperonin GroES [Burkholderia oklahomensis EO147]
 gi|167574792|ref|ZP_02367666.1| co-chaperonin GroES [Burkholderia oklahomensis C6786]
          Length = 96

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+RL  E KTA+G I+IPD+ +EKP    GEI+ VG G  D  GK +EP+V
Sbjct: 3   LRPLHDRVVVKRLDQETKTASG-IVIPDSAAEKPD--QGEIVAVGPGRRDADGKRVEPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDIVAVV 94


>gi|167586345|ref|ZP_02378733.1| co-chaperonin GroES [Burkholderia ubonensis Bu]
          Length = 100

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (68%), Gaps = 4/102 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   RV++RRL+ E KTATG I+IPDT +EKP    GE++ VG G   + G+  EP+V
Sbjct: 3   LSPLHDRVLIRRLEQERKTATG-IVIPDTAAEKPD--QGEVLAVGPGKRMEDGRRCEPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKN 110
             GD VLFGK++GT +K+ +GEE LVM+E D++ ++  +  +
Sbjct: 60  KVGDRVLFGKYAGTTVKV-EGEELLVMREDDLLAVIASDPAH 100


>gi|254511349|ref|ZP_05123416.1| chaperonin GroS [Rhodobacteraceae bacterium KLH11]
 gi|221535060|gb|EEE38048.1| chaperonin GroS [Rhodobacteraceae bacterium KLH11]
          Length = 95

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR +S+ KTA G ++IPD+  EKPS   GE++  G G    SG++I   V
Sbjct: 3   LKPLHDRVLVRRTESDEKTA-GGLIIPDSAKEKPS--EGEVVATGEGARKDSGELIAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+ +  GEE L+M+ESDIMGI+
Sbjct: 60  KAGDKILFGKWSGTEVNVG-GEELLMMKESDIMGII 94


>gi|262276693|ref|ZP_06054491.1| chaperonin GroS [alpha proteobacterium HIMB114]
 gi|262225144|gb|EEY75598.1| chaperonin GroS [alpha proteobacterium HIMB114]
          Length = 96

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V  L SE KTA G I+IPDT  EKP    G+++ VG G   + GK+   +V
Sbjct: 3   FRPLHDRVLVESLGSEEKTA-GGIIIPDTAKEKPQ--EGKVIAVGPGAKAEDGKITPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG+EY +M+ESDIMG++
Sbjct: 60  KVGDQILFGKWSGTEVKI-DGKEYSIMKESDIMGVI 94


>gi|217424447|ref|ZP_03455945.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
 gi|254198893|ref|ZP_04905311.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|169657065|gb|EDS88459.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|217392371|gb|EEC32395.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
          Length = 98

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD+ +EKP    GEI+ VG G  D  GK +EP+V
Sbjct: 5   LRPLHDRVIVKRLDQETKTASG-IVIPDSAAEKPD--QGEIVAVGPGRRDADGKRVEPDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 62  KVGERVLFGKYAGQSVKV-DGNELLVLREEDIVAVV 96


>gi|326386247|ref|ZP_08207871.1| chaperonin GroES [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209472|gb|EGD60265.1| chaperonin GroES [Novosphingobium nitrogenifigens DSM 19370]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKP+   GEI+ VG G    +G V   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDSAKEKPA--EGEIVAVGTGTRADNGTVTPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K++ GE+ L+M+E+DI+G++
Sbjct: 60  KVGDRVLFGKWSGTEVKVS-GEDLLIMKETDILGVI 94


>gi|94987066|ref|YP_594999.1| co-chaperonin GroES [Lawsonia intracellularis PHE/MN1-00]
 gi|48474759|sp|O87887|CH10_LAWIN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123262153|sp|Q1MQP9|CH10_LAWIP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|3599923|gb|AAC36499.1| GroES/HSP10 homolog [Lawsonia intracellularis]
 gi|94731315|emb|CAJ54678.1| GroES/HSP10 homolog [Lawsonia intracellularis PHE/MN1-00]
          Length = 101

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE KTA G + IPDT  EKPS   GE++ VG G     GK+I   V
Sbjct: 3   LKPLNDRVLVKRLESEEKTA-GGLYIPDTAKEKPS--RGEVVAVGPGKHTDDGKLIPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLF K++GTE+KL DG E+LVM+E DI+ ++  E   K
Sbjct: 60  KAGDTVLFNKYAGTEVKL-DGVEHLVMREDDILAVITGETGRK 101


>gi|53721513|ref|YP_110498.1| co-chaperonin GroES [Burkholderia pseudomallei K96243]
 gi|126442428|ref|YP_001061736.1| co-chaperonin GroES [Burkholderia pseudomallei 668]
 gi|126456944|ref|YP_001074681.1| co-chaperonin GroES [Burkholderia pseudomallei 1106a]
 gi|134283064|ref|ZP_01769766.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|167722567|ref|ZP_02405803.1| co-chaperonin GroES [Burkholderia pseudomallei DM98]
 gi|167741544|ref|ZP_02414318.1| co-chaperonin GroES [Burkholderia pseudomallei 14]
 gi|167818738|ref|ZP_02450418.1| co-chaperonin GroES [Burkholderia pseudomallei 91]
 gi|167827113|ref|ZP_02458584.1| co-chaperonin GroES [Burkholderia pseudomallei 9]
 gi|167838938|ref|ZP_02465715.1| co-chaperonin GroES [Burkholderia thailandensis MSMB43]
 gi|167848611|ref|ZP_02474119.1| co-chaperonin GroES [Burkholderia pseudomallei B7210]
 gi|167897185|ref|ZP_02484587.1| co-chaperonin GroES [Burkholderia pseudomallei 7894]
 gi|167905558|ref|ZP_02492763.1| co-chaperonin GroES [Burkholderia pseudomallei NCTC 13177]
 gi|167921782|ref|ZP_02508873.1| co-chaperonin GroES [Burkholderia pseudomallei BCC215]
 gi|226196570|ref|ZP_03792151.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|237510473|ref|ZP_04523188.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|242311110|ref|ZP_04810127.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
 gi|254185403|ref|ZP_04891991.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|254187288|ref|ZP_04893802.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
 gi|254296718|ref|ZP_04964172.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
 gi|52211927|emb|CAH37932.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243]
 gi|126221919|gb|ABN85424.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668]
 gi|126230712|gb|ABN94125.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a]
 gi|134245712|gb|EBA45804.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|157806695|gb|EDO83865.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
 gi|157934970|gb|EDO90640.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
 gi|184209638|gb|EDU06681.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|225931446|gb|EEH27452.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|235002678|gb|EEP52102.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|242134349|gb|EES20752.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
          Length = 96

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD+ +EKP    GEI+ VG G  D  GK +EP+V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDSAAEKPD--QGEIVAVGPGRRDADGKRVEPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDIVAVV 94


>gi|295691040|ref|YP_003594733.1| chaperonin cpn10 [Caulobacter segnis ATCC 21756]
 gi|295432943|gb|ADG12115.1| Chaperonin Cpn10 [Caulobacter segnis ATCC 21756]
          Length = 96

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG G  +  G+V+  +V
Sbjct: 3   FRPLGDRVLVKRVEEETKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARNDKGEVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG++ L+M+ESD++G+V
Sbjct: 60  KAGDRILFGKWSGTEVKV-DGQDLLIMKESDVLGVV 94


>gi|126728132|ref|ZP_01743948.1| chaperonin, 10 kDa [Sagittula stellata E-37]
 gi|126711097|gb|EBA10147.1| chaperonin, 10 kDa [Sagittula stellata E-37]
          Length = 103

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 71/103 (68%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++S+ KTA G ++IPD+  EKP+   G ++  G G    SG++I+  V
Sbjct: 3   FKPLHDRVLVRRVESDEKTA-GGLIIPDSAKEKPA--EGVVVACGEGARKDSGELIDMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
            +GD VLFGKWSGTE+ +  GEE L+M+ESDI+GI+ ++   K
Sbjct: 60  KEGDKVLFGKWSGTEVNVG-GEELLIMKESDILGIITDDAAAK 101


>gi|146278226|ref|YP_001168385.1| co-chaperonin GroES [Rhodobacter sphaeroides ATCC 17025]
 gi|23813796|sp|Q93MH2|CH10_RHOPA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198402|sp|A4WUL6|CH10_RHOS5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|15290744|gb|AAK94942.1| GroES [Rhodopseudomonas palustris]
 gi|145556467|gb|ABP71080.1| chaperonin Cpn10 [Rhodobacter sphaeroides ATCC 17025]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR+QS+ KT  G ++IPDT  EKP+   GE++  G G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRVQSDEKT-KGGLIIPDTAKEKPA--EGEVVACGEGARKDSGELIAMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DG E L+M+ESDI+GI+
Sbjct: 60  KAGDRVLFGKWSGTEVTI-DGAELLIMKESDILGIL 94


>gi|171464108|ref|YP_001798221.1| chaperonin Cpn10 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|226704020|sp|B1XRX2|CH10_POLNS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|171193646|gb|ACB44607.1| chaperonin Cpn10 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 96

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++RL  E KTA+G I+IPD  +EKP    GE++ VG G  D  GK+  P+V
Sbjct: 3   LRPLHDRVIIKRLDQESKTASG-IIIPDAAAEKPD--QGEVLAVGPGKRDDGGKLNAPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ D EE +VM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DSEELIVMREDDIMAVV 94


>gi|16124939|ref|NP_419503.1| co-chaperonin GroES [Caulobacter crescentus CB15]
 gi|221233659|ref|YP_002516095.1| co-chaperonin GroES [Caulobacter crescentus NA1000]
 gi|239977084|sp|B8H164|CH10_CAUCN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|239977085|sp|P0CAU0|CH10_CAUCR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|13421907|gb|AAK22671.1| chaperonin, 10 kDa [Caulobacter crescentus CB15]
 gi|220962831|gb|ACL94187.1| chaperonin GroES [Caulobacter crescentus NA1000]
          Length = 96

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG G  +  G V+  +V
Sbjct: 3   FRPLGDRVLVKRVEEETKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARNDKGDVVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DG++ L+M+ESD++G+V
Sbjct: 60  KAGDRILFGKWSGTEVKV-DGQDLLIMKESDVLGVV 94


>gi|198282836|ref|YP_002219157.1| co-chaperonin GroES [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665198|ref|YP_002425035.1| chaperonin, 10 kDa [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226701715|sp|B7J562|CH10_ACIF2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701716|sp|B5EN20|CH10_ACIF5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|198247357|gb|ACH82950.1| chaperonin Cpn10 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517411|gb|ACK77997.1| chaperonin, 10 kDa [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 96

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RRL+ E KTA G I+IPDT  EKP    GEI+  G G + + GKV   +V
Sbjct: 3   LRPLHDRVVIRRLEEEQKTA-GGIIIPDTAKEKPV--RGEIVAAGHGKILEDGKVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTEIK+ +GEE LVM+E DIM ++
Sbjct: 60  KTGDQVLFAKYAGTEIKV-EGEELLVMREDDIMAVI 94


>gi|262198534|ref|YP_003269743.1| chaperonin Cpn10 [Haliangium ochraceum DSM 14365]
 gi|262081881|gb|ACY17850.1| chaperonin Cpn10 [Haliangium ochraceum DSM 14365]
          Length = 95

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+RL+ E +TA G + IPD+  EKP    G+++ VGAG  D++GK I  EV
Sbjct: 3   IRPLHDRILVKRLEEETQTA-GGLYIPDSAKEKPF--QGKVISVGAGKRDKAGKAIPVEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+SGTE+K+ +GEE+L+M+E DI+ ++
Sbjct: 60  KAGDKVLFSKYSGTEVKI-EGEEHLIMREDDILAVI 94


>gi|85859565|ref|YP_461767.1| co-chaperonin [Syntrophus aciditrophicus SB]
 gi|85722656|gb|ABC77599.1| co-chaperonin [Syntrophus aciditrophicus SB]
          Length = 98

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (66%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K   +P   R+VV R+ +E KTA G I+IPDT  EKP    G+I+ VG G  D  G +I 
Sbjct: 2   KMKFKPLHDRIVVSRVDAEEKTA-GGIIIPDTAKEKPQ--EGKIIAVGPGKRDNDGNIIP 58

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VLF KW+GTE KL DG+E+++M+E DI+GI+
Sbjct: 59  LDVKAGDRVLFSKWAGTEFKL-DGQEHMIMKEDDILGII 96


>gi|153209038|ref|ZP_01947217.1| 10 kDa chaperonin GroS [Coxiella burnetii 'MSU Goat Q177']
 gi|161831078|ref|YP_001597542.1| co-chaperonin GroES [Coxiella burnetii RSA 331]
 gi|165924023|ref|ZP_02219855.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 334]
 gi|116194|sp|P19422|CH10_COXBU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock protein A; AltName:
           Full=Protein Cpn10
 gi|189044100|sp|A9KC14|CH10_COXBN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189044101|sp|A9NA83|CH10_COXBR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|144997|gb|AAA23308.1| heat shock protein A (htpA) [Coxiella burnetii]
 gi|120575520|gb|EAX32144.1| 10 kDa chaperonin GroS [Coxiella burnetii 'MSU Goat Q177']
 gi|161762945|gb|ABX78587.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 331]
 gi|165916527|gb|EDR35131.1| 10 kDa chaperonin GroS [Coxiella burnetii RSA 334]
          Length = 96

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRRL+ E +T+ G I+IPD+ +EKPS   GE++ VG G    +G+V   +V
Sbjct: 3   IRPLHDRVVVRRLEEE-RTSAGGIVIPDSAAEKPS--RGEVISVGPGKPLDNGEVRSLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++GTE+KL  G+EY+VM+E DIMG++
Sbjct: 60  KVGDQILFGKYAGTEVKLA-GDEYIVMREDDIMGVI 94


>gi|77462861|ref|YP_352365.1| co-chaperonin GroES [Rhodobacter sphaeroides 2.4.1]
 gi|126461753|ref|YP_001042867.1| co-chaperonin GroES [Rhodobacter sphaeroides ATCC 17029]
 gi|221638731|ref|YP_002524993.1| co-chaperonin GroES [Rhodobacter sphaeroides KD131]
 gi|332557752|ref|ZP_08412074.1| co-chaperonin GroES [Rhodobacter sphaeroides WS8N]
 gi|20141217|sp|P25969|CH101_RHOSH RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|123592426|sp|Q3J420|CH10_RHOS4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198401|sp|A3PIC9|CH10_RHOS1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813853|sp|B9KPJ9|CH10_RHOSK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1208542|gb|AAB41335.1| chaperonin 10 [Rhodobacter sphaeroides]
 gi|77387279|gb|ABA78464.1| Chaperonin Cpn10 (GroES) [Rhodobacter sphaeroides 2.4.1]
 gi|126103417|gb|ABN76095.1| chaperonin Cpn10 [Rhodobacter sphaeroides ATCC 17029]
 gi|221159512|gb|ACM00492.1| 10 kDa chaperonin 1 [Rhodobacter sphaeroides KD131]
 gi|332275464|gb|EGJ20779.1| co-chaperonin GroES [Rhodobacter sphaeroides WS8N]
          Length = 95

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR+QS+ KT  G ++IPDT  EKP+   GE++  G G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRVQSDEKT-KGGLIIPDTAKEKPA--EGEVVSCGEGARKDSGELIAMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DG E L+M+ESDI+GI+
Sbjct: 60  KAGDRVLFGKWSGTEVTI-DGAELLIMKESDILGIL 94


>gi|76817441|ref|YP_337180.1| co-chaperonin GroES [Burkholderia pseudomallei 1710b]
 gi|167913869|ref|ZP_02500960.1| co-chaperonin GroES [Burkholderia pseudomallei 112]
 gi|254262673|ref|ZP_04953538.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
 gi|76581914|gb|ABA51388.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b]
 gi|254213675|gb|EET03060.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
          Length = 96

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD+ +EKP    GEI+ VG G  D  GK +EP+V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDSAAEKPD--QGEIVAVGPGRRDADGKRVEPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ ++
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDIVAVI 94


>gi|89069035|ref|ZP_01156416.1| Chaperonin Cpn10 (GroES) [Oceanicola granulosus HTCC2516]
 gi|89045404|gb|EAR51469.1| Chaperonin Cpn10 (GroES) [Oceanicola granulosus HTCC2516]
          Length = 103

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++S+ KT  G ++IPD   EKP+   G ++ VGAG  D+ G  I  +V
Sbjct: 3   FKPLHDRVLVRRVESDEKT-KGGLIIPDNAKEKPA--EGLVIAVGAGAKDEDGDRIAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD +LFGKWSGTE+ + DGEE L+M+ESDI+G++
Sbjct: 60  KEGDRILFGKWSGTEVTV-DGEELLIMKESDILGVI 94


>gi|320354778|ref|YP_004196117.1| Chaperonin Cpn10 [Desulfobulbus propionicus DSM 2032]
 gi|320123280|gb|ADW18826.1| Chaperonin Cpn10 [Desulfobulbus propionicus DSM 2032]
          Length = 96

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+RL+ E KTA G I+IPD+  EKP+   GEI+ VG G ++ +G+ +  +V
Sbjct: 3   IRPLNDRILVKRLEGEEKTA-GGIIIPDSAKEKPA--EGEIVAVGPGKLNDAGERVAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VLF K+ GTE+KL DGE++L+M+E DI+G+V
Sbjct: 60  AVGDRVLFSKYGGTEVKL-DGEDFLIMREDDILGVV 94


>gi|254497967|ref|ZP_05110731.1| co-chaperonin GroES [Legionella drancourtii LLAP12]
 gi|254352861|gb|EET11632.1| co-chaperonin GroES [Legionella drancourtii LLAP12]
          Length = 96

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E +T  G I+IPD+ +EKP    GE++ VGAG +  +G V    V
Sbjct: 3   IRPLHDRVVVRRMEEE-RTTAGGIVIPDSATEKPM--RGEVVAVGAGKVLDNGDVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SGTE+K+ DG+E +VM+E DIMG++
Sbjct: 60  KVGDVVLFGKYSGTEVKV-DGKELVVMREDDIMGVI 94


>gi|319941805|ref|ZP_08016127.1| chaperonin [Sutterella wadsworthensis 3_1_45B]
 gi|319804738|gb|EFW01605.1| chaperonin [Sutterella wadsworthensis 3_1_45B]
          Length = 95

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++RL++E  TA G I+IPDT  EKP    GE++ VG G  D++G ++  +V
Sbjct: 3   IRPLHDRVIIKRLEAETTTAFG-IVIPDTAGEKPD--QGEVIAVGPGKRDEAGHLVAMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DGEE LVM+E DIMG++
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGEELLVMREEDIMGVL 94


>gi|23813836|sp|Q9ZFD9|CH10_BURVI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|3916738|gb|AAC79088.1| 10 kDa heat shock protein GroES [Burkholderia vietnamiensis]
          Length = 97

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G +I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGALIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|218782075|ref|YP_002433393.1| chaperonin Cpn10 [Desulfatibacillum alkenivorans AK-01]
 gi|226701753|sp|B8FM87|CH10_DESAA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|218763459|gb|ACL05925.1| chaperonin Cpn10 [Desulfatibacillum alkenivorans AK-01]
          Length = 95

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R++V+RL  E KT  G I+IPDT  EKP+   GEI+ VG G   + G  I  EV
Sbjct: 3   LQPLADRILVKRLAEETKT-KGGIIIPDTAKEKPA--EGEIVAVGPGRNAEDGTKIALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ +GEEYL+M+E D++GIV
Sbjct: 60  KVGDRVLFGKYSGTEVKI-EGEEYLIMREDDVLGIV 94


>gi|85859339|ref|YP_461541.1| co-chaperonin GroES [Syntrophus aciditrophicus SB]
 gi|85722430|gb|ABC77373.1| co-chaperonin [Syntrophus aciditrophicus SB]
          Length = 96

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+RL+ E KT  G I+IPDT  EKP    GE++ VG G + + GK++  +V
Sbjct: 3   IRPLQDRVIVKRLEEEQKTK-GGIIIPDTAKEKPI--EGEVVAVGKGKVTEDGKLLPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+ GTE+K  DG+EYL+M+E DI+GIV
Sbjct: 60  KVGDRVLFSKYGGTEVKF-DGQEYLIMREDDILGIV 94


>gi|187927674|ref|YP_001898161.1| co-chaperonin GroES [Ralstonia pickettii 12J]
 gi|187724564|gb|ACD25729.1| chaperonin Cpn10 [Ralstonia pickettii 12J]
          Length = 96

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKKDDKGNAIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V +
Sbjct: 60  KVGDRVLFGKYAGQGVKV-DGQEVLVMREEDIMAVVAK 96


>gi|114797690|ref|YP_760662.1| chaperonin, 10 kDa [Hyphomonas neptunium ATCC 15444]
 gi|123027971|sp|Q0C0T1|CH10_HYPNA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|114737864|gb|ABI75989.1| chaperonin, 10 kDa [Hyphomonas neptunium ATCC 15444]
          Length = 96

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVVRR++ E KT  G I+IPD   EKP    G I+ VG G +    + +  +V
Sbjct: 3   LRPLHDRVVVRRVKEEEKT-KGGIIIPDNAKEKPQ--EGIIVAVGNGAIGDDNERVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLFGKWSGTE+K+ DGE+ L+M+ESDIMGI+
Sbjct: 60  KKGDRVLFGKWSGTEVKI-DGEDLLIMKESDIMGIL 94


>gi|241662151|ref|YP_002980511.1| co-chaperonin GroES [Ralstonia pickettii 12D]
 gi|309780746|ref|ZP_07675487.1| chaperonin GroS [Ralstonia sp. 5_7_47FAA]
 gi|240864178|gb|ACS61839.1| chaperonin Cpn10 [Ralstonia pickettii 12D]
 gi|308920428|gb|EFP66084.1| chaperonin GroS [Ralstonia sp. 5_7_47FAA]
          Length = 96

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKKDDKGNAIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQGVKV-DGQEVLVMREEDIMAVV 94


>gi|317487383|ref|ZP_07946172.1| chaperonin 10 kDa subunit [Bilophila wadsworthia 3_1_6]
 gi|316921360|gb|EFV42657.1| chaperonin 10 kDa subunit [Bilophila wadsworthia 3_1_6]
          Length = 95

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE +TA+G + IPDT  EKPS   GE++ VG G     GK++   V
Sbjct: 3   LKPLNDRVLVKRLESEERTASG-LYIPDTAKEKPS--KGEVVAVGPGKHADDGKLVPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLF K++GTE+K+ DG E+LVM+E DI+ I+
Sbjct: 60  KVGDMVLFNKYAGTEVKI-DGAEHLVMREDDILAII 94


>gi|86356910|ref|YP_468802.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
 gi|86281012|gb|ABC90075.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CFN 42]
          Length = 105

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            R    RVV+RR + ++ T+ G I+IPD   +KP    GE++ VG G+ DQSGK+   +V
Sbjct: 3   FRSLHDRVVIRRAEGDV-TSKGGIIIPDAAKDKPQ--EGEVVAVGPGLRDQSGKLAPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++LFGKWSGTE+ + DG+  L+++E+DIMGIV
Sbjct: 60  KVGDLILFGKWSGTEVTI-DGQTLLIIKEADIMGIV 94


>gi|222053507|ref|YP_002535869.1| chaperonin Cpn10 [Geobacter sp. FRC-32]
 gi|254813845|sp|B9LZ36|CH10_GEOSF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|221562796|gb|ACM18768.1| chaperonin Cpn10 [Geobacter sp. FRC-32]
          Length = 96

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++ E KTA G I IP+T  EKP    GE++ VG G   + GK++  +V
Sbjct: 3   LRPMQDRIIVKRVEEETKTA-GGIYIPETAKEKPQ--EGEVVAVGNGKRTEDGKILPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ +G++YL+M+E DI+G++
Sbjct: 60  KVGDKVLFGKYSGTEVKV-EGQDYLIMREDDILGVI 94


>gi|209363747|ref|YP_001423709.2| co-chaperonin GroES [Coxiella burnetii Dugway 5J108-111]
 gi|207081680|gb|ABS77081.2| 10 kDa chaperonin GROES [Coxiella burnetii Dugway 5J108-111]
          Length = 127

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRRL+ E +T+ G I+IPD+ +EKPS   GE++ VG G    +G+V   +V
Sbjct: 34  IRPLHDRVVVRRLEEE-RTSAGGIVIPDSAAEKPS--RGEVISVGPGKPLDNGEVRSLDV 90

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++GTE+KL  G+EY+VM+E DIMG++
Sbjct: 91  KVGDQILFGKYAGTEVKLA-GDEYIVMREDDIMGVI 125


>gi|71082867|ref|YP_265586.1| 10 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762710|ref|ZP_01264675.1| 10 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
 gi|123775543|sp|Q4FPA6|CH10_PELUB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|71061980|gb|AAZ20983.1| 10 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718512|gb|EAS85162.1| 10 kDa chaperonin [Candidatus Pelagibacter ubique HTCC1002]
          Length = 96

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 65/95 (68%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV++  L S  KTA G I+IPDT  EKP    G+++ VG G   + GK+I  +V
Sbjct: 3   FKPLHDRVLIEVLDSSEKTA-GGIIIPDTAQEKPQ--EGKVIAVGGGAKTEDGKLIPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLFGKWSGTEIK+ DG+EY +M+ESDIMGI
Sbjct: 60  KVGDKVLFGKWSGTEIKI-DGKEYSIMKESDIMGI 93


>gi|330993456|ref|ZP_08317391.1| 10 kDa chaperonin [Gluconacetobacter sp. SXCC-1]
 gi|329759486|gb|EGG75995.1| 10 kDa chaperonin [Gluconacetobacter sp. SXCC-1]
          Length = 86

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 4/89 (4%)

Query: 16  VVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVL 75
           +VVRRL+SE KTA G I+IP+T  EKP    GE++  G G  ++ G+++  +V  GD VL
Sbjct: 1   MVVRRLKSEEKTA-GGIIIPETAKEKPM--EGEVISAGPGARNEQGQIVALDVKAGDRVL 57

Query: 76  FGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           FGKWSGTE+ +N GEE L+M+ESDIMG+V
Sbjct: 58  FGKWSGTEVTIN-GEELLIMKESDIMGVV 85


>gi|317154297|ref|YP_004122345.1| Chaperonin Cpn10 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944548|gb|ADU63599.1| Chaperonin Cpn10 [Desulfovibrio aespoeensis Aspo-2]
          Length = 95

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+ E KTA G I IPD+  EKP    GE++  G G +D+ GK ++  V
Sbjct: 3   LKPLNDRVLVKRLEVEEKTA-GGIYIPDSAKEKPM--KGEVVAAGPGKLDEDGKRVKMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLF K++GTEI + DG+E+LVM+E DI+ IV
Sbjct: 60  KKGDTVLFAKYAGTEISV-DGDEHLVMREDDILAIV 94


>gi|148266316|ref|YP_001233022.1| co-chaperonin GroES [Geobacter uraniireducens Rf4]
 gi|189044105|sp|A5G9I1|CH10_GEOUR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|146399816|gb|ABQ28449.1| chaperonin Cpn10 [Geobacter uraniireducens Rf4]
          Length = 96

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++ E KTA G I IP+T  EKP    GE++ VG G   + GKV+  +V
Sbjct: 3   LRPMQDRIIVKRVEEETKTA-GGIFIPETAKEKPM--EGEVVAVGNGKRTEDGKVLPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTEIK+ +G+++L+M+E DI+G++
Sbjct: 60  KVGDKVLFGKYSGTEIKV-EGQDFLIMREDDILGVI 94


>gi|302381306|ref|YP_003817129.1| chaperonin Cpn10 [Brevundimonas subvibrioides ATCC 15264]
 gi|302191934|gb|ADK99505.1| Chaperonin Cpn10 [Brevundimonas subvibrioides ATCC 15264]
          Length = 94

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG GV D+ G V   E+
Sbjct: 3   FRPLGDRVLVKRVEEESKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGVRDERGTVNALEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+KL +GE+ ++M+ESD++G++
Sbjct: 60  KAGDRILFGKWSGTEVKL-EGEDLIIMKESDVLGVL 94


>gi|212211764|ref|YP_002302700.1| co-chaperonin GroES [Coxiella burnetii CbuG_Q212]
 gi|212217956|ref|YP_002304743.1| co-chaperonin GroES [Coxiella burnetii CbuK_Q154]
 gi|212010174|gb|ACJ17555.1| 10 kDa chaperonin GROES [Coxiella burnetii CbuG_Q212]
 gi|212012218|gb|ACJ19598.1| 10 kDa chaperonin GROES [Coxiella burnetii CbuK_Q154]
          Length = 127

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRRL+ E +T+ G I+IPD+ +EKPS   GE++ VG G    +G+V   +V
Sbjct: 34  IRPLHDRVVVRRLEEE-RTSAGGIVIPDSAAEKPS--RGEVISVGPGKPLDNGEVRSLDV 90

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++GTE+KL  G+EY+VM+E DIMG++
Sbjct: 91  KVGDQILFGKYAGTEVKLA-GDEYIVMREDDIMGVI 125


>gi|163797981|ref|ZP_02191923.1| co-chaperonin GroES [alpha proteobacterium BAL199]
 gi|159176775|gb|EDP61346.1| co-chaperonin GroES [alpha proteobacterium BAL199]
          Length = 104

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 69/103 (66%), Gaps = 4/103 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + RV++R ++   KT  G I+IPDT  EKP    GE++ +G G  D+ G +   +V
Sbjct: 3   LRPLQDRVLIRLIEQVSKT-PGGIIIPDTAKEKPV--EGEVLAIGPGARDERGALCPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111
             GD VLFGKWSGTE+K+ DGEE ++M+E+DI+GI+ +    K
Sbjct: 60  KVGDRVLFGKWSGTEVKI-DGEELMIMKETDILGILAQGAAKK 101


>gi|254460534|ref|ZP_05073950.1| chaperonin GroS [Rhodobacterales bacterium HTCC2083]
 gi|206677123|gb|EDZ41610.1| chaperonin GroS [Rhodobacteraceae bacterium HTCC2083]
          Length = 95

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRR + E KTA G ++IPD+  EKP+   G I+  G G    SG++IE  V
Sbjct: 3   LKPLHDRVLVRRTEGEEKTA-GGLIIPDSAKEKPA--EGVIVACGDGARKDSGELIEMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DGEE L+M+ESD++GI+
Sbjct: 60  KDGDRVLFGKWSGTEVSV-DGEELLMMKESDVLGIL 94


>gi|215919236|ref|NP_820700.2| co-chaperonin GroES [Coxiella burnetii RSA 493]
 gi|206584120|gb|AAO91214.2| 10 kDa chaperonin GROES [Coxiella burnetii RSA 493]
          Length = 116

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRRL+ E +T+ G I+IPD+ +EKPS   GE++ VG G    +G+V   +V
Sbjct: 23  IRPLHDRVVVRRLEEE-RTSAGGIVIPDSAAEKPS--RGEVISVGPGKPLDNGEVRSLDV 79

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++GTE+KL  G+EY+VM+E DIMG++
Sbjct: 80  KVGDQILFGKYAGTEVKLA-GDEYIVMREDDIMGVI 114


>gi|254253091|ref|ZP_04946409.1| Chaperonin Cpn10 [Burkholderia dolosa AUO158]
 gi|124895700|gb|EAY69580.1| Chaperonin Cpn10 [Burkholderia dolosa AUO158]
          Length = 99

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 5   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRDDKGAPIALDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 62  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 96


>gi|145589986|ref|YP_001156583.1| chaperonin Cpn10 [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|189044113|sp|A4SZV5|CH10_POLSQ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|145048392|gb|ABP35019.1| chaperonin Cpn10 [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++RL  E KTA+G I+IPD  +EKP    GEI+ VG G  D++GK+   +V
Sbjct: 3   LRPLHDRVIIKRLDQESKTASG-IIIPDAAAEKPD--QGEILAVGPGKRDEAGKLNPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E +VM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGDELIVMREDDIMAVV 94


>gi|17545360|ref|NP_518762.1| co-chaperonin GroES [Ralstonia solanacearum GMI1000]
 gi|23813787|sp|Q8Y1P9|CH10_RALSO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|17427652|emb|CAD14171.1| probable 10 kda chaperonin (protein cpn10) (groes protein)
           [Ralstonia solanacearum GMI1000]
 gi|299067818|emb|CBJ39029.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Ralstonia
           solanacearum CMR15]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKKDDKGNPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V +
Sbjct: 60  KVGDRVLFGKYAGQAVKV-DGQELLVMREEDIMAVVTK 96


>gi|83747557|ref|ZP_00944594.1| 10 kDa chaperonin GROES [Ralstonia solanacearum UW551]
 gi|207728089|ref|YP_002256483.1| 10 kda chaperonin [Ralstonia solanacearum MolK2]
 gi|207742484|ref|YP_002258876.1| 10 kda chaperonin (protein cpn10) (groes protein) [Ralstonia
           solanacearum IPO1609]
 gi|300704953|ref|YP_003746556.1| chaperone hsp10 (groes), part of groe chaperone system [Ralstonia
           solanacearum CFBP2957]
 gi|83725737|gb|EAP72878.1| 10 kDa chaperonin GROES [Ralstonia solanacearum UW551]
 gi|206591334|emb|CAQ56946.1| 10 kda chaperonin (protein cpn10) (groes protein) [Ralstonia
           solanacearum MolK2]
 gi|206593875|emb|CAQ60802.1| 10 kda chaperonin (protein cpn10) (groes protein) [Ralstonia
           solanacearum IPO1609]
 gi|299072617|emb|CBJ43967.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Ralstonia
           solanacearum CFBP2957]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKKDDKGNPISLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V +
Sbjct: 60  KVGDRVLFGKYAGQAVKV-DGQELLVMREEDIMAVVTK 96


>gi|237747350|ref|ZP_04577830.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229378701|gb|EEO28792.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R+  E  TA+G I+IPD  +EKP    GE++ VG G + + GKV+  +V
Sbjct: 3   LRPLQDRIIVKRVDQEKTTASG-IVIPDAAAEKPD--QGEVIAVGNGKVLEDGKVLPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SG  +K+ DGEE LVM ESD+M I+
Sbjct: 60  KVGDMVLFGKYSGQTVKV-DGEELLVMHESDVMAII 94


>gi|161525698|ref|YP_001580710.1| co-chaperonin GroES [Burkholderia multivorans ATCC 17616]
 gi|189349580|ref|YP_001945208.1| co-chaperonin GroES [Burkholderia multivorans ATCC 17616]
 gi|221201072|ref|ZP_03574112.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2M]
 gi|221206476|ref|ZP_03579489.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2]
 gi|221213808|ref|ZP_03586782.1| chaperonin, 10 kDa [Burkholderia multivorans CGD1]
 gi|160343127|gb|ABX16213.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616]
 gi|189333602|dbj|BAG42672.1| chaperonin GroES [Burkholderia multivorans ATCC 17616]
 gi|221166597|gb|EED99069.1| chaperonin, 10 kDa [Burkholderia multivorans CGD1]
 gi|221173785|gb|EEE06219.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2]
 gi|221178922|gb|EEE11329.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2M]
          Length = 97

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|6831503|sp|P94819|CH10_HOLOB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1754519|dbj|BAA14045.1| GroES [Holospora obtusa]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R++V+R+++E +T +G I+IPDT  EKP    G ++ VG G  D  G +I  EV
Sbjct: 4   FKPLGDRILVKRVEAEERT-SGGIVIPDTAKEKPI--EGTVIAVGPGARDPQGNLIALEV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFGKWSGTE+KL+ GE+Y+VM+ESD+ G +
Sbjct: 61  KQGDRVLFGKWSGTEVKLS-GEDYIVMKESDVFGTI 95


>gi|116196|sp|P26195|CH10_LEGMI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock protein A; AltName:
           Full=Protein Cpn10
 gi|227655|prf||1708212A heat shock protein
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E +T  G I+IPD+ +EKP+   GEI+ VG G + ++G V    V
Sbjct: 3   IRPLHDRVVVRRMEEE-RTTAGGIVIPDSATEKPT--RGEIIAVGPGKVLENGDVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SGTE+K++ G+E +VM+E DIMG++
Sbjct: 60  KVGDVVLFGKYSGTEVKIS-GQELVVMREDDIMGVI 94


>gi|315498219|ref|YP_004087023.1| chaperonin cpn10 [Asticcacaulis excentricus CB 48]
 gi|315416231|gb|ADU12872.1| Chaperonin Cpn10 [Asticcacaulis excentricus CB 48]
          Length = 96

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG G  ++ G+ +  +V
Sbjct: 3   FRPLGDRVLVKRVEEEAKT-KGGIIIPDTAKEKPQ--EGEVVAVGPGARNEKGEQVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKW GTE+KLN GE+ L+++ESDI+G+V
Sbjct: 60  KVGDRVLFGKWGGTEVKLN-GEDLLILKESDILGVV 94


>gi|313673979|ref|YP_004052090.1| chaperonin cpn10 [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940735|gb|ADR19927.1| Chaperonin Cpn10 [Calditerrivibrio nitroreducens DSM 19672]
          Length = 97

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P + RV+V+RL++E KTA+G I+IPDT  EKP    GE++  G G + ++G  IE  V
Sbjct: 4   IKPLQDRVLVKRLEAEEKTASG-IIIPDTAKEKPQ--EGEVIATGPGKVLENGTRIELTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++GTE+K+ DG EYL+M+E DI+GI+
Sbjct: 61  KPGDKILFSKYAGTEVKI-DGTEYLIMREDDILGII 95


>gi|255019599|ref|ZP_05291680.1| Heat shock protein 60 family co-chaperone GroES [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970943|gb|EET28424.1| Heat shock protein 60 family co-chaperone GroES [Acidithiobacillus
           caldus ATCC 51756]
          Length = 96

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RRL+ E KTA G I+IPDT  EKP    GE++ VG G + + GKV   ++
Sbjct: 3   LRPLHDRVVIRRLEEEQKTA-GGIIIPDTAKEKPV--QGEVVAVGNGKILEDGKVRALDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTEIK+ +GEE LVM+E D+M ++
Sbjct: 60  KPGDRVLFAKYAGTEIKV-EGEELLVMREDDVMAVI 94


>gi|308271140|emb|CBX27749.1| 10 kDa chaperonin [uncultured Desulfobacterium sp.]
          Length = 95

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R++V+R++ E  T  G I+IPDT  EKP+   G+++ VG G + + GKVI  EV
Sbjct: 3   LKPLHDRILVQRVE-EPTTTKGGIIIPDTAKEKPA--EGKVVAVGNGKIGEDGKVIPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD +LFGK+SG+E+K+ +G+EYL+M+E D++GI+
Sbjct: 60  KKGDRILFGKYSGSEVKI-EGDEYLIMREDDVLGII 94


>gi|255263476|ref|ZP_05342818.1| chaperonin GroS [Thalassiobium sp. R2A62]
 gi|255105811|gb|EET48485.1| chaperonin GroS [Thalassiobium sp. R2A62]
          Length = 95

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P + RV VRR++SE KTA G ++IPDT  EKP+   G ++ VG G    SG++I   +
Sbjct: 3   LKPLQDRVTVRRIESEEKTA-GGLIIPDTAKEKPA--EGIVVAVGEGARKDSGELIAMTL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D +LFGKWSGTEI + DGEE L+M+ESD++GI+
Sbjct: 60  KADDKILFGKWSGTEITV-DGEELLIMKESDVLGIL 94


>gi|237749499|ref|ZP_04579979.1| predicted protein [Oxalobacter formigenes OXCC13]
 gi|229380861|gb|EEO30952.1| predicted protein [Oxalobacter formigenes OXCC13]
          Length = 96

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R+  E  TA+G I+IPD  +EKP    GE++ VG G + + GKV+  +V
Sbjct: 3   LRPLQDRIIVKRVDQEKTTASG-IVIPDNAAEKPD--QGEVIAVGNGKVLEDGKVLPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVLFGK+SG  +K+ +GEE LVM ESD+M IV
Sbjct: 60  KVGDIVLFGKYSGQTVKV-EGEELLVMHESDVMAIV 94


>gi|87198060|ref|YP_495317.1| chaperonin Cpn10 [Novosphingobium aromaticivorans DSM 12444]
 gi|123736336|sp|Q2GCC7|CH10_NOVAD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|87133741|gb|ABD24483.1| chaperonin Cpn10 [Novosphingobium aromaticivorans DSM 12444]
          Length = 95

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR+++E KTA G I+IPD+  EKP+   G ++ VG+G   ++G +   +V
Sbjct: 3   FRPLHDRVLVRRVEAEEKTA-GGIIIPDSAKEKPA--EGIVVAVGSGARAENGTITPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D VLFGKWSGTE+K+ DGE+ L+M+ESDI+G++
Sbjct: 60  KANDRVLFGKWSGTEVKV-DGEDLLIMKESDILGVI 94


>gi|254456642|ref|ZP_05070071.1| chaperonin GroS [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083644|gb|EDZ61070.1| chaperonin GroS [Candidatus Pelagibacter sp. HTCC7211]
          Length = 96

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 65/95 (68%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV++  L S  KTA G I+IPDT  EKP    G+++ VG G   + GK+I  +V
Sbjct: 3   FKPLHDRVLIEVLDSSEKTA-GGIIIPDTAQEKPQ--EGKVVAVGGGAKTEDGKLIPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLFGKWSGTE+K+ DG+EY +M+ESDIMGI
Sbjct: 60  KVGDKVLFGKWSGTEVKI-DGKEYSIMKESDIMGI 93


>gi|298292875|ref|YP_003694814.1| chaperonin Cpn10 [Starkeya novella DSM 506]
 gi|296929386|gb|ADH90195.1| Chaperonin Cpn10 [Starkeya novella DSM 506]
          Length = 105

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVV+RR + +  +  G I+IPDT  EKP    GE++  G G  D+SGK++  +V
Sbjct: 3   FRPLHDRVVIRRSEGDPVSEDG-IIIPDTAKEKPQ--QGEVVAHGPGQRDESGKLVPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGKWSGTE+K+ DGE+ L+++E+D++G+V
Sbjct: 60  QTGDLVLFGKWSGTEVKI-DGEDLLIIKEADLLGVV 94


>gi|254191746|ref|ZP_04898249.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
 gi|254298986|ref|ZP_04966436.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
 gi|157809140|gb|EDO86310.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
 gi|157939417|gb|EDO95087.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
          Length = 99

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 5   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGAPIALDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 62  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 96


>gi|46580386|ref|YP_011194.1| co-chaperonin GroES [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602242|ref|YP_966642.1| co-chaperonin GroES [Desulfovibrio vulgaris DP4]
 gi|81699064|sp|Q72AL5|CH10_DESVH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166234000|sp|A1VCP9|CH10_DESVV RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|46449803|gb|AAS96453.1| chaperonin, 10 kDa [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562471|gb|ABM28215.1| chaperonin Cpn10 [Desulfovibrio vulgaris DP4]
 gi|311233639|gb|ADP86493.1| Chaperonin Cpn10 [Desulfovibrio vulgaris RCH1]
          Length = 95

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE KTA G + IPDT  EKPS   GE++  G G     GK++   V
Sbjct: 3   LKPLNDRVLVKRLESEEKTA-GGLYIPDTAKEKPS--RGEVVAAGPGKTADDGKLVAMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLF K++GTEIK+ DG E+LVM+E DI+ I+
Sbjct: 60  KAGDMVLFNKYAGTEIKI-DGVEHLVMREDDILAII 94


>gi|399238|sp|P31295|CH10_CHRVI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|145008|gb|AAA23318.1| GroES [Allochromatium vinosum DSM 180]
          Length = 96

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E + + G I+IPD+ +EKP    GEI+ VG G +  +G V   +V
Sbjct: 3   IRPLHDRVVVRRMEEE-RLSAGGIVIPDSATEKPI--QGEIIAVGHGKILDNGSVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+KL DG+E+LVM+E DIM +V
Sbjct: 60  KVGDSVLFGKYSGTEVKL-DGKEFLVMREEDIMAVV 94


>gi|330815713|ref|YP_004359418.1| chaperonin, 10 kDa [Burkholderia gladioli BSR3]
 gi|327368106|gb|AEA59462.1| chaperonin, 10 kDa [Burkholderia gladioli BSR3]
          Length = 97

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|73542342|ref|YP_296862.1| co-chaperonin GroES [Ralstonia eutropha JMP134]
 gi|94309560|ref|YP_582770.1| co-chaperonin GroES [Cupriavidus metallidurans CH34]
 gi|194288825|ref|YP_002004732.1| co-chaperonin groes [Cupriavidus taiwanensis LMG 19424]
 gi|123260360|sp|Q1LQS5|CH10_RALME RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123774039|sp|Q46XW5|CH10_RALEJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701750|sp|B3R2Y2|CH10_CUPTR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|72119755|gb|AAZ62018.1| Chaperonin Cpn10 [Ralstonia eutropha JMP134]
 gi|93353412|gb|ABF07501.1| Cpn10 chaperonin GroES, small subunit of GroESL [Cupriavidus
           metallidurans CH34]
 gi|193222660|emb|CAQ68663.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Cupriavidus
           taiwanensis LMG 19424]
          Length = 96

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDNAAEKPD--QGEVLAIGPGKKDDKGNNIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQGVKV-DGQELLVMREEDIMAVV 94


>gi|196017870|ref|XP_002118666.1| hypothetical protein TRIADDRAFT_34560 [Trichoplax adhaerens]
 gi|190578506|gb|EDV18846.1| hypothetical protein TRIADDRAFT_34560 [Trichoplax adhaerens]
          Length = 94

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V RL+ E KT +G I+IPDT  EKP    G+++  G G+ D+ G V   +V
Sbjct: 3   FQPLHDRVLVERLEQENKTESG-IIIPDTAKEKPM--QGKVIAAGKGIKDEKGNVSPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF KW GTE+KL +G+EYL+M+ESDI+GIV
Sbjct: 60  KVGDKILFAKWGGTEVKL-EGKEYLIMKESDILGIV 94


>gi|304319879|ref|YP_003853522.1| co-chaperonin GroES [Parvularcula bermudensis HTCC2503]
 gi|303298782|gb|ADM08381.1| co-chaperonin GroES [Parvularcula bermudensis HTCC2503]
          Length = 95

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR++ + +TA G I+IPDT  EKP    GE++ VG+G      +++  E+
Sbjct: 3   FRPLHDRVLVRRVEEDERTA-GGIIIPDTAKEKPQ--QGEVVAVGSGARGDDNEIVPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+K+ DGE+ ++M+ESD++GI+
Sbjct: 60  KAGDKILFGKWSGTEVKV-DGEDLIIMKESDVLGIL 94


>gi|53720308|ref|YP_109294.1| co-chaperonin GroES [Burkholderia pseudomallei K96243]
 gi|53725993|ref|YP_103589.1| co-chaperonin GroES [Burkholderia mallei ATCC 23344]
 gi|67643862|ref|ZP_00442605.1| chaperonin GroS [Burkholderia mallei GB8 horse 4]
 gi|76808812|ref|YP_334548.1| co-chaperonin GroES [Burkholderia pseudomallei 1710b]
 gi|115350786|ref|YP_772625.1| co-chaperonin GroES [Burkholderia ambifaria AMMD]
 gi|121600115|ref|YP_992251.1| co-chaperonin GroES [Burkholderia mallei SAVP1]
 gi|124385024|ref|YP_001028693.1| co-chaperonin GroES [Burkholderia mallei NCTC 10229]
 gi|126440709|ref|YP_001060130.1| co-chaperonin GroES [Burkholderia pseudomallei 668]
 gi|126448254|ref|YP_001081401.1| co-chaperonin GroES [Burkholderia mallei NCTC 10247]
 gi|126453024|ref|YP_001067392.1| co-chaperonin GroES [Burkholderia pseudomallei 1106a]
 gi|134280542|ref|ZP_01767253.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|134294905|ref|YP_001118640.1| co-chaperonin GroES [Burkholderia vietnamiensis G4]
 gi|167000849|ref|ZP_02266654.1| chaperonin, 10 kDa [Burkholderia mallei PRL-20]
 gi|167590188|ref|ZP_02382576.1| co-chaperonin GroES [Burkholderia ubonensis Bu]
 gi|167720888|ref|ZP_02404124.1| co-chaperonin GroES [Burkholderia pseudomallei DM98]
 gi|167739868|ref|ZP_02412642.1| co-chaperonin GroES [Burkholderia pseudomallei 14]
 gi|167817089|ref|ZP_02448769.1| co-chaperonin GroES [Burkholderia pseudomallei 91]
 gi|167825499|ref|ZP_02456970.1| co-chaperonin GroES [Burkholderia pseudomallei 9]
 gi|167846989|ref|ZP_02472497.1| co-chaperonin GroES [Burkholderia pseudomallei B7210]
 gi|167895572|ref|ZP_02482974.1| co-chaperonin GroES [Burkholderia pseudomallei 7894]
 gi|167908574|ref|ZP_02495779.1| co-chaperonin GroES [Burkholderia pseudomallei NCTC 13177]
 gi|167912220|ref|ZP_02499311.1| co-chaperonin GroES [Burkholderia pseudomallei 112]
 gi|167920181|ref|ZP_02507272.1| co-chaperonin GroES [Burkholderia pseudomallei BCC215]
 gi|170701766|ref|ZP_02892701.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
 gi|171319259|ref|ZP_02908374.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
 gi|172059809|ref|YP_001807461.1| co-chaperonin GroES [Burkholderia ambifaria MC40-6]
 gi|206561491|ref|YP_002232256.1| co-chaperonin GroES [Burkholderia cenocepacia J2315]
 gi|217421245|ref|ZP_03452750.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
 gi|226193803|ref|ZP_03789405.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|237813521|ref|YP_002897972.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|242316935|ref|ZP_04815951.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
 gi|254175760|ref|ZP_04882420.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399]
 gi|254180901|ref|ZP_04887499.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|254196054|ref|ZP_04902479.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|254202280|ref|ZP_04908643.1| chaperonin, 10 kDa [Burkholderia mallei FMH]
 gi|254207613|ref|ZP_04913963.1| chaperonin, 10 kDa [Burkholderia mallei JHU]
 gi|254259483|ref|ZP_04950537.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
 gi|254356486|ref|ZP_04972762.1| chaperonin, 10 kDa [Burkholderia mallei 2002721280]
 gi|23813837|sp|Q9ZFE1|CH10_BURCE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|3916735|gb|AAC79086.1| 10 kDa heat shock protein GroES [Burkholderia cepacia]
 gi|52210722|emb|CAH36706.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243]
 gi|52429416|gb|AAU50009.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344]
 gi|76578265|gb|ABA47740.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b]
 gi|115280774|gb|ABI86291.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD]
 gi|121228925|gb|ABM51443.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1]
 gi|124293044|gb|ABN02313.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229]
 gi|126220202|gb|ABN83708.1| chaperonin GroS [Burkholderia pseudomallei 668]
 gi|126226666|gb|ABN90206.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a]
 gi|126241124|gb|ABO04217.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247]
 gi|134138062|gb|ABO53805.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4]
 gi|134248549|gb|EBA48632.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|147746527|gb|EDK53604.1| chaperonin, 10 kDa [Burkholderia mallei FMH]
 gi|147751507|gb|EDK58574.1| chaperonin, 10 kDa [Burkholderia mallei JHU]
 gi|148025483|gb|EDK83637.1| chaperonin, 10 kDa [Burkholderia mallei 2002721280]
 gi|160696804|gb|EDP86774.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399]
 gi|169652798|gb|EDS85491.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|170133314|gb|EDT01707.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
 gi|171095516|gb|EDT40481.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
 gi|171992326|gb|ACB63245.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6]
 gi|184211440|gb|EDU08483.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|198037533|emb|CAR53470.1| 10 kDa chaperonin 1 [Burkholderia cenocepacia J2315]
 gi|217396657|gb|EEC36674.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
 gi|225934108|gb|EEH30093.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|237504824|gb|ACQ97142.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|238525311|gb|EEP88739.1| chaperonin GroS [Burkholderia mallei GB8 horse 4]
 gi|242140174|gb|EES26576.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
 gi|243063278|gb|EES45464.1| chaperonin, 10 kDa [Burkholderia mallei PRL-20]
 gi|254218172|gb|EET07556.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
 gi|325528869|gb|EGD05911.1| co-chaperonin GroES [Burkholderia sp. TJI49]
          Length = 97

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|288940191|ref|YP_003442431.1| chaperonin cpn10 [Allochromatium vinosum DSM 180]
 gi|288895563|gb|ADC61399.1| Chaperonin Cpn10 [Allochromatium vinosum DSM 180]
          Length = 96

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E + + G I+IPD+ +EKP    GEI+ VG G +  +G V   +V
Sbjct: 3   IRPLHDRVVVRRMEEE-RLSAGGIVIPDSATEKPI--QGEIIAVGHGKILDNGSVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+KL DG+E+LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYSGTEVKL-DGKEFLVMREEDIMAVV 94


>gi|209518800|ref|ZP_03267614.1| chaperonin Cpn10 [Burkholderia sp. H160]
 gi|209500770|gb|EEA00812.1| chaperonin Cpn10 [Burkholderia sp. H160]
          Length = 96

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E +TA+G I+IPD+ +EKP    GEI+ VG G   + GK +EP++
Sbjct: 3   LRPLHDRVIVKRLDQETRTASG-IVIPDSAAEKPD--QGEILAVGPGRRGEDGKRVEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 60  QVGDRVLFGKYAGQAVKV-DGNELLVLREEDIVAVV 94


>gi|312797114|ref|YP_004030036.1| 10 kDa chaperonin GROES [Burkholderia rhizoxinica HKI 454]
 gi|312168889|emb|CBW75892.1| 10 kDa chaperonin GROES [Burkholderia rhizoxinica HKI 454]
          Length = 96

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGAQIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|83719093|ref|YP_442003.1| co-chaperonin GroES [Burkholderia thailandensis E264]
 gi|167563843|ref|ZP_02356759.1| co-chaperonin GroES [Burkholderia oklahomensis EO147]
 gi|167570981|ref|ZP_02363855.1| co-chaperonin GroES [Burkholderia oklahomensis C6786]
 gi|167580840|ref|ZP_02373714.1| co-chaperonin GroES [Burkholderia thailandensis TXDOH]
 gi|167618942|ref|ZP_02387573.1| co-chaperonin GroES [Burkholderia thailandensis Bt4]
 gi|167837624|ref|ZP_02464507.1| co-chaperonin GroES [Burkholderia thailandensis MSMB43]
 gi|257138185|ref|ZP_05586447.1| co-chaperonin GroES [Burkholderia thailandensis E264]
 gi|83652918|gb|ABC36981.1| chaperonin, 10 kDa [Burkholderia thailandensis E264]
          Length = 97

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAIGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|78065428|ref|YP_368197.1| co-chaperonin GroES [Burkholderia sp. 383]
 gi|77966173|gb|ABB07553.1| Chaperonin Cpn10, groES protein [Burkholderia sp. 383]
          Length = 97

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|126733620|ref|ZP_01749367.1| Chaperonin Cpn10 (GroES) [Roseobacter sp. CCS2]
 gi|126716486|gb|EBA13350.1| Chaperonin Cpn10 (GroES) [Roseobacter sp. CCS2]
          Length = 94

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR++ + KTA G ++IP+   EKP+   GEI+ VG G    SG++I   V
Sbjct: 3   FTPLHDRVLVRRIEGDEKTA-GGLIIPENAKEKPA--EGEIVSVGEGARKDSGELIAMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+K+ DGE+ L+M+ESDI+GI+
Sbjct: 60  KAGDKVLFGKWSGTEVKI-DGEDLLIMKESDILGIM 94


>gi|186477085|ref|YP_001858555.1| co-chaperonin GroES [Burkholderia phymatum STM815]
 gi|226701732|sp|B2JFE1|CH10_BURP8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|184193544|gb|ACC71509.1| chaperonin Cpn10 [Burkholderia phymatum STM815]
          Length = 96

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|330820707|ref|YP_004349569.1| co-chaperonin GroES [Burkholderia gladioli BSR3]
 gi|327372702|gb|AEA64057.1| co-chaperonin GroES [Burkholderia gladioli BSR3]
          Length = 96

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I++PD+ +EKP    GE++ VG G  D  GK IEP++
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVLPDSAAEKPD--QGEVIAVGPGRRDNDGKRIEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ D  E LV++E D++ +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DSNELLVLREEDVVAVV 94


>gi|71906065|ref|YP_283652.1| co-chaperonin GroES [Dechloromonas aromatica RCB]
 gi|123733379|sp|Q47IZ9|CH10_DECAR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|71845686|gb|AAZ45182.1| Chaperonin Cpn10 [Dechloromonas aromatica RCB]
          Length = 96

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R+++E  TA+G I+IPD+  EKP    GE++ VG G  D +GK I  +V
Sbjct: 3   IRPLHDRVIVKRVEAERTTASG-IVIPDSAGEKPD--QGEVLAVGPGKRDDNGKQIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGK++G  +K+ DG+E LVM+E DIMG++V
Sbjct: 60  KVGDRVLFGKYAGQAVKV-DGQEVLVMREEDIMGVLV 95


>gi|253995802|ref|YP_003047866.1| chaperonin Cpn10 [Methylotenera mobilis JLW8]
 gi|253982481|gb|ACT47339.1| chaperonin Cpn10 [Methylotenera mobilis JLW8]
          Length = 95

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R + E  TA+G I+IPD+ +EKP    G I  VG+G  D+SGKVI  +V
Sbjct: 3   IRPLHDRVIVKRSEEERTTASG-IVIPDSATEKPD--QGVIQAVGSGKRDESGKVIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E DIM IV
Sbjct: 60  KVGDKVLFGKYAGQTVKV-DGEELLVMREEDIMAIV 94


>gi|256821493|ref|YP_003145456.1| chaperonin Cpn10 [Kangiella koreensis DSM 16069]
 gi|256795032|gb|ACV25688.1| chaperonin Cpn10 [Kangiella koreensis DSM 16069]
          Length = 96

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+VRRL+ E  T+ G I+IPD   EKPS   GEI+ VG G    SG+V   +V
Sbjct: 3   LRPLHDRVIVRRLEEET-TSAGGIVIPDNAKEKPS--RGEILAVGNGKPLDSGEVRAVDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+K  DGEE LV++E DIM ++
Sbjct: 60  KVGDKVLFGKYAGTEVK-ADGEELLVLREDDIMAVI 94


>gi|288940592|ref|YP_003442832.1| chaperonin cpn10 [Allochromatium vinosum DSM 180]
 gi|288895964|gb|ADC61800.1| Chaperonin Cpn10 [Allochromatium vinosum DSM 180]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E +T+ G ILIPD+ +EKPS   GE++ VG G +  +G V   +V
Sbjct: 3   LRPLHDRVVIRRSEEE-RTSAGGILIPDSATEKPS--QGEVVAVGKGKILDNGDVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ D E+ LVM+E D+MG++
Sbjct: 60  KVGDRVLFGKYSGTEVKVGD-EKLLVMREDDLMGVI 94


>gi|303258260|ref|ZP_07344267.1| chaperonin GroS [Burkholderiales bacterium 1_1_47]
 gi|331001098|ref|ZP_08324729.1| chaperonin GroS [Parasutterella excrementihominis YIT 11859]
 gi|302859013|gb|EFL82097.1| chaperonin GroS [Burkholderiales bacterium 1_1_47]
 gi|329569403|gb|EGG51181.1| chaperonin GroS [Parasutterella excrementihominis YIT 11859]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R+ +E +TA+G I IP+   EKP    G ++ VG G  D++GK+I  +V
Sbjct: 3   IRPLHDRVIVKRVDAETRTASG-IYIPEAAGEKPD--QGVVLAVGPGKRDEAGKLIPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SG  +K+ DG+EYLVM+E DIMG++
Sbjct: 60  KVGDRILFGKYSGQNVKV-DGDEYLVMREEDIMGVL 94


>gi|323524999|ref|YP_004227152.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1001]
 gi|323382001|gb|ADX54092.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1001]
          Length = 96

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAAIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|209521975|ref|ZP_03270639.1| chaperonin Cpn10 [Burkholderia sp. H160]
 gi|295675681|ref|YP_003604205.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1002]
 gi|307728789|ref|YP_003906013.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1003]
 gi|209497589|gb|EDZ97780.1| chaperonin Cpn10 [Burkholderia sp. H160]
 gi|295435524|gb|ADG14694.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1002]
 gi|307583324|gb|ADN56722.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1003]
          Length = 96

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAAIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|189425978|ref|YP_001953155.1| chaperonin Cpn10 [Geobacter lovleyi SZ]
 gi|226701771|sp|B3E8F9|CH10_GEOLS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189422237|gb|ACD96635.1| chaperonin Cpn10 [Geobacter lovleyi SZ]
          Length = 96

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL+ E KTA G + IPDT  EKP    GE++ VG G  +  GK    +V
Sbjct: 3   LRPLHDRIIVKRLEGEEKTA-GGLFIPDTAKEKPQ--KGEVIAVGNGKKNDEGKCAPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++GTE+K+ DG+E+L+M+E D++ ++
Sbjct: 60  KVGDSILFGKYAGTEVKV-DGDEFLMMREDDVLAVI 94


>gi|254246163|ref|ZP_04939484.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
 gi|124870939|gb|EAY62655.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
          Length = 99

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 5   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAPIALDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 62  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 96


>gi|325983086|ref|YP_004295488.1| Chaperonin Cpn10 [Nitrosomonas sp. AL212]
 gi|325532605|gb|ADZ27326.1| Chaperonin Cpn10 [Nitrosomonas sp. AL212]
          Length = 96

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPD+ +EKP    GEI+ +G G +   GK+   EV
Sbjct: 3   IRPLHDRVIVKRLEDERKTASG-IVIPDSAAEKPD--QGEILAIGKGKVGDDGKIRPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+  GEE LVM+E DIMG++
Sbjct: 60  KVGDKVLFGKYAGQSVKVQ-GEELLVMREEDIMGVI 94


>gi|303327148|ref|ZP_07357590.1| chaperonin GroS [Desulfovibrio sp. 3_1_syn3]
 gi|302863136|gb|EFL86068.1| chaperonin GroS [Desulfovibrio sp. 3_1_syn3]
          Length = 95

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE KTA G + IPDT  EKPS   G+++ VG G + ++G  +   V
Sbjct: 3   LKPLNDRVLVKRLESEEKTA-GGLYIPDTAKEKPS--KGQVVAVGPGKIAENGSRVAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLF K++GTEIKL DG ++LVM+E DI+ I+
Sbjct: 60  KKGDEVLFNKYAGTEIKL-DGVDHLVMREEDILAII 94


>gi|113866732|ref|YP_725221.1| co-chaperonin GroES [Ralstonia eutropha H16]
 gi|123134359|sp|Q0KDR8|CH10_RALEH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|40714532|dbj|BAD06927.1| molecular chaperone GroES [Ralstonia pickettii]
 gi|113525508|emb|CAJ91853.1| Co-chaperonin GroES (HSP10) [Ralstonia eutropha H16]
          Length = 96

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDNAAEKPD--QGEVLAIGPGKKDDKGNNIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ +G+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQAVKV-EGQELLVMREEDIMAVV 94


>gi|107021935|ref|YP_620262.1| co-chaperonin GroES [Burkholderia cenocepacia AU 1054]
 gi|116688882|ref|YP_834505.1| co-chaperonin GroES [Burkholderia cenocepacia HI2424]
 gi|170732183|ref|YP_001764130.1| co-chaperonin GroES [Burkholderia cenocepacia MC0-3]
 gi|105892124|gb|ABF75289.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054]
 gi|116646971|gb|ABK07612.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424]
 gi|169815425|gb|ACA90008.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3]
          Length = 97

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGQELLVMREEDIMAVV 94


>gi|114764192|ref|ZP_01443430.1| Chaperonin Cpn10 (GroES) [Pelagibaca bermudensis HTCC2601]
 gi|114543344|gb|EAU46360.1| Chaperonin Cpn10 (GroES) [Roseovarius sp. HTCC2601]
          Length = 97

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++S+ KT  G ++IPD+  EKP+   G ++  G G    +G++I   V
Sbjct: 3   FKPLHDRVLVRRVESDEKT-KGGLIIPDSAKEKPA--EGVVVACGEGARKDNGELISMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           S+GD VLFGKWSGTE+ + DGEE L+M+ESDI+GI
Sbjct: 60  SEGDRVLFGKWSGTEVSI-DGEELLIMKESDILGI 93


>gi|118581210|ref|YP_902460.1| co-chaperonin GroES [Pelobacter propionicus DSM 2379]
 gi|166198391|sp|A1AST2|CH10_PELPD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118503920|gb|ABL00403.1| chaperonin Cpn10 [Pelobacter propionicus DSM 2379]
          Length = 95

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+R++ E KTA G + IP+T  EKP    GE++  G G   + GKV+  +V
Sbjct: 3   LRPLHDRILVKRVEEETKTA-GGLFIPETAKEKPQ--RGEVVAAGNGKKTEDGKVLPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ DGE++L+M+E DI+ +V
Sbjct: 60  KVGDKVLFGKYSGTEVKV-DGEDFLMMREDDILAVV 94


>gi|317404762|gb|EFV85145.1| chaperonin [Achromobacter xylosoxidans C54]
          Length = 105

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (67%), Gaps = 4/102 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+R++ + KTA+G I+IPD+ +EKP    GE++ VG G  +  G + EPE+
Sbjct: 3   IRPLYDRIIVKRIEQQRKTASG-IVIPDSAAEKPE--QGEVLAVGQGKRNADGSLREPEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKN 110
             GD VLFGK++G  +K+ DGEE LVM+E DI  ++  + K 
Sbjct: 60  KVGDHVLFGKYAGQTVKV-DGEELLVMREDDIFAVLTPQDKQ 100


>gi|82703462|ref|YP_413028.1| co-chaperonin GroES [Nitrosospira multiformis ATCC 25196]
 gi|123727099|sp|Q2Y6I5|CH10_NITMU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|82411527|gb|ABB75636.1| Chaperonin Cpn10 [Nitrosospira multiformis ATCC 25196]
          Length = 96

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPD+ +EKP    GEI+ VG G +   G V   EV
Sbjct: 3   IRPLHDRVIVKRLEEERKTASG-IVIPDSAAEKPD--QGEIIAVGKGKVGDDGNVRPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K++ GEE LVM+E DIMG+V
Sbjct: 60  KVGDKVLFGKYSGQTVKIS-GEELLVMREEDIMGVV 94


>gi|300692353|ref|YP_003753348.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
 gi|299079413|emb|CBJ52084.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Ralstonia
           solanacearum PSI07]
          Length = 96

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD  +EKP    GE++ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKKDDKGNPIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQSVKV-DGLEVLVMREEDIMAVV 94


>gi|329847961|ref|ZP_08262989.1| 10 kDa chaperonin [Asticcacaulis biprosthecum C19]
 gi|328843024|gb|EGF92593.1| 10 kDa chaperonin [Asticcacaulis biprosthecum C19]
          Length = 96

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++ VG G  ++ G+ +  +V
Sbjct: 3   FRPLGDRVLVKRVEEEAKT-KGGIIIPDTAKEKPQ--EGEVVSVGPGARNEKGEQVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGKW GTE+K+ DG++ L+++ESDI+G++V
Sbjct: 60  KAGDRVLFGKWGGTEVKI-DGDDLLILKESDILGVLV 95


>gi|78221256|ref|YP_383003.1| co-chaperonin GroES [Geobacter metallireducens GS-15]
 gi|123756541|sp|Q39ZP6|CH10_GEOMG RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78192511|gb|ABB30278.1| Chaperonin Cpn10 [Geobacter metallireducens GS-15]
          Length = 95

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++ E  TA G I IPDT  EKP    GEI+ VG G   + GKVI  ++
Sbjct: 3   LRPLQDRILVKRIEEEQVTA-GGIFIPDTAKEKPQ--RGEIVAVGNGKKTEDGKVIPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GT+IK+ +GE++L+M+E DI+G++
Sbjct: 60  KVGDKVLFGKYAGTDIKV-EGEDFLIMREDDILGVI 94


>gi|51244043|ref|YP_063927.1| chaperonin GroES [Desulfotalea psychrophila LSv54]
 gi|81692985|sp|Q6ARV5|CH10_DESPS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|50875080|emb|CAG34920.1| probable chaperonin GroES [Desulfotalea psychrophila LSv54]
          Length = 95

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+RL  E KTA G I+IPD+  EKP+   G+++ VG G +  SG+ +  +V
Sbjct: 3   IRPLNDRLLVKRLAEEEKTA-GGIIIPDSAKEKPA--EGQVVAVGPGKVSDSGERVALQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+VLF K+ GT++KL DGE++L+M+E DI+GI+
Sbjct: 60  KEGDLVLFSKYGGTDVKL-DGEDFLIMREDDILGIM 94


>gi|301060766|ref|ZP_07201581.1| chaperonin GroS [delta proteobacterium NaphS2]
 gi|300445163|gb|EFK09113.1| chaperonin GroS [delta proteobacterium NaphS2]
          Length = 95

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+R++ E KT  G I+IPDT  EKP    G IM VG G +   GK I  EV
Sbjct: 3   VKPLHDRVIVKRVEEEEKT-KGGIIIPDTAKEKPV--EGVIMAVGEGKVGDDGKKIALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTEI++ DGEE+L+M+E DI+ IV
Sbjct: 60  KAGDKVLFGKYAGTEIQI-DGEEHLIMREDDIIAIV 94


>gi|295680699|ref|YP_003609273.1| chaperonin Cpn10 [Burkholderia sp. CCGE1002]
 gi|295440594|gb|ADG19762.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1002]
          Length = 96

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E +TA+G I+IPD+ +EKP    GEI+ VG G     GK +EP++
Sbjct: 3   LRPLHDRVIVKRLGQESRTASG-IVIPDSAAEKPD--QGEILAVGPGRRGDDGKRVEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LV++E DI+ +V
Sbjct: 60  QVGDRVLFGKYAGQAVKV-DGDELLVLREEDIVAVV 94


>gi|170691218|ref|ZP_02882383.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
 gi|170143423|gb|EDT11586.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
          Length = 96

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAQIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|238026379|ref|YP_002910610.1| co-chaperonin GroES [Burkholderia glumae BGR1]
 gi|237875573|gb|ACR27906.1| Chaperonin Cpn10 [Burkholderia glumae BGR1]
          Length = 97

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GE++ +G G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEVLAIGPGKRDDKGAPIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQSVKV-DGQELLVMREEDIMAVV 94


>gi|220933624|ref|YP_002512523.1| chaperonin Cpn10 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254813863|sp|B8GL18|CH10_THISH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219994934|gb|ACL71536.1| chaperonin Cpn10 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 96

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++R++ E +T  G I+IPD+ +EKP    GE++ VG G + ++G+V   +V
Sbjct: 3   IRPLHDRVIIKRMEEE-RTTAGGIVIPDSATEKPV--RGEVIAVGKGKILENGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTEIK+ DG+E LVM+E DIMG++
Sbjct: 60  KVGDKVLFGKYSGTEIKV-DGQEVLVMREEDIMGVL 94


>gi|91782028|ref|YP_557234.1| co-chaperonin GroES [Burkholderia xenovorans LB400]
 gi|187922866|ref|YP_001894508.1| co-chaperonin GroES [Burkholderia phytofirmans PsJN]
 gi|296160311|ref|ZP_06843129.1| chaperonin Cpn10 [Burkholderia sp. Ch1-1]
 gi|226701733|sp|B2T0H9|CH10_BURPP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|91685982|gb|ABE29182.1| 10 kDa chaperonin, GroES [Burkholderia xenovorans LB400]
 gi|187714060|gb|ACD15284.1| chaperonin Cpn10 [Burkholderia phytofirmans PsJN]
 gi|295889522|gb|EFG69322.1| chaperonin Cpn10 [Burkholderia sp. Ch1-1]
          Length = 96

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IP+  +EKP    GEI+ VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPEAAAEKPD--QGEILAVGPGKRDDKGAQIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM +V
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNELLVMREEDIMAVV 94


>gi|53803987|ref|YP_114146.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath]
 gi|53757748|gb|AAU92039.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath]
          Length = 96

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV R + E KT+ G I+IPDT  EKP    GEI+ VG G +  +G+V    V
Sbjct: 3   IRPLHDRVVVIRREEE-KTSPGGIVIPDTAKEKPI--KGEIVAVGTGKVLDNGQVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTEIK+ DG EYL+++E DIMG++
Sbjct: 60  KAGDTVLFGKYSGTEIKI-DGTEYLMLREDDIMGVI 94


>gi|319761535|ref|YP_004125472.1| chaperonin cpn10 [Alicycliphilus denitrificans BC]
 gi|330823404|ref|YP_004386707.1| chaperonin Cpn10 [Alicycliphilus denitrificans K601]
 gi|317116096|gb|ADU98584.1| Chaperonin Cpn10 [Alicycliphilus denitrificans BC]
 gi|329308776|gb|AEB83191.1| Chaperonin Cpn10 [Alicycliphilus denitrificans K601]
          Length = 96

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IPD  +EKP    GE++ VG G +D+ G  I   V
Sbjct: 3   LRPLADRVIVKRLENETKTASG-IVIPDNAAEKPD--QGEVVAVGPGRLDEDGDRIAMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K++ G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVH-GDELLVMKEDDLFAVV 94


>gi|254451618|ref|ZP_05065055.1| chaperonin GroS [Octadecabacter antarcticus 238]
 gi|198266024|gb|EDY90294.1| chaperonin GroS [Octadecabacter antarcticus 238]
          Length = 85

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 63/89 (70%), Gaps = 4/89 (4%)

Query: 17  VVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLF 76
           +VRR+  + KTA G ++IPD   EKP    GE++ VGAG  D +G  I  +V  GD +LF
Sbjct: 1   MVRRIDGDEKTA-GGLIIPDNAKEKPQ--EGEVISVGAGAKDDAGARIAMDVKAGDKILF 57

Query: 77  GKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           GKWSGTEIK+ DGEE ++M+ESDI+GI+ 
Sbjct: 58  GKWSGTEIKI-DGEELMIMKESDILGIMA 85


>gi|254249097|ref|ZP_04942417.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
 gi|124875598|gb|EAY65588.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
          Length = 109

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 68/101 (67%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           + K  LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ 
Sbjct: 11  DEKMSLRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDTDGQR 67

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           I P++  G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 68  IVPDLQVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 107


>gi|303248168|ref|ZP_07334432.1| Chaperonin Cpn10 [Desulfovibrio fructosovorans JJ]
 gi|302490432|gb|EFL50341.1| Chaperonin Cpn10 [Desulfovibrio fructosovorans JJ]
          Length = 96

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+ E +   G I+IPD+  EKP    GE++ VG G +D  G  ++  V
Sbjct: 3   LKPLGDRVLVKRLEQE-EVTKGGIIIPDSAKEKPM--KGEVVAVGPGKLDDKGDHMKMHV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD+VLF K++GTEIKL+D EE LVM+E DI+ ++
Sbjct: 60  EKGDLVLFNKYAGTEIKLDD-EELLVMREDDILAVI 94


>gi|254451617|ref|ZP_05065054.1| chaperonin GroS [Octadecabacter antarcticus 238]
 gi|198266023|gb|EDY90293.1| chaperonin GroS [Octadecabacter antarcticus 238]
          Length = 85

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 63/89 (70%), Gaps = 4/89 (4%)

Query: 17  VVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLF 76
           +VRR+  + KTA G ++IPD   EKP    GE++ VGAG  D +G  I  +V  GD +LF
Sbjct: 1   MVRRIDGDEKTA-GGLIIPDNAKEKPQ--EGEVVSVGAGAKDDAGARIAMDVKAGDKILF 57

Query: 77  GKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           GKWSGTEIK+ DGEE ++M+ESDI+GI+ 
Sbjct: 58  GKWSGTEIKI-DGEELMIMKESDILGIMA 85


>gi|288959864|ref|YP_003450204.1| chaperonin GroES [Azospirillum sp. B510]
 gi|288912172|dbj|BAI73660.1| chaperonin GroES [Azospirillum sp. B510]
          Length = 97

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR+  E K+  G I+IPDT  EKP  +  E++ VG GV D  G++   +V
Sbjct: 3   FRPLHDRVVVRRVAQEEKS-KGGIIIPDTAKEKPQEA--EVIAVGPGVRDDQGRIHPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGKWSGTEIK+  GE+ LV++E+DI+G++
Sbjct: 60  KVGDRVVFGKWSGTEIKVQ-GEDLLVIKETDIVGVI 94


>gi|83589409|ref|YP_429418.1| chaperonin Cpn10 [Moorella thermoacetica ATCC 39073]
 gi|83572323|gb|ABC18875.1| Chaperonin Cpn10 [Moorella thermoacetica ATCC 39073]
          Length = 94

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV++ L SE KT  G I++PDT  EKP    GE++ VG G +  +G  + PEV
Sbjct: 2   LKPLADRVVIKVLSSEEKT-QGGIVLPDTAKEKPQ--EGEVIAVGPGKILDNGTRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
            KGD+V+F K+SGTE+K  +G+EYL++++SDI+ I
Sbjct: 59  KKGDVVVFAKYSGTEVKY-EGQEYLIIRDSDILAI 92


>gi|297537605|ref|YP_003673374.1| Chaperonin Cpn10 [Methylotenera sp. 301]
 gi|297256952|gb|ADI28797.1| Chaperonin Cpn10 [Methylotenera sp. 301]
          Length = 95

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R + E  TA+G I+IPD+ +EKP    G +  +G+G  D SGKVI  +V
Sbjct: 3   IRPLHDRVIVKRSEEERTTASG-IVIPDSATEKPD--QGIVQAIGSGKRDDSGKVIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E DIM IV
Sbjct: 60  KVGDKVLFGKYAGQTVKV-DGEELLVMREEDIMAIV 94


>gi|77166373|ref|YP_344898.1| co-chaperonin GroES [Nitrosococcus oceani ATCC 19707]
 gi|300115407|ref|YP_003761982.1| chaperonin cpn10 [Nitrosococcus watsonii C-113]
 gi|123593295|sp|Q3J728|CH10_NITOC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|76884687|gb|ABA59368.1| Chaperonin Cpn10 [Nitrosococcus oceani ATCC 19707]
 gi|299541344|gb|ADJ29661.1| Chaperonin Cpn10 [Nitrosococcus watsonii C-113]
          Length = 96

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+VRR++ E KT++G I+IPDT +EKP    GE++ VG G + +SG+V   +V
Sbjct: 3   IRPLHDRVIVRRMEEE-KTSSGGIVIPDTAAEKPI--RGEVVAVGNGKILESGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGT++K+ + EE LVM+E DIM ++
Sbjct: 60  KVGDKVLFGKYSGTDVKV-ESEELLVMREDDIMAVL 94


>gi|114769407|ref|ZP_01447033.1| Chaperonin Cpn10 (GroES) [alpha proteobacterium HTCC2255]
 gi|114550324|gb|EAU53205.1| Chaperonin Cpn10 (GroES) [alpha proteobacterium HTCC2255]
          Length = 94

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR++ E KTA G ++IP++  EKP+   GEI+  G G    +G++I   V
Sbjct: 3   FTPLHDRVLVRRIEGEEKTA-GGLIIPESAKEKPA--EGEIISAGEGARKDNGELIPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKWSGTE+ + DGEE L+M+ESDI+G++
Sbjct: 60  KAGDKVLFGKWSGTEVTI-DGEELLIMKESDILGLL 94


>gi|299138999|ref|ZP_07032176.1| Chaperonin Cpn10 [Acidobacterium sp. MP5ACTX8]
 gi|298599153|gb|EFI55314.1| Chaperonin Cpn10 [Acidobacterium sp. MP5ACTX8]
          Length = 99

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   R++VRRL+ E ++  G I+IPD+  EKP    GE++ VG G  +  GKV   +V
Sbjct: 6   FTPLHDRILVRRLE-EGESIRGGIIIPDSAKEKPQ--QGEVVSVGKGKSNDEGKVFPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SGTEIKL DGEE+L+M+E +++GI+
Sbjct: 63  KAGDTILFGKYSGTEIKL-DGEEFLIMREEEVLGIL 97


>gi|292490324|ref|YP_003525763.1| chaperonin Cpn10 [Nitrosococcus halophilus Nc4]
 gi|291578919|gb|ADE13376.1| chaperonin Cpn10 [Nitrosococcus halophilus Nc4]
          Length = 96

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV++RR++ E KT++G I+IPDT +EKP    GE++ VG G   ++G+V   +V
Sbjct: 3   IRPLHDRVIIRRMEEE-KTSSGGIVIPDTAAEKPI--RGEVIAVGNGKTLENGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ D E+ LVM+E DIM ++
Sbjct: 60  KVGDKVLFGKYSGTEVKVED-EDLLVMREDDIMAVL 94


>gi|289207476|ref|YP_003459542.1| chaperonin Cpn10 [Thioalkalivibrio sp. K90mix]
 gi|288943107|gb|ADC70806.1| Chaperonin Cpn10 [Thioalkalivibrio sp. K90mix]
          Length = 96

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++ E +T+ G I+IPD+ +EKP    GE++ VG G + +SG+V   +V
Sbjct: 3   LRPLHDRVIVKRMEEE-RTSPGGIVIPDSAAEKPI--RGEVIAVGNGKILESGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGTE+K+ +GE+ LVM+E DIM ++
Sbjct: 60  KAGDKVLFGKYSGTEVKV-EGEDVLVMREDDIMAVI 94


>gi|296156287|ref|ZP_06839126.1| chaperonin Cpn10 [Burkholderia sp. Ch1-1]
 gi|295893793|gb|EFG73572.1| chaperonin Cpn10 [Burkholderia sp. Ch1-1]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL  E KTA+G I+IP++ +EKP    GE++ +G G  D  GK IEP++
Sbjct: 3   LRPLHDRLIVKRLDQETKTASG-IVIPESAAEKPD--QGEVIAIGPGKRDSDGKRIEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             G+ VLFGK++G  +K+ DG E LV++E D++ +V +
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDVVAVVTQ 96


>gi|91778538|ref|YP_553746.1| co-chaperonin GroES [Burkholderia xenovorans LB400]
 gi|91691198|gb|ABE34396.1| GroES [Burkholderia xenovorans LB400]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL  E KTA+G I+IP++ +EKP    GE++ +G G  D  GK IEP++
Sbjct: 3   LRPLHDRLIVKRLDQETKTASG-IVIPESAAEKPD--QGEVIAIGPGRRDSDGKRIEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             G+ VLFGK++G  +K+ DG E LV++E D++ +V +
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDVVAVVTQ 96


>gi|254293332|ref|YP_003059355.1| chaperonin Cpn10 [Hirschia baltica ATCC 49814]
 gi|254041863|gb|ACT58658.1| chaperonin Cpn10 [Hirschia baltica ATCC 49814]
          Length = 95

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+VRR++ E+    G I+IPDT  EKP    GEI+ VG G +    + I  EV
Sbjct: 3   FRPLHDRVLVRRVE-EVAKTKGGIIIPDTAKEKPQ--EGEIVAVGNGAIGDDNERIALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF KW GTE+ + DGEE ++M+ESDIMGIV
Sbjct: 60  KPGDRVLFAKWGGTEVTV-DGEELIIMKESDIMGIV 94


>gi|116188|sp|P26005|CH10_AMOPS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|155401|gb|AAC09380.1| groES [Candidatus Legionella jeonii]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRRL+ E +T  G I+IPD+ +EKP    GEI+ +GAG +  +G V    V
Sbjct: 3   IRPLHDRVVVRRLEEE-RTTAGWIVIPDSATEKPM--RGEIIAIGAGKILDNGDVRAFVV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+SGTE+K+  G+E +VM+E DIMG++
Sbjct: 60  KVGDVVLFGKYSGTEVKVA-GQELVVMREDDIMGVI 94


>gi|171057173|ref|YP_001789522.1| co-chaperonin GroES [Leptothrix cholodnii SP-6]
 gi|226704009|sp|B1XXY8|CH10_LEPCP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|170774618|gb|ACB32757.1| chaperonin Cpn10 [Leptothrix cholodnii SP-6]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL+ E KTA+G I+IPD  +EKP    GE++ VG G  +  G  +   V
Sbjct: 3   LRPLHDRVIVKRLEQETKTASG-IVIPDNAAEKPD--QGEVLAVGPGKRNDKGDFVALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  AVGDRVLFGKYSGQTVKV-DGDELLVMREEDLFAVV 94


>gi|153006552|ref|YP_001380877.1| co-chaperonin GroES [Anaeromyxobacter sp. Fw109-5]
 gi|152030125|gb|ABS27893.1| chaperonin Cpn10 [Anaeromyxobacter sp. Fw109-5]
          Length = 97

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++V+R+Q E KT  G I+IPD+  EKP    G+++ VG G + + GKV   +V
Sbjct: 4   IRPLQDRIIVKRVQEEEKT-KGGIIIPDSAKEKPI--EGKVIAVGNGKVQEDGKVRPLDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++GTEIK+ DGEE+L+M+E DI+G++
Sbjct: 61  KAGDRILFSKYAGTEIKI-DGEEHLIMREDDILGVI 95


>gi|119897264|ref|YP_932477.1| chaperonin GroES [Azoarcus sp. BH72]
 gi|119669677|emb|CAL93590.1| chaperonin GroES [Azoarcus sp. BH72]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL++E KTA+G I+IPD+  EKP    GE++ VG G +   GKV    V
Sbjct: 3   IRPLHDRVIVKRLEAERKTASG-IVIPDSAGEKPD--QGEVLAVGNGKILDDGKVRPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ +GEE LVM+E DIMG+V
Sbjct: 60  QVGDKVLFGKYAGQSVKV-EGEELLVMREEDIMGVV 94


>gi|40714529|dbj|BAD06925.1| molecular chaperone GroES [Ralstonia pickettii]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E K+A+G I+IPD  +EKP    GE+  VG G  D  G  I  +V
Sbjct: 3   LRPLHDRVIVKRLDNETKSASG-IVIPDNAAEKPD--QGEVPAVGPGKKDDKGHNIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLFGK++G  +K+ DG+E LVM+E DIM +V +
Sbjct: 60  KVGDRVLFGKYAGQGVKV-DGQELLVMREEDIMAVVAK 96


>gi|121593124|ref|YP_985020.1| co-chaperonin GroES [Acidovorax sp. JS42]
 gi|222109894|ref|YP_002552158.1| co-chaperonin groes [Acidovorax ebreus TPSY]
 gi|166233975|sp|A1W3W9|CH10_ACISJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813841|sp|B9MDC6|CH10_ACIET RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|120605204|gb|ABM40944.1| chaperonin Cpn10 [Acidovorax sp. JS42]
 gi|221729338|gb|ACM32158.1| chaperonin Cpn10 [Acidovorax ebreus TPSY]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++SE  TA+G I+IPD  +EKP    GE++ VG G  +  G++I   V
Sbjct: 3   LRPLHDRVIVKRIESETTTASG-IVIPDNAAEKPD--QGEVLAVGPGKKNDKGELIALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+N G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVN-GDELLVMKEDDLFAVV 94


>gi|239904911|ref|YP_002951649.1| 10 kDa chaperonin [Desulfovibrio magneticus RS-1]
 gi|259585878|sp|C4XGI3|CH10_DESMR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|239794774|dbj|BAH73763.1| 10 kDa chaperonin [Desulfovibrio magneticus RS-1]
          Length = 96

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+ E +   G I+IPD+  EKP    GE++ VG G + + GK ++  V
Sbjct: 3   LKPLGDRVLVKRLEQE-EVTKGGIIIPDSAKEKPM--KGEVIAVGPGKLAEDGKHLKMHV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD+VLF K++GTEIK++D E++LVM+E DI+ ++
Sbjct: 60  EKGDLVLFNKYAGTEIKVDD-EDFLVMREDDILAVI 94


>gi|260425716|ref|ZP_05779696.1| chaperonin GroS [Citreicella sp. SE45]
 gi|260423656|gb|EEX16906.1| chaperonin GroS [Citreicella sp. SE45]
          Length = 97

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+VRR++S+ KT  G ++IPD+  EKP+   G ++  G G    SG++I   V
Sbjct: 3   FKPLHDRVLVRRVESDEKT-KGGLIIPDSAKEKPA--EGVVVACGDGARKDSGELISMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD +LFGKWSGTE+ + DGEE L+M+ESDI+G+
Sbjct: 60  KAGDRILFGKWSGTEVSI-DGEELLIMKESDILGV 93


>gi|257093854|ref|YP_003167495.1| chaperonin Cpn10 [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257046378|gb|ACV35566.1| chaperonin Cpn10 [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E KTA+G I+IPDT +EKP    GEI  VG G + + G V    V
Sbjct: 3   IRPLHDRVIVKRLEEERKTASG-IVIPDTAAEKPD--QGEIRAVGNGKILEDGSVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E DIMG++
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGDELLVMREEDIMGVI 94


>gi|91780204|ref|YP_555411.1| co-chaperonin GroES [Burkholderia xenovorans LB400]
 gi|91692864|gb|ABE36061.1| groES 10 kDa chaperonin [Burkholderia xenovorans LB400]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL  E KTA+G I+IP++ +EKP    GE++ +G G  D  GK IEP++
Sbjct: 3   LRPLHDRLIVKRLDQETKTASG-IVIPESAAEKPD--QGEVIAIGPGKRDSDGKRIEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             G+ VLFGK++G  +K+ DG E LV++E D++ +V +
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGTELLVLREEDVVAVVTQ 96


>gi|83716291|ref|YP_440133.1| co-chaperonin GroES [Burkholderia thailandensis E264]
 gi|167578705|ref|ZP_02371579.1| co-chaperonin GroES [Burkholderia thailandensis TXDOH]
 gi|167616838|ref|ZP_02385469.1| co-chaperonin GroES [Burkholderia thailandensis Bt4]
 gi|257140764|ref|ZP_05589026.1| co-chaperonin GroES [Burkholderia thailandensis E264]
 gi|83650116|gb|ABC34180.1| chaperonin, 10 kDa [Burkholderia thailandensis E264]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I+IPD+ +EKP    GEI+ VG G  D  G  +EP+V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVIPDSAAEKPD--QGEIVAVGPGRRDADGVRVEPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E +I+ +V
Sbjct: 60  KVGERVLFGKYAGQPVKV-DGNELLVLREEEIVAVV 94


>gi|171319826|ref|ZP_02908909.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
 gi|171094921|gb|EDT39950.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDTDGQRIVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+N G E+LV++E DI+ +V
Sbjct: 60  QVGERVLFGKYAGQAVKVN-GNEFLVLREEDIVAVV 94


>gi|221069086|ref|ZP_03545191.1| chaperonin Cpn10 [Comamonas testosteroni KF-1]
 gi|264676780|ref|YP_003276686.1| chaperonin Cpn10 [Comamonas testosteroni CNB-2]
 gi|299529602|ref|ZP_07043039.1| co-chaperonin GroES [Comamonas testosteroni S44]
 gi|220714109|gb|EED69477.1| chaperonin Cpn10 [Comamonas testosteroni KF-1]
 gi|262207292|gb|ACY31390.1| chaperonin Cpn10 [Comamonas testosteroni CNB-2]
 gi|298722465|gb|EFI63385.1| co-chaperonin GroES [Comamonas testosteroni S44]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I++PD  +EKP    GE++ VG G  +  G++I   V
Sbjct: 3   LRPLHDRVIVKRLENETKTASG-IVLPDAATEKPD--QGEVLAVGPGKRNDKGELIALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K++ G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKIH-GDELLVMKEDDLFAVV 94


>gi|332525041|ref|ZP_08401222.1| co-chaperonin GroES [Rubrivivax benzoatilyticus JA2]
 gi|332108331|gb|EGJ09555.1| co-chaperonin GroES [Rubrivivax benzoatilyticus JA2]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IPD  +EKP    GE++ VG G  +  G  +   +
Sbjct: 3   LRPLHDRVIVKRLENETKTASG-IVIPDNAAEKPD--QGEVLAVGPGKRNDKGDFVALNI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMREEDLFAVV 94


>gi|170696125|ref|ZP_02887260.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
 gi|170138940|gb|EDT07133.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL  E KTA+G I+IP++ +EKP    GE++ +G G  D  GK +EP++
Sbjct: 3   LRPLHDRLIVKRLDQETKTASG-IVIPESAAEKPD--QGEVIAIGPGKRDSDGKRVEPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             G+ VLFGK++G  +K+ DG E LV++E D++ +V +
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGNELLVLREEDVVAVVTQ 96


>gi|170736377|ref|YP_001777637.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3]
 gi|169818565|gb|ACA93147.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDHETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDTDGQRIVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 60  QVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 94


>gi|78063462|ref|YP_373370.1| co-chaperonin GroES [Burkholderia sp. 383]
 gi|77971347|gb|ABB12726.1| Chaperonin Cpn10/GroES [Burkholderia sp. 383]
          Length = 96

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDADGQRIVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 60  QVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 94


>gi|298246278|ref|ZP_06970084.1| Chaperonin Cpn10 [Ktedonobacter racemifer DSM 44963]
 gi|297553759|gb|EFH87624.1| Chaperonin Cpn10 [Ktedonobacter racemifer DSM 44963]
          Length = 100

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+ L  E  T +G I++PDT  EKP    GE++ VG+G +  +GK    EV
Sbjct: 8   LRPLGDRVVVKPLAREAVTKSG-IVLPDTAKEKPQ--EGEVLAVGSGKVLDNGKRTTLEV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  VLF K++GTEIKL +GEEYL+++ESDIMGI+
Sbjct: 65  QVGQTVLFAKYAGTEIKL-EGEEYLILRESDIMGII 99


>gi|258406295|ref|YP_003199037.1| chaperonin Cpn10 [Desulfohalobium retbaense DSM 5692]
 gi|257798522|gb|ACV69459.1| chaperonin Cpn10 [Desulfohalobium retbaense DSM 5692]
          Length = 96

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+R+Q E +T  G I+IPDT  EKP    GEI+  G G +   GK IE  V
Sbjct: 3   LKPLHDRVLVKRVQEE-ETTKGGIIIPDTAKEKPI--KGEIVAAGPGKVADDGKRIEMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+K+ DGEE+LVM+E DI+  +
Sbjct: 60  KTGDKVMFNKYAGTEVKI-DGEEFLVMREDDILATI 94


>gi|162148429|ref|YP_001602890.1| 10 kDa chaperonin [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543038|ref|YP_002275267.1| chaperonin Cpn10 [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787006|emb|CAP56591.1| 10 kDa chaperonin (Protein Cpn10) [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530715|gb|ACI50652.1| chaperonin Cpn10 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 99

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           +  RP   RVV+RR+    KTA G I+IPDT  EKP  +   ++ VG G  D  G+++  
Sbjct: 2   SSFRPLHDRVVLRRISPTEKTA-GGIIIPDTAQEKPVEAV--VVAVGPGARDDRGEIVPL 58

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           EV  GD VLFGKWSGTE+++  GE+ L+ +ESD+ GIV
Sbjct: 59  EVRAGDHVLFGKWSGTEVRIA-GEDLLIAKESDLFGIV 95


>gi|291278671|ref|YP_003495506.1| chaperonin GroES [Deferribacter desulfuricans SSM1]
 gi|290753373|dbj|BAI79750.1| chaperonin GroES [Deferribacter desulfuricans SSM1]
          Length = 97

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P + RV+V+R++ E KT +G I+IPDT  EK  +  GE++ VG G + ++G  IE  V
Sbjct: 4   IKPLQDRVLVKRIEVEEKTESG-IIIPDTAREK--SQEGEVIAVGPGKVLENGTKIELTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++GTE+K+ DGEEYL+M+E DI+GI+
Sbjct: 61  KPGDRILFSKYAGTEVKI-DGEEYLIMREDDILGII 95


>gi|116691622|ref|YP_837155.1| co-chaperonin GroES [Burkholderia cenocepacia HI2424]
 gi|206562410|ref|YP_002233173.1| co-chaperonin GroES [Burkholderia cenocepacia J2315]
 gi|116649622|gb|ABK10262.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424]
 gi|198038450|emb|CAR54408.1| 10 kDa chaperonin 2 [Burkholderia cenocepacia J2315]
          Length = 96

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDTDGQRIVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 60  QVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 94


>gi|160901091|ref|YP_001566673.1| co-chaperonin GroES [Delftia acidovorans SPH-1]
 gi|226701752|sp|A9BXL2|CH10_DELAS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|160366675|gb|ABX38288.1| chaperonin Cpn10 [Delftia acidovorans SPH-1]
          Length = 96

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IP+  +EKP    GE++ VG G  +  G+VI   V
Sbjct: 3   LRPLHDRVIVKRLENETKTASG-IVIPENAAEKPD--QGEVLAVGPGKKNDKGEVIALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K++ G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVH-GDELLVMKEDDLFAVV 94


>gi|124265620|ref|YP_001019624.1| co-chaperonin GroES [Methylibium petroleiphilum PM1]
 gi|166198382|sp|A2SCV0|CH10_METPP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|124258395|gb|ABM93389.1| 10 kDa chaperonin [Methylibium petroleiphilum PM1]
          Length = 96

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL+ E KTA+G I+IPD  +EKP    GE++ VG G  +  G  I    
Sbjct: 3   LRPLHDRVIVKRLEQETKTASG-IVIPDNAAEKPD--QGEVLAVGPGKRNDKGDFIALNC 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMREEDLFAVV 94


>gi|302341934|ref|YP_003806463.1| Chaperonin Cpn10 [Desulfarculus baarsii DSM 2075]
 gi|301638547|gb|ADK83869.1| Chaperonin Cpn10 [Desulfarculus baarsii DSM 2075]
          Length = 95

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P + RV+V+RL+   KTA G ++IPD   EKP    G I+ VG G +  +G  +E  V
Sbjct: 3   IKPLQDRVIVKRLEEVEKTA-GGLIIPDAAKEKPQ--QGRILAVGPGKVLDNGTKLELTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK++GTE+K+ DG+E L+M+E DI+GIV
Sbjct: 60  KAGDVVLFGKYAGTEVKI-DGDEVLIMREDDILGIV 94


>gi|119898656|ref|YP_933869.1| chaperonin GroES [Azoarcus sp. BH72]
 gi|119671069|emb|CAL94982.1| chaperonin GroES [Azoarcus sp. BH72]
          Length = 95

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL++E  TATG I+IPD+  EKP    GE++ VG G +  +G++  P++
Sbjct: 3   IRPLHDRVIVKRLEAERTTATG-IVIPDSAGEKPD--QGEVIAVGRGKILDNGELRAPQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E DI G++
Sbjct: 60  KAGDRVLFGKYAGQAVKI-DGEEVLVVREEDIFGVI 94


>gi|152983288|ref|YP_001354341.1| 10 kDa chaperonin [Janthinobacterium sp. Marseille]
 gi|166198378|sp|A6T1E4|CH10_JANMA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|151283365|gb|ABR91775.1| 10 kDa chaperonin (Protein Cpn10) [Janthinobacterium sp. Marseille]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G ++IP+  +EKP    GEI+ +G G + + GKV   +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-LIIPEAAAEKPD--QGEILAIGNGKILEDGKVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM IV
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGNEVLVMREEDIMAIV 94


>gi|148652451|ref|YP_001279544.1| co-chaperonin GroES [Psychrobacter sp. PRwf-1]
 gi|172048508|sp|A5WD53|CH10_PSYWF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|148571535|gb|ABQ93594.1| chaperonin Cpn10 [Psychrobacter sp. PRwf-1]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR++ E KTA G IL+P +  EKPS   GEI+ VG G + ++G+V   +V
Sbjct: 3   IRPLHDRIVVRRVEEEQKTA-GGILLPGSAQEKPS--QGEILAVGNGQIRENGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G  +K+N GEE L+M+ESD++G++
Sbjct: 60  KVGDKVLFGQYAGQTVKVN-GEELLIMKESDVLGVL 94


>gi|300310330|ref|YP_003774422.1| co-chaperonin GroES [Herbaspirillum seropedicae SmR1]
 gi|124483632|emb|CAM32689.1| Co-chaperonin GroES (HSP10) protein [Herbaspirillum seropedicae]
 gi|300073115|gb|ADJ62514.1| co-chaperonin GroES (HSP10) protein [Herbaspirillum seropedicae
           SmR1]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G I++PD  +EKP    GE++ VG G + + GKV    V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-IVLPDAATEKPD--QGEVLAVGNGKILEDGKVRPLSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQAVKI-DGQELLVMREEDLFAVV 94


>gi|332977951|gb|EGK14695.1| chaperone GroES [Psychrobacter sp. 1501(2011)]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR++ E KTA G IL+P +  EKPS   GE++ VG G +  SG+V   +V
Sbjct: 3   IRPLHDRIVVRRVEEEQKTA-GGILLPGSAQEKPS--QGEVLAVGNGQIRDSGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G  +K+ DGEE L+M+ESD++G++
Sbjct: 60  KVGDKVLFGQYAGQAVKV-DGEELLIMKESDVLGVL 94


>gi|163858247|ref|YP_001632545.1| co-chaperonin GroES [Bordetella petrii DSM 12804]
 gi|226701730|sp|A9I682|CH10_BORPD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|163261975|emb|CAP44277.1| 10 kDa chaperonin [Bordetella petrii]
          Length = 95

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD+ +EKP    GE++ VG G   + GKV+  ++
Sbjct: 3   LRPLHDRVIVKRLDNERKTASG-IVIPDSAAEKPD--QGEVVAVGPGKKTEDGKVLPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E +I+ ++
Sbjct: 60  KAGDKVLFGKYAGQSVKV-DGEELLVIREEEILAVI 94


>gi|322417819|ref|YP_004197042.1| Chaperonin Cpn10 [Geobacter sp. M18]
 gi|320124206|gb|ADW11766.1| Chaperonin Cpn10 [Geobacter sp. M18]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++    TA G + IP+T  EKP    GE++ VG G   + GKV   ++
Sbjct: 3   LRPLQDRIIVKRVEEATMTA-GGLYIPETAKEKPQ--QGEVVAVGNGKRGEDGKVFPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G+E+KL DGE+YL+M+E DI+G++
Sbjct: 60  KVGDKVLFGKYAGSEVKL-DGEDYLIMREDDILGVL 94


>gi|118602569|ref|YP_903784.1| chaperonin Cpn10 [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|166198407|sp|A1AWK6|CH10_RUTMC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118567508|gb|ABL02313.1| chaperonin Cpn10 [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 95

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+VRR Q E KT    ++IPD+ +EKPS   GEI+ +G G ++ +G VI  +V
Sbjct: 3   IRPLHDRVIVRRTQEE-KTTESGLIIPDSATEKPS--KGEILAIGNGKINDNGDVIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G EIK+ DGE  LV++E DI+ I+
Sbjct: 60  KVGDQVLFGQYAGNEIKV-DGETLLVVREDDIVAII 94


>gi|288819090|ref|YP_003433438.1| 10 kDa chaperonin GroES [Hydrogenobacter thermophilus TK-6]
 gi|288788490|dbj|BAI70237.1| 10 kDa chaperonin GroES [Hydrogenobacter thermophilus TK-6]
 gi|308752673|gb|ADO46156.1| Chaperonin Cpn10 [Hydrogenobacter thermophilus TK-6]
          Length = 97

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 67/96 (69%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   ++VV+R++ + +     I+IPDT  EKP    GE++ VG G +  +G+++ P+V
Sbjct: 4   LRPLYDKIVVKRMEEQEQKTPSGIIIPDTAKEKPQI--GEVIAVGDGKLLSNGQIVSPKV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD V+F K++GTE++L DGE+YL+M E +++ ++
Sbjct: 62  KKGDKVVFNKYAGTEVEL-DGEKYLIMSEDEVLAVI 96


>gi|319943074|ref|ZP_08017357.1| chaperone GroES [Lautropia mirabilis ATCC 51599]
 gi|319743616|gb|EFV96020.1| chaperone GroES [Lautropia mirabilis ATCC 51599]
          Length = 95

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++RL +E KTA+G I++P+  +EKP    GE++ VG G +   GKV    V
Sbjct: 3   LRPLHDRVIIKRLDNERKTASG-IVLPENAAEKPD--QGEVLAVGDGKIGDDGKVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DGEE LVM+E DIM +V
Sbjct: 60  KVGDKVLFGKYSGQTVKV-DGEELLVMREEDIMAVV 94


>gi|114569156|ref|YP_755836.1| chaperonin Cpn10 [Maricaulis maris MCS10]
 gi|122316674|sp|Q0AS39|CH10_MARMM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|114339618|gb|ABI64898.1| chaperonin Cpn10 [Maricaulis maris MCS10]
          Length = 95

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+R++ E  T  G I+IPDT  EKP    GE++ +G G + + G V   +V
Sbjct: 3   FRPLHDRVLVKRVEEE-STTKGGIIIPDTAKEKPQ--EGEVVAIGGGAIKEDGSVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGKWSGTE+ + DG E L+M+ESDI+G++
Sbjct: 60  KAGDRILFGKWSGTEVTV-DGVELLIMKESDILGVM 94


>gi|254254938|ref|ZP_04948255.1| co-chaperonin GroES [Burkholderia dolosa AUO158]
 gi|124899583|gb|EAY71426.1| co-chaperonin GroES [Burkholderia dolosa AUO158]
          Length = 109

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 16  LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDADGQRIVPDL 72

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E D++ +V
Sbjct: 73  KVGERVLFGKYAGQAVKV-DGSEFLVLREEDVVAVV 107


>gi|225872383|ref|YP_002753838.1| chaperonin, 10 kDa [Acidobacterium capsulatum ATCC 51196]
 gi|225794005|gb|ACO34095.1| chaperonin, 10 kDa [Acidobacterium capsulatum ATCC 51196]
          Length = 103

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 65/94 (69%), Gaps = 4/94 (4%)

Query: 11  PTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSK 70
           P   R++VRR+  E +T  G I+IPD+  EKP    GE++ VG G  +  GKV   +V  
Sbjct: 12  PLHDRILVRRI-DEGETVRGGIIIPDSAKEKPQ--EGEVIAVGKGKSNDEGKVFPLDVKS 68

Query: 71  GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GD VLFGK+SGTEIK+ DGEE+L+M+E +++GI+
Sbjct: 69  GDRVLFGKYSGTEIKI-DGEEFLIMREEEVLGIL 101


>gi|254000000|ref|YP_003052063.1| chaperonin Cpn10 [Methylovorus sp. SIP3-4]
 gi|253986679|gb|ACT51536.1| chaperonin Cpn10 [Methylovorus sp. SIP3-4]
          Length = 105

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+R++++  TA+G I+IPDT SEKP    GE++  G G   Q G  +  EV
Sbjct: 3   IRPLYDRVVVKRIEAQRTTASG-IVIPDTASEKPE--QGEVIATGNGRRLQDGTQVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +KLN GEE LV++E DI+G+V
Sbjct: 60  KIGDQVLFGKYAGQTVKLN-GEELLVLREEDILGVV 94


>gi|149917227|ref|ZP_01905726.1| chaperonin GroES [Plesiocystis pacifica SIR-1]
 gi|149821834|gb|EDM81228.1| chaperonin GroES [Plesiocystis pacifica SIR-1]
          Length = 96

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RLQ E KTA G I IP++  EKP+   G+++ VG+G  D SG     +V
Sbjct: 3   VRPLNDRVLVKRLQEEEKTA-GGIFIPNSAKEKPT--RGKVIAVGSGRADDSGNRKPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K D +LFGK++GTEIK+ DG++ L+M+E DI+ +V
Sbjct: 60  KKDDEILFGKYAGTEIKV-DGDDLLIMREEDILAVV 94


>gi|301165637|emb|CBW25208.1| 10 kDa chaperonin [Bacteriovorax marinus SJ]
          Length = 95

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+RL+ E KTA G I+IPD  +EKP    GEI+ VG G   + G   E +V
Sbjct: 3   VRPLQDRVLVKRLEEETKTA-GGIIIPDNHTEKPV--QGEIVSVGPGYRKEDGSFRELDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GT++K+ +G +YL+M+E DI+G++
Sbjct: 60  KAGDKVLFGKYAGTDVKV-EGVDYLIMKEDDILGVL 94


>gi|322434956|ref|YP_004217168.1| Chaperonin Cpn10 [Acidobacterium sp. MP5ACTX9]
 gi|321162683|gb|ADW68388.1| Chaperonin Cpn10 [Acidobacterium sp. MP5ACTX9]
          Length = 99

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   R++VRR + E +T  G I+IPD+  EKP    GE++ VG G  +  GKV   +V
Sbjct: 6   FTPLHDRILVRRTE-EGETMRGGIIIPDSAKEKPQ--QGEVVSVGKGKSNDEGKVFPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SGTEIKL DGEE L+M+E +++GIV
Sbjct: 63  KAGDTILFGKYSGTEIKL-DGEELLIMREEEVLGIV 97


>gi|329910025|ref|ZP_08275204.1| Heat shock protein 60 family co-chaperone GroES [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546305|gb|EGF31330.1| Heat shock protein 60 family co-chaperone GroES [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 96

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G ++IP+  +EKP    GE++ VG G + + GKV   +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-LIIPEAAAEKPD--QGEVLAVGNGKILEDGKVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+  G+E LVM+E DIM IV
Sbjct: 60  KVGDRVLFGKYSGQAVKIA-GDELLVMREEDIMAIV 94


>gi|212638060|ref|YP_002314580.1| co-chaperonin GroES [Anoxybacillus flavithermus WK1]
 gi|226701721|sp|B7GFR5|CH10_ANOFW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|212559540|gb|ACJ32595.1| Chaperonin GroES (HSP10 family) [Anoxybacillus flavithermus WK1]
          Length = 94

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 71/96 (73%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  +Q+E KTA+G I++PDT  EKP    G+++ VG+G +  +G+ + PEV
Sbjct: 2   LKPLGDRIVIELIQTEEKTASG-IVLPDTAKEKPQ--EGKVVAVGSGRVLDNGERVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  SVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|88811317|ref|ZP_01126572.1| co-chaperonin GroES [Nitrococcus mobilis Nb-231]
 gi|88791206|gb|EAR22318.1| co-chaperonin GroES [Nitrococcus mobilis Nb-231]
          Length = 96

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV++RL+ E +T+ G I+IPDT +EKP    GEI+ VG G    +G++   +V
Sbjct: 3   LRPLHDRVVIKRLEEE-RTSPGGIVIPDTAAEKPI--RGEIIAVGNGKQLDNGEIRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VLFGK++GTE+K+ D E+ LVM+E D+M +V
Sbjct: 60  TVGDQVLFGKFAGTEVKIGD-EDLLVMREDDVMAVV 94


>gi|170697257|ref|ZP_02888351.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
 gi|172062484|ref|YP_001810135.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6]
 gi|170137877|gb|EDT06111.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
 gi|171995001|gb|ACB65919.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6]
          Length = 96

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ + P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDADGQRLVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 60  QVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 94


>gi|196233176|ref|ZP_03132023.1| chaperonin Cpn10 [Chthoniobacter flavus Ellin428]
 gi|196222820|gb|EDY17343.1| chaperonin Cpn10 [Chthoniobacter flavus Ellin428]
          Length = 98

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+ L++ ++T  G I+IPD   EKP    GE++ +G G  D++GK+IE  V
Sbjct: 6   VRPLADRVLVKPLEA-VETKKGGIIIPDAHKEKPQ--EGEVVALGTGKRDEAGKLIEFSV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VL  K+ GTEIK  +GE YL+M+E DI+GI+
Sbjct: 63  KKGDKVLISKYGGTEIKF-EGESYLIMREDDILGII 97


>gi|313201973|ref|YP_004040631.1| chaperonin cpn10 [Methylovorus sp. MP688]
 gi|312441289|gb|ADQ85395.1| chaperonin Cpn10 [Methylovorus sp. MP688]
          Length = 105

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+R++++  TA+G I+IPDT SEKP    GE++  G G   Q G  +  EV
Sbjct: 3   IRPLYDRVVVKRVEAQRTTASG-IVIPDTASEKPE--QGEVIATGNGRRLQDGTQVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +KLN GEE LV++E DI+G+V
Sbjct: 60  KVGDQVLFGKYAGQTVKLN-GEELLVLREEDILGVV 94


>gi|56476062|ref|YP_157651.1| chaperonins cpn10 (10 kDa subunit) [Aromatoleum aromaticum EbN1]
 gi|217969840|ref|YP_002355074.1| chaperonin Cpn10 [Thauera sp. MZ1T]
 gi|81677557|sp|Q5P7G1|CH10_AZOSE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|56312105|emb|CAI06750.1| Chaperonins cpn10 (10 kDa subunit) [Aromatoleum aromaticum EbN1]
 gi|217507167|gb|ACK54178.1| chaperonin Cpn10 [Thauera sp. MZ1T]
          Length = 96

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL++E KTA+G I+IPD+  EKP    GE++ VG G +   GKV    V
Sbjct: 3   IRPLHDRVIVKRLEAERKTASG-IVIPDSAGEKPD--QGEVLAVGNGKILDDGKVRPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ +G+E LVM+E DIMG+V
Sbjct: 60  KVGDKVLFGKYAGQTVKV-EGDELLVMREEDIMGVV 94


>gi|121999118|ref|YP_001003905.1| chaperonin Cpn10 [Halorhodospira halophila SL1]
 gi|166198376|sp|A1WZJ1|CH10_HALHL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|121590523|gb|ABM63103.1| chaperonin Cpn10 [Halorhodospira halophila SL1]
          Length = 96

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL+ E +T+ G I+IPDT +EKP    G+++ VG G    +G+    EV
Sbjct: 3   IRPLHDRVVIQRLEEE-RTSPGGIVIPDTAAEKPM--KGKVIAVGHGKTLDNGERRPVEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           + GD VLFGK++GTE+K+ DG++YLVM+E DIM +
Sbjct: 60  NVGDQVLFGKYAGTEVKI-DGQDYLVMREDDIMAV 93


>gi|212702624|ref|ZP_03310752.1| hypothetical protein DESPIG_00652 [Desulfovibrio piger ATCC 29098]
 gi|212673896|gb|EEB34379.1| hypothetical protein DESPIG_00652 [Desulfovibrio piger ATCC 29098]
          Length = 96

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL++E KTA G + IPDT  EKP    G+++  G G + ++G  +E  V
Sbjct: 3   LQPLNDRVLVKRLETEEKTA-GGLYIPDTAKEKPC--KGQVIATGPGKVLENGTRVELAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            KGD VLF K++GTE+KL DG ++LVM+E DI+ I+ +
Sbjct: 60  KKGDQVLFNKYAGTEVKL-DGIDHLVMREEDILAILTD 96


>gi|115360015|ref|YP_777153.1| co-chaperonin GroES [Burkholderia ambifaria AMMD]
 gi|115285303|gb|ABI90819.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD]
          Length = 96

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ + P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRKDADGQRLVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E+LV++E DI+ +V
Sbjct: 60  RVGERVLFGKYAGQAVKV-DGNEFLVLREEDIVAVV 94


>gi|187735899|ref|YP_001878011.1| chaperonin Cpn10 [Akkermansia muciniphila ATCC BAA-835]
 gi|187425951|gb|ACD05230.1| chaperonin Cpn10 [Akkermansia muciniphila ATCC BAA-835]
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+R+++E KTA G + +PDT  EKP  +  E++ VG G  D+ G +IE  V
Sbjct: 4   IKPLGQRVLVKRIEAETKTA-GGLFLPDTAKEKPQEA--EVISVGTGGRDEKGALIEFTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL  K+ GTEIKL DGE+YL++ E+DI+ I+
Sbjct: 61  KPGDRVLISKYGGTEIKL-DGEDYLILSENDILAII 95


>gi|33594371|ref|NP_882015.1| co-chaperonin GroES [Bordetella pertussis Tohama I]
 gi|33595553|ref|NP_883196.1| co-chaperonin GroES [Bordetella parapertussis 12822]
 gi|33599951|ref|NP_887511.1| co-chaperonin GroES [Bordetella bronchiseptica RB50]
 gi|61220904|sp|P0A339|CH10_BORPE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|61220906|sp|P0A340|CH10_BORBR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|61220907|sp|P0A341|CH10_BORPA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|968919|gb|AAA74966.1| Cpn10 (GroES) [Bordetella pertussis]
 gi|33564446|emb|CAE43757.1| 10 kDa chaperonin [Bordetella pertussis Tohama I]
 gi|33565631|emb|CAE40278.1| 10 kDa chaperonin [Bordetella parapertussis]
 gi|33567548|emb|CAE31462.1| 10 kDa chaperonin [Bordetella bronchiseptica RB50]
 gi|332383782|gb|AEE68629.1| co-chaperonin GroES [Bordetella pertussis CS]
          Length = 95

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD+ +EKP    GE++ VG G   + GK++  ++
Sbjct: 3   LRPLHDRVIVKRLDNERKTASG-IVIPDSAAEKPD--QGEVVAVGPGKKTEDGKILPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E +I+ ++
Sbjct: 60  KAGDKVLFGKYAGQTVKV-DGEELLVIREDEILAVI 94


>gi|325528393|gb|EGD05533.1| co-chaperonin GroES [Burkholderia sp. TJI49]
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRRDTDGQRIAPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 60  KVGERVLFGKYAGQSVKV-DGAELLVLREEDIVAVV 94


>gi|293607557|ref|ZP_06689891.1| chaperone GroES [Achromobacter piechaudii ATCC 43553]
 gi|311108695|ref|YP_003981548.1| 10 kDa chaperonin [Achromobacter xylosoxidans A8]
 gi|292813990|gb|EFF73137.1| chaperone GroES [Achromobacter piechaudii ATCC 43553]
 gi|310763384|gb|ADP18833.1| 10 kDa chaperonin [Achromobacter xylosoxidans A8]
          Length = 95

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IPD+ +EKP    GE++ VG G   + GK++  ++
Sbjct: 3   LRPLGDRVIVKRLENERKTASG-IVIPDSAAEKPD--QGEVVAVGPGKKTEDGKILPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E +I+ +V
Sbjct: 60  KAGDKVLFGKYAGQSVKV-DGEELLVIREDEILAVV 94


>gi|317405441|gb|EFV85753.1| chaperonin [Achromobacter xylosoxidans C54]
          Length = 95

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IPD+ +EKP    GE++ VG G   + GK++  ++
Sbjct: 3   LRPLGDRVIVKRLENERKTASG-IVIPDSAAEKPD--QGEVVAVGPGKKTEDGKILPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E +I+ +V
Sbjct: 60  KAGDKVLFGKYAGQAVKV-DGEELLVIREDEILAVV 94


>gi|332530398|ref|ZP_08406343.1| co-chaperonin GroES [Hylemonella gracilis ATCC 19624]
 gi|332040209|gb|EGI76590.1| co-chaperonin GroES [Hylemonella gracilis ATCC 19624]
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+++E KTA+G I+IPD+ +EKP    GE++ VG G  +  G++    V
Sbjct: 3   LRPLADRVIVKRVENETKTASG-IVIPDSAAEKPD--QGEVLAVGPGKKNDKGELAAMNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMKEDDLFAVV 94


>gi|134095719|ref|YP_001100794.1| co-chaperonin GroES [Herminiimonas arsenicoxydans]
 gi|166198377|sp|A4G836|CH10_HERAR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|133739622|emb|CAL62673.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Herminiimonas
           arsenicoxydans]
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E KTA+G ++IP+  +EKP    GE++ +G G +   GKV   +V
Sbjct: 3   LRPLHDRVIVKRLDQETKTASG-LIIPEAAAEKPD--QGEVLAIGNGKILDDGKVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG E LVM+E DIM IV
Sbjct: 60  KVGDRVLFGKYAGQSVKV-DGNEVLVMREEDIMAIV 94


>gi|326562446|gb|EGE12765.1| co-chaperonin GroES [Moraxella catarrhalis 7169]
 gi|326562815|gb|EGE13110.1| co-chaperonin GroES [Moraxella catarrhalis 46P47B1]
 gi|326563220|gb|EGE13488.1| co-chaperonin GroES [Moraxella catarrhalis 12P80B1]
 gi|326563464|gb|EGE13727.1| co-chaperonin GroES [Moraxella catarrhalis 103P14B1]
 gi|326569154|gb|EGE19216.1| co-chaperonin GroES [Moraxella catarrhalis BC1]
 gi|326570640|gb|EGE20676.1| co-chaperonin GroES [Moraxella catarrhalis BC7]
 gi|326571347|gb|EGE21364.1| co-chaperonin GroES [Moraxella catarrhalis BC8]
 gi|326572958|gb|EGE22937.1| co-chaperonin GroES [Moraxella catarrhalis CO72]
 gi|326573774|gb|EGE23731.1| co-chaperonin GroES [Moraxella catarrhalis 101P30B1]
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E KTA G IL+P + +EKP    GE++  G G++ ++G+V   +V
Sbjct: 3   IRPLHDRIVVRRTEEEQKTA-GGILLPGSAAEKPQ--QGEVIAAGNGLVRENGEVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+VLFG++SG  +K+ DGEE L+++ESD++G++
Sbjct: 60  AVGDVVLFGQYSGQTVKV-DGEELLILKESDVLGVL 94


>gi|126725848|ref|ZP_01741690.1| chaperonin, 10 kDa [Rhodobacterales bacterium HTCC2150]
 gi|126705052|gb|EBA04143.1| chaperonin, 10 kDa [Rhodobacterales bacterium HTCC2150]
          Length = 95

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   RV+VRR++S+ KTA G + IPD+  EKP+   GE++  G G+   +G++I   V
Sbjct: 3   LTPLHDRVLVRRVESDEKTA-GGLFIPDSAKEKPA--EGEVVACGEGLRKDNGELIAMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGKW+G EI   +G+E L+M+ESDI GI+
Sbjct: 60  KPGDKVLFGKWNGVEITF-EGDELLMMKESDIFGII 94


>gi|319791891|ref|YP_004153531.1| chaperonin cpn10 [Variovorax paradoxus EPS]
 gi|315594354|gb|ADU35420.1| Chaperonin Cpn10 [Variovorax paradoxus EPS]
          Length = 97

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+ SE KTA+G I+IPD  +EKP    GE++ VG G  +  G +    V
Sbjct: 3   LRPLADRVIVKRIDSETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRNDKGDLAALTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMKEDDLFAVV 94


>gi|162454187|ref|YP_001616554.1| GroES-like protein [Sorangium cellulosum 'So ce 56']
 gi|161164769|emb|CAN96074.1| GroES-like protein [Sorangium cellulosum 'So ce 56']
          Length = 96

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+R++ E KT  G + IPDT  EKP    G ++ VG G + + G V + +V
Sbjct: 3   IRPLQDRVIVQRVKEEEKTK-GGLYIPDTAKEKPI--EGTVVAVGNGKVAEDGTVRKLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFGK+SGTE+K+ DGEE+L+++E DI+G++
Sbjct: 60  KEGDRVLFGKYSGTEVKI-DGEEHLILREDDILGVI 94


>gi|296135133|ref|YP_003642375.1| Chaperonin Cpn10 [Thiomonas intermedia K12]
 gi|294339185|emb|CAZ87539.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Thiomonas sp.
           3As]
 gi|295795255|gb|ADG30045.1| Chaperonin Cpn10 [Thiomonas intermedia K12]
          Length = 96

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+R++ E  TA+G I+IP + +EKP    GE++ VG G  D  GK++   V
Sbjct: 3   LRPLHDRVVVKRIEQETTTASG-IVIPGSAAEKPD--QGEVLAVGPGKHDDQGKLVAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E +VM+E D+M ++
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGDELMVMREDDLMAVI 94


>gi|301632221|ref|XP_002945188.1| PREDICTED: 10 kDa chaperonin-like [Xenopus (Silurana) tropicalis]
          Length = 96

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL++E KTA+G I+IPD  +EKP    GE++ VG G  +  G V    V
Sbjct: 3   LRPLHDRVIVKRLENETKTASG-IVIPDNAAEKPD--QGEVLAVGPGKKNDQGVVSPLGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+N G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVN-GDELLVMKEDDLFAVV 94


>gi|218680270|ref|ZP_03528167.1| 10 kDa chaperonin, heat shock protein [Rhizobium etli CIAT 894]
          Length = 116

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 63/94 (67%), Gaps = 4/94 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   R++VRR++SE KT  G I+IPDT  EKP    G ++ VG+G  D++G++   +V
Sbjct: 3   FRPLHDRILVRRVESEEKT-KGGIIIPDTAKEKPQ--EGVVIAVGSGARDEAGQIQALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
             GD +LFGKWSGTEIK+N GE+ L+M+     G
Sbjct: 60  KAGDRILFGKWSGTEIKIN-GEDLLIMKGKRCHG 92


>gi|332701272|ref|ZP_08421360.1| 10 kDa chaperonin [Desulfovibrio africanus str. Walvis Bay]
 gi|332551421|gb|EGJ48465.1| 10 kDa chaperonin [Desulfovibrio africanus str. Walvis Bay]
          Length = 95

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+SE +   G I+IPD+  EKP    GE++ VG G     G+ I+  V
Sbjct: 3   LKPLHDRVLVKRLESE-EVTKGGIIIPDSAKEKPI--KGEVIAVGPGKTSDKGEKIKMNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KG+ VLF K++GTEIK+ DG+E+LVM+E DI+ I+
Sbjct: 60  EKGNKVLFNKYAGTEIKV-DGDEFLVMREDDILAII 94


>gi|108759998|ref|YP_633051.1| co-chaperonin GroES [Myxococcus xanthus DK 1622]
 gi|122980867|sp|Q1D2S2|CH10_MYXXD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|108463878|gb|ABF89063.1| chaperonin GroS [Myxococcus xanthus DK 1622]
          Length = 96

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++V+R+  E KT  G + IPDT  EKP    G+++ VG G + + GKV   ++
Sbjct: 3   IRPLQDRLIVKRVAEENKT-KGGLFIPDTAKEKPL--EGKVIAVGNGKVQEDGKVRPLDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++GTEIKL DGEE+L+++E D++G++
Sbjct: 60  KAGDTILFSKYAGTEIKL-DGEEHLILREEDVLGVI 94


>gi|296113706|ref|YP_003627644.1| chaperonin protein Cpn10 [Moraxella catarrhalis RH4]
 gi|295921400|gb|ADG61751.1| chaperonin protein Cpn10 [Moraxella catarrhalis RH4]
          Length = 140

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E KTA G IL+P + +EKP    GE++  G G++ ++G+V   +V
Sbjct: 47  IRPLHDRIVVRRTEEEQKTA-GGILLPGSAAEKPQ--QGEVIAAGNGLVRENGEVRPLDV 103

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+VLFG++SG  +K+ DGEE L+++ESD++G++
Sbjct: 104 AVGDVVLFGQYSGQTVKV-DGEELLILKESDVLGVL 138


>gi|218297028|ref|ZP_03497705.1| chaperonin Cpn10 [Thermus aquaticus Y51MC23]
 gi|218242583|gb|EED09120.1| chaperonin Cpn10 [Thermus aquaticus Y51MC23]
          Length = 101

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M  E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++
Sbjct: 1   MAAEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGTGRILEN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 58  GQRVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 100


>gi|46200015|ref|YP_005682.1| co-chaperonin GroES [Thermus thermophilus HB27]
 gi|55980241|ref|YP_143538.1| co-chaperonin GroES [Thermus thermophilus HB8]
 gi|47606332|sp|P61492|CH10_THET2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|47606333|sp|P61493|CH10_THET8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1066157|dbj|BAA08298.1| chaperonin-10 [Thermus thermophilus]
 gi|6689421|emb|CAB65481.1| chaperonin-10 [Thermus thermophilus HB27]
 gi|46197642|gb|AAS82055.1| 10 kDa chaperonin groES [Thermus thermophilus HB27]
 gi|55771654|dbj|BAD70095.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Thermus
           thermophilus HB8]
 gi|1581935|prf||2117332A chaperonin 10
          Length = 101

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M  E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++
Sbjct: 1   MAAEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGTGRVLEN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 58  GQRVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 100


>gi|320449188|ref|YP_004201284.1| chaperonin GroS [Thermus scotoductus SA-01]
 gi|320149357|gb|ADW20735.1| chaperonin GroS [Thermus scotoductus SA-01]
          Length = 101

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 71/104 (68%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M  E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG+G +  +
Sbjct: 1   MAAEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGSGRILDN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 58  GQKVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 100


>gi|116625796|ref|YP_827952.1| chaperonin Cpn10 [Candidatus Solibacter usitatus Ellin6076]
 gi|116228958|gb|ABJ87667.1| chaperonin Cpn10 [Candidatus Solibacter usitatus Ellin6076]
          Length = 105

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VV+R+++  +   G + IPDT  EKP    GE++ VG G   + GKVI  +V
Sbjct: 3   IRPLYDRIVVKRIEN-TEQMQGGLYIPDTAKEKPQ--EGEVVAVGKGKRLEDGKVIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SG++IKL DG+EYL+M+E +++GI+
Sbjct: 60  QVGDKILFGKYSGSDIKL-DGDEYLIMREDEVLGIL 94


>gi|167590160|ref|ZP_02382548.1| co-chaperonin GroES [Burkholderia ubonensis Bu]
          Length = 96

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E  TA+G I+IPD+ +EKP    GE++ VG G  D  G+ I P++
Sbjct: 3   LRPLHDRVIVKRLDQETTTASG-IVIPDSAAEKPD--QGEVIAVGPGRRDNDGQRIVPDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VLFGK++G  +K+ DG E LV++E DI+ +V
Sbjct: 60  KVGERVLFGKYAGQTVKV-DGSELLVLREEDIVAVV 94


>gi|15613124|ref|NP_241427.1| co-chaperonin GroES [Bacillus halodurans C-125]
 gi|10720366|sp|O50304|CH10_BACHD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|10173174|dbj|BAB04280.1| class I heat-shock protein (chaperonin) [Bacillus halodurans C-125]
          Length = 94

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+ ++++E KTA+G I++PDT  EKP    G ++ VG G + ++G+ I  EV
Sbjct: 2   LKPLGDRVVIEQVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGTGRVTENGEKIALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+K  DG+EYL+++ESDI+ I+
Sbjct: 59  KEGDSVIFSKYAGTEVKY-DGKEYLILRESDILAII 93


>gi|218288236|ref|ZP_03492535.1| chaperonin Cpn10 [Alicyclobacillus acidocaldarius LAA1]
 gi|258510393|ref|YP_003183827.1| chaperonin Cpn10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218241595|gb|EED08768.1| chaperonin Cpn10 [Alicyclobacillus acidocaldarius LAA1]
 gi|257477119|gb|ACV57438.1| chaperonin Cpn10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 95

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVVR ++ E KTA+G I +PD   EKP    GE++ VG G +D+ G  +  EV
Sbjct: 2   LKPLADRVVVRPVEREEKTASG-IFLPDNAKEKPQ--EGEVIAVGPGKLDEKGNRVAMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++GTE+K+N+ EE L+++ESDI+ IV
Sbjct: 59  KVGDRVIYSKYAGTEVKVNN-EELLILRESDILAIV 93


>gi|226940797|ref|YP_002795871.1| co-chaperonin GroES [Laribacter hongkongensis HLHK9]
 gi|226715724|gb|ACO74862.1| GroES [Laribacter hongkongensis HLHK9]
          Length = 95

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G I++P T +EKP    GE++ VG G +  +G+    E+
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASG-IVLPGTATEKPDM--GEVVAVGNGKVLDNGERRALEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K+ DGEE LVM+E DIMGIV
Sbjct: 60  KTGDKVIFGKYSGQAVKI-DGEELLVMREEDIMGIV 94


>gi|326574804|gb|EGE24738.1| co-chaperonin GroES [Moraxella catarrhalis O35E]
          Length = 96

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E KTA G IL+P + +EKP    GE++  G G++  +G+V   +V
Sbjct: 3   IRPLHDRIVVRRTEEEQKTA-GGILLPGSAAEKPQ--QGEVIAAGNGLVRDNGEVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+VLFG++SG  +K+ DGEE L+++ESD++G++
Sbjct: 60  AVGDVVLFGQYSGQTVKV-DGEELLILKESDVLGVL 94


>gi|241766722|ref|ZP_04764558.1| chaperonin Cpn10 [Acidovorax delafieldii 2AN]
 gi|241362924|gb|EER58637.1| chaperonin Cpn10 [Acidovorax delafieldii 2AN]
          Length = 96

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++SE  TA+G I+IPD  +EKP    GE++ VG G  +  G++I   V
Sbjct: 3   LRPLHDRVIVKRIESETTTASG-IVIPDNAAEKPD--QGEVLAVGPGKKNDKGELIALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+  G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVK-GDELLVMKEDDLFAVV 94


>gi|145219400|ref|YP_001130109.1| co-chaperonin GroES [Prosthecochloris vibrioformis DSM 265]
 gi|189044114|sp|A4SDP8|CH10_PROVI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|145205564|gb|ABP36607.1| chaperonin Cpn10 [Chlorobium phaeovibrioides DSM 265]
          Length = 95

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG M  SG+++E  V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPM--YGEVVAVGAGKMSDSGQLLEMPV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  KAGDKVLYGKYSGTEVSV-EGEDYLIMRESDIFAIL 94


>gi|187930494|ref|YP_001900981.1| chaperonin Cpn10 [Ralstonia pickettii 12J]
 gi|241664662|ref|YP_002983022.1| chaperonin Cpn10 [Ralstonia pickettii 12D]
 gi|309780520|ref|ZP_07675267.1| chaperonin GroS [Ralstonia sp. 5_7_47FAA]
 gi|187727384|gb|ACD28549.1| chaperonin Cpn10 [Ralstonia pickettii 12J]
 gi|240866689|gb|ACS64350.1| chaperonin Cpn10 [Ralstonia pickettii 12D]
 gi|308920675|gb|EFP66325.1| chaperonin GroS [Ralstonia sp. 5_7_47FAA]
          Length = 105

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG G + Q G   E ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGTGRLLQDGTQRELQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGEELLVMREEDVMGVI 94


>gi|114777817|ref|ZP_01452748.1| co-chaperonin GroES [Mariprofundus ferrooxydans PV-1]
 gi|114551808|gb|EAU54348.1| co-chaperonin GroES [Mariprofundus ferrooxydans PV-1]
          Length = 142

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+VRRL  E K+A G I+IPD+  EKP    GE++  G G + ++G V   +V
Sbjct: 49  VRPLHDRVIVRRLDEEEKSA-GGIIIPDSAKEKPL--EGEVISAGKGKILENGDVRPLDV 105

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTEIKL DG+++L+M+E DI+G++
Sbjct: 106 KAGDKVIFSKYAGTEIKL-DGDDFLMMREDDILGVI 140


>gi|302879832|ref|YP_003848396.1| Chaperonin Cpn10 [Gallionella capsiferriformans ES-2]
 gi|302582621|gb|ADL56632.1| Chaperonin Cpn10 [Gallionella capsiferriformans ES-2]
          Length = 96

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ ++KTA+G I++  T  EKP   +GE++ VG G ++  GK+    V
Sbjct: 3   IRPLSDRVIVKRMEEDVKTASG-IVLASTAVEKPD--TGEVVAVGNGKVNNDGKLQSMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG   K+ DG+EYL M+E DI+GIV
Sbjct: 60  KVGDKVLFGKYSGQTFKM-DGQEYLTMREDDIIGIV 94


>gi|239814126|ref|YP_002943036.1| chaperonin Cpn10 [Variovorax paradoxus S110]
 gi|259585895|sp|C5CPP9|CH10_VARPS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|239800703|gb|ACS17770.1| chaperonin Cpn10 [Variovorax paradoxus S110]
          Length = 96

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+ SE KTA+G I+IPD  +EKP    GE++ VG G   + G +    V
Sbjct: 3   LRPLADRVIVKRVDSETKTASG-IVIPDAAAEKPD--QGEVLAVGPGKRTEKGDLTALTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMKEDDLFAVV 94


>gi|53805104|ref|YP_113216.1| co-chaperonin GroES [Methylococcus capsulatus str. Bath]
 gi|53758865|gb|AAU93156.1| chaperonin, 10 kDa subunit [Methylococcus capsulatus str. Bath]
          Length = 96

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++RL+ E +T+ G I+IPD+ +EKP    GEI+ VG G +  +G+V   +V
Sbjct: 3   IRPLHDRVIIKRLEEE-RTSAGGIVIPDSAAEKPM--RGEILAVGNGKVLDNGEVRALQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+K+ DGE+ +VM+E DI+ ++
Sbjct: 60  KVGDKVLFGKYAGTEVKV-DGEDVVVMREDDILAVL 94


>gi|261418571|ref|YP_003252253.1| co-chaperonin GroES [Geobacillus sp. Y412MC61]
 gi|297528599|ref|YP_003669874.1| chaperonin Cpn10 [Geobacillus sp. C56-T3]
 gi|319765385|ref|YP_004130886.1| chaperonin Cpn10 [Geobacillus sp. Y412MC52]
 gi|261375028|gb|ACX77771.1| chaperonin Cpn10 [Geobacillus sp. Y412MC61]
 gi|297251851|gb|ADI25297.1| Chaperonin Cpn10 [Geobacillus sp. C56-T3]
 gi|317110251|gb|ADU92743.1| Chaperonin Cpn10 [Geobacillus sp. Y412MC52]
          Length = 94

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  +++E KTA+G I++PDT  EKP    G ++ VGAG +  +G+ I PEV
Sbjct: 2   LKPLGDRIVIEVVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGAGRVLDNGQRIAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|239825803|ref|YP_002948427.1| co-chaperonin GroES [Geobacillus sp. WCH70]
 gi|259585884|sp|C5D4F3|CH10_GEOSW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|239806096|gb|ACS23161.1| chaperonin Cpn10 [Geobacillus sp. WCH70]
          Length = 94

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +++E KTA+G I++PDT  EKP    G ++ VG G +  SG+ + PEV
Sbjct: 2   LKPLGDRVVIEVIETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGKGRVLDSGECVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|50085882|ref|YP_047392.1| co-chaperonin GroES [Acinetobacter sp. ADP1]
 gi|60389580|sp|Q6F8P5|CH10_ACIAD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|49531858|emb|CAG69570.1| chaperone Hsp10, affects cell division [Acinetobacter sp. ADP1]
          Length = 96

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 69/96 (71%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  + GE++ VG G + ++G V   +V
Sbjct: 4   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--AQGEVIAVGNGQITENG-VRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K+N GEE+L+M+ESDI+ ++
Sbjct: 60  KAGDKVLFGTYAGTTVKVN-GEEFLIMKESDILAVL 94


>gi|225025131|ref|ZP_03714323.1| hypothetical protein EIKCOROL_02023 [Eikenella corrodens ATCC
           23834]
 gi|224942092|gb|EEG23301.1| hypothetical protein EIKCOROL_02023 [Eikenella corrodens ATCC
           23834]
          Length = 95

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G I++P + +EKP    GE++ VGAG + + G+  + +V
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASG-IVLPGSAAEKPDM--GEVVAVGAGKLTKGGERRKLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDRVIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|121603569|ref|YP_980898.1| co-chaperonin GroES [Polaromonas naphthalenivorans CJ2]
 gi|166198392|sp|A1VJZ9|CH10_POLNA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|120592538|gb|ABM35977.1| chaperonin Cpn10 [Polaromonas naphthalenivorans CJ2]
          Length = 96

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+++E KTA+G I+IPD+ +EKP    GE++ VG G  +  G++    V
Sbjct: 3   LRPLHDRVIVKRVENETKTASG-IVIPDSAAEKPD--QGEVLAVGPGKKNDKGELGAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKV-DGDELLVMKEEDLFAVV 94


>gi|93005370|ref|YP_579807.1| co-chaperonin GroES [Psychrobacter cryohalolentis K5]
 gi|123386767|sp|Q1QDD0|CH10_PSYCK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|92393048|gb|ABE74323.1| chaperonin Cpn10 [Psychrobacter cryohalolentis K5]
          Length = 96

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR++ E KTA G IL+P +  EKPS   GE++  G G +  +G+    +V
Sbjct: 3   IRPLHDRIVVRRIEEETKTA-GGILLPGSAQEKPS--QGEVLATGNGQIRDNGETRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G  +K+ DGEE L+M+ESD++G++
Sbjct: 60  KAGDKVLFGQYAGQTVKV-DGEELLIMKESDVLGVL 94


>gi|187477089|ref|YP_785113.1| co-chaperonin GroES [Bordetella avium 197N]
 gi|123738607|sp|Q2KXY8|CH10_BORA1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|115421675|emb|CAJ48185.1| 10 kDa chaperonin [Bordetella avium 197N]
          Length = 95

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL +E KTA+G I+IPD+ +EKP    GE++ VG G   + GK++  ++
Sbjct: 3   LRPLHDRVIVKRLDNERKTASG-IVIPDSAAEKPD--QGEVLAVGPGKKTEDGKILPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LV++E +I+ ++
Sbjct: 60  KVGDKVLFGKYAGQGVKV-DGEELLVIREEEILAVI 94


>gi|114319186|ref|YP_740869.1| co-chaperonin GroES [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312792|sp|Q0ACQ8|CH10_ALHEH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|114225580|gb|ABI55379.1| chaperonin Cpn10 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 95

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++R++ E +T+ G I+IPD+ +EKP    GE++ VG G +  +G+    ++
Sbjct: 3   IRPLHDRVVIKRMEEE-RTSPGGIVIPDSAAEKPI--KGEVVAVGNGKLLDNGETRPLDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+K+ DGEE LVM+E D+M IV
Sbjct: 60  KVGDKVLFGKFAGTEVKV-DGEELLVMREDDVMAIV 94


>gi|86160011|ref|YP_466796.1| co-chaperonin GroES [Anaeromyxobacter dehalogenans 2CP-C]
 gi|197124050|ref|YP_002136001.1| co-chaperonin GroES [Anaeromyxobacter sp. K]
 gi|220918822|ref|YP_002494126.1| chaperonin Cpn10 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|85776522|gb|ABC83359.1| Chaperonin Cpn10, GroES [Anaeromyxobacter dehalogenans 2CP-C]
 gi|196173899|gb|ACG74872.1| chaperonin Cpn10 [Anaeromyxobacter sp. K]
 gi|219956676|gb|ACL67060.1| chaperonin Cpn10 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 97

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++V+R+Q E KT  G I+IPD+  EKP    G+++  G G + + GKV   +V
Sbjct: 4   IRPLQDRLIVKRVQEEEKT-KGGIIIPDSAKEKPI--EGKVIAAGNGKVLEDGKVRPLDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K+ DGEE+L+M+E DI+G++
Sbjct: 61  KAGDRVLFSKYAGTEVKI-DGEEHLIMREEDILGVI 95


>gi|71065120|ref|YP_263847.1| co-chaperonin GroES [Psychrobacter arcticus 273-4]
 gi|123775629|sp|Q4FU95|CH10_PSYA2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|71038105|gb|AAZ18413.1| putative Chaperonin HSP10 [Psychrobacter arcticus 273-4]
 gi|189008659|gb|ACD68571.1| GroES [Psychrobacter frigidicola]
          Length = 96

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR++ E KTA G IL+P +  EKPS   GE++  G G +  +G+    +V
Sbjct: 3   IRPLHDRIVVRRIEEETKTA-GGILLPGSAQEKPS--QGEVLATGNGQIRDNGETRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G  +K+ DGEE L+M+ESD++G++
Sbjct: 60  KTGDKVLFGQYAGQTVKV-DGEELLIMKESDVLGVL 94


>gi|91786662|ref|YP_547614.1| co-chaperonin GroES [Polaromonas sp. JS666]
 gi|123356095|sp|Q12FH6|CH10_POLSJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|91695887|gb|ABE42716.1| chaperonin Cpn10 [Polaromonas sp. JS666]
          Length = 96

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+++E KTA+G I+IPD+ +EKP    GE++ VG G  +  G +    V
Sbjct: 3   LRPLHDRVIVKRVENETKTASG-IVIPDSAAEKPD--QGEVLAVGPGKKNDKGDLSPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DG+E LVM+E D+  +V
Sbjct: 60  KIGDRVLFGKYSGQTVKV-DGDELLVMKEEDLFAVV 94


>gi|326795331|ref|YP_004313151.1| 10 kDa chaperonin [Marinomonas mediterranea MMB-1]
 gi|326546095|gb|ADZ91315.1| 10 kDa chaperonin [Marinomonas mediterranea MMB-1]
          Length = 96

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E  TA+G I++P + +EKP+   GE++ VG G +  +G V E  V
Sbjct: 3   IRPLHDRVVVRRKEEETTTASG-IVLPGSATEKPT--QGEVLAVGTGRIQSNGDVRELAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG++SG  +K+ DGEE L+M+E +I GIV
Sbjct: 60  KTGDTVLFGQYSGQTVKI-DGEELLIMKEEEIYGIV 94


>gi|37520597|ref|NP_923974.1| co-chaperonin GroES [Gloeobacter violaceus PCC 7421]
 gi|35211591|dbj|BAC88969.1| chaperonin GroES [Gloeobacter violaceus PCC 7421]
          Length = 103

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 64/95 (67%), Gaps = 4/95 (4%)

Query: 10  RPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVS 69
           RP   RV+V+ ++ E +TA G I +PDT  EKP   +GE++ VG G +   G  ++PEV 
Sbjct: 12  RPLGDRVLVKVVEQEERTA-GGIFLPDTAKEKPQ--TGEVVAVGPGRLKDDGTRVDPEVK 68

Query: 70  KGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            GD VL+GK+SGT++KL D  EY+++ E DI+ IV
Sbjct: 69  VGDTVLYGKYSGTDLKLGDA-EYMLVAEKDILAIV 102


>gi|300819971|ref|ZP_07100152.1| chaperonin GroS [Escherichia coli MS 107-1]
 gi|300527471|gb|EFK48533.1| chaperonin GroS [Escherichia coli MS 107-1]
          Length = 130

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++R + E K + G I+IPD+ +EKP    G+++ VG G +  +G V  P+V
Sbjct: 38  IKPLYDRVVIKRTEEE-KVSAGGIVIPDSATEKPI--KGQVVAVGEGKVFDNGNVRAPKV 94

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+KL DG EYLV++E DI  ++
Sbjct: 95  KVGDQVLFGKYAGTEVKL-DGTEYLVVKEDDIFAVL 129


>gi|237640304|ref|YP_002891159.1| GroS [Escherichia coli]
 gi|237810047|ref|YP_002894487.1| GroS [Escherichia coli]
 gi|229561523|gb|ACQ77726.1| GroS [Escherichia coli]
 gi|229561903|gb|ACQ78104.1| GroS [Escherichia coli]
          Length = 146

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++R + E K + G I+IPD+ +EKP    G+++ VG G +  +G V  P+V
Sbjct: 54  IKPLYDRVVIKRTEEE-KVSAGGIVIPDSATEKPI--KGQVVAVGEGKVFDNGNVRAPKV 110

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+KL DG EYLV++E DI  ++
Sbjct: 111 KVGDQVLFGKYAGTEVKL-DGTEYLVVKEDDIFAVL 145


>gi|325527714|gb|EGD05001.1| chaperonin Cpn10 [Burkholderia sp. TJI49]
          Length = 105

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++++  TA+G I+IPD+ +EKP    GE++ VG G + Q G +   ++
Sbjct: 3   IRPLYDRVIVKRIETQRTTASG-IVIPDSAAEKPE--QGEVLAVGNGRLLQDGTLRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDHVLFGKYAGQTVKV-DGEELLVMREEDVMGVL 94


>gi|307316013|ref|ZP_07595492.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
 gi|306898338|gb|EFN29046.1| Chaperonin Cpn10 [Sinorhizobium meliloti BL225C]
          Length = 70

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 56/72 (77%), Gaps = 3/72 (4%)

Query: 33  LIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEY 92
           +IPDT  EKP    GEI+ VG+G  D+SGKV+  +V  GD +LFGKWSGTE+K+N GE+ 
Sbjct: 1   IIPDTAKEKPQ--EGEIVAVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKIN-GEDL 57

Query: 93  LVMQESDIMGIV 104
           L+M+E+DIMG++
Sbjct: 58  LIMKEADIMGVI 69


>gi|162451052|ref|YP_001613419.1| GroES-like protein [Sorangium cellulosum 'So ce 56']
 gi|161161634|emb|CAN92939.1| GroES-like protein [Sorangium cellulosum 'So ce 56']
          Length = 98

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R+VV+R++SE KT  G I+IPD   EKP    G ++ VG G + + GKV   +V
Sbjct: 3   IRPLQDRIVVKRVESETKT-KGGIIIPDAAKEKPI--EGRVVAVGNGKVLKDGKVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLFGK+SGTE+KL DGEE+++++E D++ +
Sbjct: 60  KVGDKVLFGKYSGTEVKL-DGEEHVLIREDDVLAV 93


>gi|149927966|ref|ZP_01916216.1| co-chaperonin GroES [Limnobacter sp. MED105]
 gi|149823405|gb|EDM82638.1| co-chaperonin GroES [Limnobacter sp. MED105]
          Length = 90

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           RV+V+RL SE  TA+G I+IP+  +EKP    GE++ VG G  D SGK+I  +V  G  V
Sbjct: 3   RVIVKRLDSERTTASG-IVIPEAAAEKPD--QGEVIAVGPGKRDDSGKLIAMDVKVGQRV 59

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           LFGK++G  IK+ DG+E LVM+E DIMG++
Sbjct: 60  LFGKYAGQAIKV-DGKEVLVMREEDIMGVI 88


>gi|297570119|ref|YP_003691463.1| Chaperonin Cpn10 [Desulfurivibrio alkaliphilus AHT2]
 gi|296926034|gb|ADH86844.1| Chaperonin Cpn10 [Desulfurivibrio alkaliphilus AHT2]
          Length = 96

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+RL+ E KT  G I+IPD+  EKP+   G +  VG G ++  G  +  E+
Sbjct: 3   IRPLNDRILVKRLEEEEKTK-GGIIIPDSAKEKPA--EGTVEAVGNGRLNDKGDRVPVEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+ GTEIK+ +GEEYL+M+E DI+G+V
Sbjct: 60  KVGDRVLFSKYGGTEIKI-EGEEYLIMREDDILGVV 94


>gi|51473807|ref|YP_067564.1| co-chaperonin GroES [Rickettsia typhi str. Wilmington]
 gi|20178264|sp|P80469|CH10_RICTY RecName: Full=10 kDa chaperonin; AltName: Full=10 kDa heat shock
           protein; AltName: Full=GroES protein; AltName:
           Full=HSP10; AltName: Full=Protein Cpn10
 gi|18266429|gb|AAL67575.1|AF462073_1 chaperonin GroES [Rickettsia typhi]
 gi|51460119|gb|AAU04082.1| 10 kDa chaperonin [Rickettsia typhi str. Wilmington]
          Length = 95

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ +++E KT  G I+IPDT  EKP    GEI+ VG GV++++G++   E+
Sbjct: 3   FKPLHDRIAIKPIENEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGVLNKNGEIYPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GEKLIVMKESDVFGII 94


>gi|220904815|ref|YP_002480127.1| co-chaperonin GroES [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254813839|sp|B8J122|CH10_DESDA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219869114|gb|ACL49449.1| chaperonin Cpn10 [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 95

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL++E KTA G + IPDT  EKPS   G+++ VG G +  +G+     V
Sbjct: 3   LKPLNDRVLVKRLETEEKTA-GGLYIPDTAKEKPS--KGQVVAVGPGKVGDNGERTALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+KL DG ++LVM+E DI+ I+
Sbjct: 60  KAGDEVLFNKYAGTEVKL-DGVDHLVMREEDILAII 94


>gi|172065374|ref|YP_001816086.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6]
 gi|171997616|gb|ACB68533.1| chaperonin Cpn10 [Burkholderia ambifaria MC40-6]
          Length = 105

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++++  TA+G I+IPD+ +EKP    GE++ VG+G + Q G +   +V
Sbjct: 3   IRPLYDRVIVKRIETQRTTASG-IVIPDSAAEKPE--QGEVVAVGSGRLLQDGTLHALQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGDELLVMREEDVMGVL 94


>gi|292572255|gb|ADE30170.1| 10 kDa chaperonin [Rickettsia prowazekii Rp22]
          Length = 99

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 70/101 (69%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ +++E KT  G I+IPDT  EKP    GEI+ VG GV++++G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIENEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGVLNKNGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  GE+ +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIEIK-GEKLIVMKESDVFGII 98


>gi|326315732|ref|YP_004233404.1| Chaperonin Cpn10 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372568|gb|ADX44837.1| Chaperonin Cpn10 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 96

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++SE  TA+G I+IPD  +EKP    GE++ VG G  +  G++    V
Sbjct: 3   LRPLHDRVIVKRIESETTTASG-IVIPDNAAEKPD--QGEVLAVGPGKKNDKGELSVLSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+N G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVN-GDELLVMKEDDLFAVV 94


>gi|56418783|ref|YP_146101.1| co-chaperonin GroES [Geobacillus kaustophilus HTA426]
 gi|81819820|sp|Q5L3E7|CH10_GEOKA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|56378625|dbj|BAD74533.1| chaperonin (GroES protein) [Geobacillus kaustophilus HTA426]
          Length = 93

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+  +++E KTA+G I++PDT  EKP    G ++ VGAG +  +G+ I PEV
Sbjct: 1   MKPLGDRIVIEVVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGAGRVLDNGQRIAPEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 58  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 92


>gi|94500715|ref|ZP_01307244.1| Co-chaperonin GroES (HSP10) [Oceanobacter sp. RED65]
 gi|94427037|gb|EAT12018.1| Co-chaperonin GroES (HSP10) [Oceanobacter sp. RED65]
          Length = 95

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E KTA G I++P   +EKP+   GE++ VG+G + Q+G+V    V
Sbjct: 3   IRPLHDRIVVRRKEEETKTA-GGIVLPGAAAEKPN--QGEVVAVGSGRILQNGEVQPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLFG++    +K+ DGEE L+M ESD++GI+
Sbjct: 60  KEGDTVLFGQYGANTVKI-DGEELLIMNESDVLGII 94


>gi|197116648|ref|YP_002137075.1| chaperonin GroES [Geobacter bemidjiensis Bem]
 gi|226701770|sp|B5E9Y1|CH10_GEOBB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|197086008|gb|ACH37279.1| chaperonin GroES [Geobacter bemidjiensis Bem]
          Length = 96

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++    TA G + IP+T  EKP    GE++ VG G   + GKV   ++
Sbjct: 3   LRPLQDRIIVKRVEEATMTA-GGLYIPETAKEKPQ--QGEVVAVGNGKRGEDGKVYPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G+E+KL +GE++L+M+E DI+G+V
Sbjct: 60  KVGDKVLFGKYAGSEVKL-EGEDFLIMREDDILGVV 94


>gi|134047194|ref|YP_001102019.1| 10 kDa chaperonin GroS [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|133905113|gb|ABO41128.1| 10 kDa chaperonin GroS [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
          Length = 106

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++R + E K + G I+IPD+ +EKP    G+++ VG G +  +G V  P+V
Sbjct: 14  IKPLYDRVVIKRTEEE-KVSAGGIVIPDSATEKPI--KGQVVAVGEGKVFDNGNVRAPKV 70

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+KL DG EYLV++E DI  ++
Sbjct: 71  KVGDQVLFGKYAGTEVKL-DGTEYLVVKEDDIFAVL 105


>gi|115361134|ref|YP_778271.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD]
 gi|171319178|ref|ZP_02908297.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
 gi|115286462|gb|ABI91937.1| chaperonin Cpn10 [Burkholderia ambifaria AMMD]
 gi|171095606|gb|EDT40567.1| chaperonin Cpn10 [Burkholderia ambifaria MEX-5]
          Length = 105

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++++  TA+G I+IPD+ +EKP    GE++ VG+G + Q G +   +V
Sbjct: 3   IRPLYDRVIVKRIETQRTTASG-IVIPDSAAEKPE--QGEVVAVGSGRLLQDGTLRALQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGDELLVMREEDVMGVL 94


>gi|170698818|ref|ZP_02889881.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
 gi|170136296|gb|EDT04561.1| chaperonin Cpn10 [Burkholderia ambifaria IOP40-10]
          Length = 105

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++++  TA+G I+IPD+ +EKP    GE++ VG+G + Q G +   +V
Sbjct: 3   IRPLYDRVIVKRIETQRTTASG-IVIPDSAAEKPE--QGEVVAVGSGRLLQDGTLRALQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DG+E LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGDELLVMREEDVMGVL 94


>gi|163781594|ref|ZP_02176594.1| GroES [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882814|gb|EDP76318.1| GroES [Hydrogenivirga sp. 128-5-R1-1]
          Length = 103

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 3/100 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   ++VVRR + + +     I+IPDT  EKP    GE++ VG G +  +G++   +V
Sbjct: 4   LKPLYDKIVVRRFEEQEQKTPSGIIIPDTAKEKPQM--GEVVAVGEGKLLNNGELKPLKV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEK 108
            +GD+VLF K++GTE++L DGE+YLVM E +++ IV + K
Sbjct: 62  KEGDVVLFNKYAGTEVEL-DGEQYLVMSEDEVLAIVEDAK 100


>gi|226939588|ref|YP_002794661.1| co-chaperonin GroES [Laribacter hongkongensis HLHK9]
 gi|226714514|gb|ACO73652.1| GroES [Laribacter hongkongensis HLHK9]
          Length = 95

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G I++P   +EKP    GE++ VG G +  +G+  + E+
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASG-IVLPGNAAEKPDM--GEVVAVGNGKVLDNGERRQLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K+ DGEE LVM+E D+MGIV
Sbjct: 60  KAGDKVIFGKYSGQTVKV-DGEELLVMREEDVMGIV 94


>gi|34498687|ref|NP_902902.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472]
 gi|34104539|gb|AAQ60897.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472]
          Length = 105

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+R++   +TA+G I+IPD+ +EKP    GE++ VG G     G ++  +V
Sbjct: 3   IRPLHDRIIVKRVEKVRQTASG-IVIPDSAAEKPE--QGEVLAVGPGKRLPDGTLLPMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLFGK+ G  +KLND +EYLV++E D+ G+V
Sbjct: 60  QVGDLVLFGKYGGQTVKLND-QEYLVLREEDVFGVV 94


>gi|59802395|ref|YP_209107.1| co-chaperonin GroES [Neisseria gonorrhoeae FA 1090]
 gi|239998043|ref|ZP_04717967.1| co-chaperonin GroES [Neisseria gonorrhoeae 35/02]
 gi|240112014|ref|ZP_04726504.1| co-chaperonin GroES [Neisseria gonorrhoeae MS11]
 gi|240114762|ref|ZP_04728824.1| co-chaperonin GroES [Neisseria gonorrhoeae PID18]
 gi|240116962|ref|ZP_04731024.1| co-chaperonin GroES [Neisseria gonorrhoeae PID1]
 gi|240124525|ref|ZP_04737481.1| co-chaperonin GroES [Neisseria gonorrhoeae PID332]
 gi|240124788|ref|ZP_04737674.1| co-chaperonin GroES [Neisseria gonorrhoeae SK-92-679]
 gi|240127306|ref|ZP_04739967.1| co-chaperonin GroES [Neisseria gonorrhoeae SK-93-1035]
 gi|254492822|ref|ZP_05105993.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|260441425|ref|ZP_05795241.1| co-chaperonin GroES [Neisseria gonorrhoeae DGI2]
 gi|268593894|ref|ZP_06128061.1| co-chaperonin GroES [Neisseria gonorrhoeae 35/02]
 gi|268598069|ref|ZP_06132236.1| predicted protein [Neisseria gonorrhoeae MS11]
 gi|268600411|ref|ZP_06134578.1| predicted protein [Neisseria gonorrhoeae PID18]
 gi|268683161|ref|ZP_06150023.1| predicted protein [Neisseria gonorrhoeae PID332]
 gi|268685671|ref|ZP_06152533.1| predicted protein [Neisseria gonorrhoeae SK-93-1035]
 gi|2493655|sp|P77913|CH10_NEIGO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|75507270|sp|Q5F542|CH10_NEIG1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1513097|gb|AAC45326.1| GroES [Neisseria gonorrhoeae]
 gi|59719290|gb|AAW90695.1| putative chaperonin 10 kDa subunit [Neisseria gonorrhoeae FA 1090]
 gi|226511862|gb|EEH61207.1| predicted protein [Neisseria gonorrhoeae 1291]
 gi|268547283|gb|EEZ42701.1| co-chaperonin GroES [Neisseria gonorrhoeae 35/02]
 gi|268582200|gb|EEZ46876.1| predicted protein [Neisseria gonorrhoeae MS11]
 gi|268584542|gb|EEZ49218.1| predicted protein [Neisseria gonorrhoeae PID18]
 gi|268623445|gb|EEZ55845.1| predicted protein [Neisseria gonorrhoeae PID332]
 gi|268625955|gb|EEZ58355.1| predicted protein [Neisseria gonorrhoeae SK-93-1035]
 gi|317165487|gb|ADV09028.1| co-chaperonin GroES [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 96

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPD--MGEVIAVGAGKIGKDGARRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KAGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|94264997|ref|ZP_01288767.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1]
 gi|94267187|ref|ZP_01290803.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1]
 gi|93452096|gb|EAT02776.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1]
 gi|93454544|gb|EAT04825.1| Chaperonin Cpn10 [delta proteobacterium MLMS-1]
          Length = 96

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+RL+ E KT  G I+IPD+  EKP+   G +  VG G  +  G+ +  E+
Sbjct: 3   IRPLNDRILVKRLEEEEKTK-GGIIIPDSAKEKPA--EGTVEAVGNGRHNDKGERMPVEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+ GTE+K+ DGEEYL+M+E D++G+V
Sbjct: 60  KVGDRVLFSKYGGTEVKI-DGEEYLIMREDDVLGVV 94


>gi|268602644|ref|ZP_06136811.1| co-chaperonin GroES [Neisseria gonorrhoeae PID1]
 gi|268683363|ref|ZP_06150225.1| co-chaperonin GroES [Neisseria gonorrhoeae SK-92-679]
 gi|291044787|ref|ZP_06570496.1| predicted protein [Neisseria gonorrhoeae DGI2]
 gi|268586775|gb|EEZ51451.1| co-chaperonin GroES [Neisseria gonorrhoeae PID1]
 gi|268623647|gb|EEZ56047.1| co-chaperonin GroES [Neisseria gonorrhoeae SK-92-679]
 gi|291011681|gb|EFE03677.1| predicted protein [Neisseria gonorrhoeae DGI2]
          Length = 108

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 15  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 72  KAGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 106


>gi|78186425|ref|YP_374468.1| co-chaperonin GroES [Chlorobium luteolum DSM 273]
 gi|123771112|sp|Q3B5F6|CH10_PELLD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78166327|gb|ABB23425.1| chaperonin, 10 kDa [Chlorobium luteolum DSM 273]
          Length = 95

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG M  SG+++   V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPM--YGEVVAVGAGKMSDSGQLLAMPV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VL+GK+SGTE+ + +GE+YL+M+ESDI  I+ 
Sbjct: 60  KAGDKVLYGKYSGTEVSV-EGEDYLIMRESDIFAILA 95


>gi|15604474|ref|NP_220992.1| co-chaperonin GroES [Rickettsia prowazekii str. Madrid E]
 gi|6225109|sp|Q9ZCT6|CH10_RICPR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|3861168|emb|CAA15068.1| 10 KD CHAPERONIN (groES) [Rickettsia prowazekii]
 gi|4581467|emb|CAB40142.1| co-chaperonin hsp10, GroES [Rickettsia prowazekii]
          Length = 95

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ +++E KT  G I+IPDT  EKP    GEI+ VG GV++++G++   E+
Sbjct: 3   FKPLHDRIAIKPIENEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGVLNKNGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GEKLIVMKESDVFGII 94


>gi|194100043|ref|YP_002003183.1| co-chaperonin GroES [Neisseria gonorrhoeae NCCP11945]
 gi|193935333|gb|ACF31157.1| co-chaperonin GroES [Neisseria gonorrhoeae NCCP11945]
          Length = 115

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 22  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 78

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 79  KAGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 113


>gi|94968127|ref|YP_590175.1| chaperonin Cpn10/GroES [Candidatus Koribacter versatilis Ellin345]
 gi|94550177|gb|ABF40101.1| chaperonin Cpn10/GroES [Candidatus Koribacter versatilis Ellin345]
          Length = 101

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   R+VVRR++ E +T  G I+IPD+  +KP    GE++ VG G  ++ G+    +V
Sbjct: 9   LVPLYDRIVVRRVE-EAQTTRGGIIIPDSAKDKPQ--EGEVIAVGKGKQNEKGETTPLQV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ +LFGK++GTEIK+ DGEE+L+M+E +++GI+
Sbjct: 66  KAGNRILFGKYAGTEIKI-DGEEFLIMREEEVLGIL 100


>gi|23813832|sp|Q9WWL3|CH10_METSS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|4929775|gb|AAD34148.1|AF152236_1 co-chaperonin GroES [Methylovorus sp. SS1]
          Length = 105

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   +VVV+R++++  TA+G I+IPDT SEKP    GE++  G G   Q G  +  EV
Sbjct: 3   IRPLYDKVVVKRIEAQRTTASG-IVIPDTASEKPE--QGEVIATGNGRRLQDGTQVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +KL+ GEE LV++E DI+G+V
Sbjct: 60  KVGDQVLFGKYAGQTVKLH-GEELLVLREEDILGVV 94


>gi|307726951|ref|YP_003910164.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1003]
 gi|307587476|gb|ADN60873.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1003]
          Length = 105

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RVVV+R++ +  TA+G I+IPD+ +EKP    GE++ VG G +   GK    E
Sbjct: 2   HIRPLYDRVVVKRIERQRTTASG-IVIPDSAAEKPE--QGEVIAVGDGRLLTDGKRQPLE 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           +  GD VLFGK++G  +K+N GEE LVM+E D+MG+
Sbjct: 59  LKVGDHVLFGKYAGQTVKVN-GEELLVMREEDVMGV 93


>gi|584917|sp|Q07200|CH10_BACST RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|6526960|dbj|BAA88109.1| Cpn10 [Bacillus sp. MS]
 gi|7019626|gb|AAA22751.2| GroES [Geobacillus stearothermophilus]
          Length = 94

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +++E KTA+G I++PDT  EKP    G ++ VG G +  SG+ + PEV
Sbjct: 2   LKPLGDRVVIEVIETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGKGRVLDSGERVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|241759143|ref|ZP_04757251.1| chaperonin GroS [Neisseria flavescens SK114]
 gi|241320562|gb|EER56839.1| chaperonin GroS [Neisseria flavescens SK114]
          Length = 95

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G+    +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGERRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|319786028|ref|YP_004145503.1| chaperonin Cpn10 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464540|gb|ADV26272.1| Chaperonin Cpn10 [Pseudoxanthomonas suwonensis 11-1]
          Length = 96

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++R + E K + G I+IPD+ +EKP    G+++ VG G +  +G V  P+V
Sbjct: 4   IKPLYDRVVIKRTEEE-KVSAGGIVIPDSATEKPI--KGQVIAVGEGKVLDNGSVRTPKV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GTE+KL DG EYLV++E DI  ++
Sbjct: 61  KVGDQVLFGKYAGTEVKL-DGTEYLVVKEDDIFAVL 95


>gi|121535451|ref|ZP_01667261.1| chaperonin Cpn10 [Thermosinus carboxydivorans Nor1]
 gi|121305960|gb|EAX46892.1| chaperonin Cpn10 [Thermosinus carboxydivorans Nor1]
          Length = 94

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++ L+ E KT +G IL+PDT  EKP    G+++ VG G M ++G  +  +V
Sbjct: 2   IKPLGDRVVIKALEREEKTKSG-ILLPDTAKEKPQ--EGKVIAVGTGKMLENGTRVPLDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+K+ DGEEYL++ E DI+ IV
Sbjct: 59  KEGDKVIFSKYAGTEVKI-DGEEYLILSERDILAIV 93


>gi|329118669|ref|ZP_08247371.1| chaperone GroES [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465213|gb|EGF11496.1| chaperone GroES [Neisseria bacilliformis ATCC BAA-1200]
          Length = 99

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P + +EKP    GE++ VGAG + + G+    +V
Sbjct: 7   IRPLHDRVVVKRLEAEEKTASG-IVLPGSAAEKPDM--GEVIAVGAGKVGKDGQRRPLDV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 64  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 98


>gi|20807075|ref|NP_622246.1| Co-chaperonin GroES (HSP10) [Thermoanaerobacter tengcongensis MB4]
 gi|23813778|sp|Q8R5T8|CH10_THETN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|20515565|gb|AAM23850.1| Co-chaperonin GroES (HSP10) [Thermoanaerobacter tengcongensis MB4]
          Length = 94

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVV+ +QSE +   G +++P T  EKP    GE++ VG G     GK +EPEV
Sbjct: 3   LKPLGDRVVVKVIQSE-EVTKGGVILPGTAKEKPQ--QGEVVAVGPG-QYIDGKRVEPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+KL DGEEYL+++ESDI+ I+
Sbjct: 59  KVGDRVIFSKYAGTEVKL-DGEEYLLLRESDILAII 93


>gi|255065345|ref|ZP_05317200.1| chaperonin GroS [Neisseria sicca ATCC 29256]
 gi|255050170|gb|EET45634.1| chaperonin GroS [Neisseria sicca ATCC 29256]
          Length = 95

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGNRRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|50514047|pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514048|pdb|1WE3|P Chain P, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514049|pdb|1WE3|Q Chain Q, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514050|pdb|1WE3|R Chain R, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514051|pdb|1WE3|S Chain S, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514052|pdb|1WE3|T Chain T, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514053|pdb|1WE3|U Chain U, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514068|pdb|1WF4|OO Chain o, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514069|pdb|1WF4|PP Chain p, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514070|pdb|1WF4|QQ Chain q, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514071|pdb|1WF4|RR Chain r, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514072|pdb|1WF4|SS Chain s, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514073|pdb|1WF4|TT Chain t, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
 gi|50514074|pdb|1WF4|UU Chain u, Crystal Structure Of The Chaperonin Complex
           Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS
          Length = 100

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 70/102 (68%), Gaps = 4/102 (3%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
            E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++G+
Sbjct: 2   AEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGTGRVLENGQ 58

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 59  RVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 99


>gi|89899933|ref|YP_522404.1| co-chaperonin GroES [Rhodoferax ferrireducens T118]
 gi|123091421|sp|Q21ZD0|CH10_RHOFD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|89344670|gb|ABD68873.1| chaperonin Cpn10 [Rhodoferax ferrireducens T118]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R+++E KTA+G I+IPD+ +EKP    GE++ VG G  +  G++    V
Sbjct: 3   LRPLHDRVIVKRVENETKTASG-IVIPDSAAEKPD--QGEVLAVGPGKKNDKGEISPMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+  G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVA-GDELLVMKEDDLFAVV 94


>gi|283853896|ref|ZP_06371109.1| chaperonin Cpn10 [Desulfovibrio sp. FW1012B]
 gi|283570719|gb|EFC18766.1| chaperonin Cpn10 [Desulfovibrio sp. FW1012B]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+ E +   G I+IPD+  EKP    GE++  G G +   GK ++  V
Sbjct: 3   LKPLGDRVLVKRLEQE-EVTKGGIIIPDSAKEKPM--KGEVIAAGPGKIGDDGKHVQMHV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD+VLF K++GTEIK+ D +++LVM+E DI+ I+
Sbjct: 60  EKGDLVLFNKYAGTEIKV-DEDDFLVMREDDILAII 94


>gi|253698886|ref|YP_003020075.1| chaperonin Cpn10 [Geobacter sp. M21]
 gi|259585883|sp|C6DY42|CH10_GEOSM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|251773736|gb|ACT16317.1| chaperonin Cpn10 [Geobacter sp. M21]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V+R++    TA G + IP+T  EKP    GE++ VG G     GKV   ++
Sbjct: 3   LRPLQDRIIVKRVEEATMTA-GGLYIPETAKEKPQ--QGEVVAVGNGKRGDDGKVYPIDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G+E+KL +GE++L+M+E DI+G+V
Sbjct: 60  KVGDKVLFGKYAGSEVKL-EGEDFLIMREDDILGVV 94


>gi|167587511|ref|ZP_02379899.1| chaperonin Cpn10 [Burkholderia ubonensis Bu]
          Length = 105

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G +   ++
Sbjct: 3   IRPLYDRVIVKRIEMQRTTASG-IVIPDSAAEKPE--QGEVVAVGSGRLLQDGTLRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+N GEE LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKVN-GEELLVMREEDVMGVL 94


>gi|91068950|gb|ABE04672.1| 10 kD chaperonin [Rickettsia bellii RML369-C]
          Length = 99

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDT  EKP    GE++ VG GV ++ G+V
Sbjct: 2   EVKMSFKPLYDRIAIKPIEHEEKT-KGGIIIPDTAKEKPM--QGEVVAVGKGVRNEKGEV 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEIK+  GE+ +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIKVK-GEDLIVMKESDVFGII 98


>gi|261365721|ref|ZP_05978604.1| chaperonin GroS [Neisseria mucosa ATCC 25996]
 gi|319639467|ref|ZP_07994216.1| chaperonin [Neisseria mucosa C102]
 gi|288565743|gb|EFC87303.1| chaperonin GroS [Neisseria mucosa ATCC 25996]
 gi|317399233|gb|EFV79905.1| chaperonin [Neisseria mucosa C102]
          Length = 95

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|121609522|ref|YP_997329.1| co-chaperonin GroES [Verminephrobacter eiseniae EF01-2]
 gi|166198422|sp|A1WL04|CH10_VEREI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|121554162|gb|ABM58311.1| chaperonin Cpn10 [Verminephrobacter eiseniae EF01-2]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++SE  TA+G I+IPD  +EKP    GE++ VG G  +  G++I   V
Sbjct: 3   LRPLHDRVIVKRIESETTTASG-IVIPDNAAEKPD--QGEVLAVGPGKKNDKGELIALNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K++  +E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVH-RDELLVMKEDDLFAVV 94


>gi|261381304|ref|ZP_05985877.1| chaperonin GroS [Neisseria subflava NJ9703]
 gi|284795790|gb|EFC51137.1| chaperonin GroS [Neisseria subflava NJ9703]
          Length = 95

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVVAVGAGKIGKDGARRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|298370058|ref|ZP_06981374.1| chaperonin GroS [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281518|gb|EFI23007.1| chaperonin GroS [Neisseria sp. oral taxon 014 str. F0314]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 18  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGNRRPLDV 74

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 75  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 109


>gi|162319773|ref|YP_379608.2| co-chaperonin GroES [Chlorobium chlorochromatii CaD3]
          Length = 94

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG +  +G+ I  +V
Sbjct: 3   LKPLADRVIVKPAAAEEKT-KGGLYIPDTGKEKPQ--YGEVVAVGAGKIADNGQAIAMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  KAGDKVLYGKYSGTEVSV-EGEDYLIMRESDIFAIL 94


>gi|325207369|gb|ADZ02821.1| chaperonin GroS [Neisseria meningitidis NZ-05/33]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGAHRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|116747571|ref|YP_844258.1| chaperonin Cpn10 [Syntrophobacter fumaroxidans MPOB]
 gi|116696635|gb|ABK15823.1| chaperonin Cpn10 [Syntrophobacter fumaroxidans MPOB]
          Length = 96

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+R + E KTA G I+IPDT  EKP    GE++ VG G + + G     +V
Sbjct: 3   LRPLNDRVVVKRTEEEEKTA-GGIIIPDTAKEKPI--QGEVVAVGNGKVMEDGSRRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++GT+IK+  GEE L+M+E DI+ I+
Sbjct: 60  KAGDKVLFGKYAGTDIKVG-GEELLIMREDDILAII 94


>gi|269128453|ref|YP_003301823.1| chaperonin Cpn10 [Thermomonospora curvata DSM 43183]
 gi|268313411|gb|ACY99785.1| chaperonin Cpn10 [Thermomonospora curvata DSM 43183]
          Length = 102

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (62%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  L+P   R+VV+ L++E  TA+G ++IPDT  EKP    G ++ VG G +D  
Sbjct: 1   MTTATKVVLKPLEDRIVVQPLEAETTTASG-LVIPDTAKEKPQ--EGTVLAVGPGRVDDK 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G  +  +V  GD+VL+ K+ GTE+K N+ EEYLV+   D++ IV
Sbjct: 58  GNRVPLDVKVGDVVLYSKYGGTEVKYNN-EEYLVLSARDVLAIV 100


>gi|189499744|ref|YP_001959214.1| co-chaperonin GroES [Chlorobium phaeobacteroides BS1]
 gi|226701736|sp|B3ENV6|CH10_CHLPB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189495185|gb|ACE03733.1| chaperonin Cpn10 [Chlorobium phaeobacteroides BS1]
          Length = 95

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG +  SG+++E +V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPQ--YGEVVAVGAGKVADSGQLLEMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  AVGNKVLYGKYSGTEVAV-EGEDYLIMRESDIFAIL 94


>gi|121635632|ref|YP_975877.1| co-chaperonin GroES [Neisseria meningitidis FAM18]
 gi|120867338|emb|CAM11109.1| chaperonin 10 Kd subunit [Neisseria meningitidis FAM18]
          Length = 108

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 15  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 72  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 106


>gi|78044510|ref|YP_359660.1| chaperonin, 10 kDa [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996625|gb|ABB15524.1| chaperonin, 10 kDa [Carboxydothermus hydrogenoformans Z-2901]
          Length = 94

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RV+V+ L +E  T +G I+IPDT  EKP    GE+  VG+G + ++G+ +  EV
Sbjct: 2   FRPLHDRVLVKPLPTEEVTKSG-IVIPDTAKEKPQ--QGEVKAVGSGRILENGERVPMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V + K++GTE+K+ DGEEYL+++ESDI+GI+
Sbjct: 59  KVGDRVFYSKYAGTEVKI-DGEEYLILRESDILGIL 93


>gi|294671021|ref|ZP_06735877.1| hypothetical protein NEIELOOT_02728 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307508|gb|EFE48751.1| hypothetical protein NEIELOOT_02728 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGNRRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|218767452|ref|YP_002341964.1| co-chaperonin GroES [Neisseria meningitidis Z2491]
 gi|240013225|ref|ZP_04720138.1| co-chaperonin GroES [Neisseria gonorrhoeae DGI18]
 gi|240015671|ref|ZP_04722211.1| co-chaperonin GroES [Neisseria gonorrhoeae FA6140]
 gi|240079807|ref|ZP_04724350.1| co-chaperonin GroES [Neisseria gonorrhoeae FA19]
 gi|240120296|ref|ZP_04733258.1| co-chaperonin GroES [Neisseria gonorrhoeae PID24-1]
 gi|254804201|ref|YP_003082422.1| 10 kDa chaperonin [Neisseria meningitidis alpha14]
 gi|261401497|ref|ZP_05987622.1| chaperonin GroS [Neisseria lactamica ATCC 23970]
 gi|268595951|ref|ZP_06130118.1| chaperonin [Neisseria gonorrhoeae FA19]
 gi|293397875|ref|ZP_06642081.1| chaperonin GroS [Neisseria gonorrhoeae F62]
 gi|304388538|ref|ZP_07370640.1| chaperone GroES [Neisseria meningitidis ATCC 13091]
 gi|23813818|sp|Q9JWA3|CH10_NEIMA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|121051460|emb|CAM07753.1| chaperonin 10 Kd subunit [Neisseria meningitidis Z2491]
 gi|254667743|emb|CBA03652.1| 10 kDa chaperonin [Neisseria meningitidis alpha14]
 gi|254670856|emb|CBA07319.1| 10 kDa chaperonin [Neisseria meningitidis alpha153]
 gi|254672967|emb|CBA07417.1| 10 kDa chaperonin [Neisseria meningitidis alpha275]
 gi|261393303|emb|CAX50935.1| 10 kDa chaperonin (protein Cpn10; GroES protein) [Neisseria
           meningitidis 8013]
 gi|268549739|gb|EEZ44758.1| chaperonin [Neisseria gonorrhoeae FA19]
 gi|269208474|gb|EEZ74929.1| chaperonin GroS [Neisseria lactamica ATCC 23970]
 gi|291611821|gb|EFF40890.1| chaperonin GroS [Neisseria gonorrhoeae F62]
 gi|304337475|gb|EFM03642.1| chaperone GroES [Neisseria meningitidis ATCC 13091]
 gi|308390072|gb|ADO32392.1| co-chaperonin GroES [Neisseria meningitidis alpha710]
 gi|309378902|emb|CBX22489.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|319409714|emb|CBY90019.1| 10 kDa chaperonin (protein Cpn10; GroES protein) [Neisseria
           meningitidis WUE 2594]
 gi|325129437|gb|EGC52268.1| chaperonin GroS [Neisseria meningitidis OX99.30304]
 gi|325131383|gb|EGC54092.1| chaperonin GroS [Neisseria meningitidis M6190]
 gi|325135566|gb|EGC58184.1| chaperonin GroS [Neisseria meningitidis M0579]
 gi|325137464|gb|EGC60050.1| chaperonin GroS [Neisseria meningitidis ES14902]
 gi|325139292|gb|EGC61833.1| chaperonin GroS [Neisseria meningitidis CU385]
 gi|325143683|gb|EGC66002.1| chaperonin GroS [Neisseria meningitidis M01-240013]
 gi|325199064|gb|ADY94520.1| chaperonin GroS [Neisseria meningitidis G2136]
 gi|325201388|gb|ADY96842.1| chaperonin GroS [Neisseria meningitidis M01-240149]
 gi|325204925|gb|ADZ00379.1| chaperonin GroS [Neisseria meningitidis M01-240355]
 gi|325206878|gb|ADZ02331.1| chaperonin GroS [Neisseria meningitidis M04-240196]
          Length = 96

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|225076143|ref|ZP_03719342.1| hypothetical protein NEIFLAOT_01175 [Neisseria flavescens
           NRL30031/H210]
 gi|224952486|gb|EEG33695.1| hypothetical protein NEIFLAOT_01175 [Neisseria flavescens
           NRL30031/H210]
          Length = 108

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 15  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 72  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 106


>gi|78171469|gb|ABB28565.1| Co-chaperonin GroES (HSP10)-like protein [Chlorobium
           chlorochromatii CaD3]
          Length = 119

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG +  +G+ I  +V
Sbjct: 28  LKPLADRVIVKPAAAEEKT-KGGLYIPDTGKEKPQ--YGEVVAVGAGKIADNGQAIAMQV 84

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 85  KAGDKVLYGKYSGTEVSV-EGEDYLIMRESDIFAIL 119


>gi|15677803|ref|NP_274967.1| co-chaperonin GroES [Neisseria meningitidis MC58]
 gi|23813819|sp|Q9JXM4|CH10_NEIMB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|7227235|gb|AAF42302.1| chaperonin, 10 kDa [Neisseria meningitidis MC58]
 gi|316985608|gb|EFV64555.1| 10 kDa chaperonin [Neisseria meningitidis H44/76]
 gi|325201021|gb|ADY96476.1| chaperonin GroS [Neisseria meningitidis H44/76]
          Length = 96

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGSRRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|307824592|ref|ZP_07654816.1| Chaperonin Cpn10 [Methylobacter tundripaludum SV96]
 gi|307734246|gb|EFO05099.1| Chaperonin Cpn10 [Methylobacter tundripaludum SV96]
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ E  TA G IL+P + +EKPS   G I+ VG+G    +G V   EV
Sbjct: 3   IRPLHDRVIVKRVEEETTTA-GGILLPGSAAEKPS--QGVILAVGSGKQLDNGTVRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG E+K+ DG++ +VM+E DIMG++
Sbjct: 60  KVGDKVLFGKYSGNEVKV-DGDDLIVMREEDIMGVL 94


>gi|320107400|ref|YP_004182990.1| Chaperonin Cpn10 [Terriglobus saanensis SP1PR4]
 gi|319925921|gb|ADV82996.1| Chaperonin Cpn10 [Terriglobus saanensis SP1PR4]
          Length = 98

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           +   P   R++VRR++ E +T  G I+IPD+  EKP    G ++ VG G  +  GK    
Sbjct: 3   STFTPLHDRILVRRVE-EGETLRGGIIIPDSAKEKPQ--QGTVISVGKGKSNDEGKTFPL 59

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +V  GD +LFGK+SGTEIKL DGEE L+M+E +++GI+
Sbjct: 60  DVKAGDTILFGKYSGTEIKL-DGEELLIMREEEVLGIL 96


>gi|157827008|ref|YP_001496072.1| co-chaperonin GroES [Rickettsia bellii OSU 85-389]
 gi|162286708|ref|YP_537761.2| co-chaperonin GroES [Rickettsia bellii RML369-C]
 gi|126215686|sp|Q1RIZ2|CH10_RICBR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198404|sp|A8GW08|CH10_RICB8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157802312|gb|ABV79035.1| co-chaperonin GroES [Rickettsia bellii OSU 85-389]
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDT  EKP    GE++ VG GV ++ G+V   E+
Sbjct: 3   FKPLYDRIAIKPIEHEEKT-KGGIIIPDTAKEKPM--QGEVVAVGKGVRNEKGEVHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEIK+  GE+ +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIKVK-GEDLIVMKESDVFGII 94


>gi|161869235|ref|YP_001598402.1| co-chaperonin GroES [Neisseria meningitidis 053442]
 gi|261379181|ref|ZP_05983754.1| chaperonin GroS [Neisseria cinerea ATCC 14685]
 gi|313669203|ref|YP_004049487.1| chaperonin 10 Kd subunit [Neisseria lactamica ST-640]
 gi|189044111|sp|A9M0Q5|CH10_NEIM0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|161594788|gb|ABX72448.1| chaperonin 10 Kd subunit [Neisseria meningitidis 053442]
 gi|269144334|gb|EEZ70752.1| chaperonin GroS [Neisseria cinerea ATCC 14685]
 gi|313006665|emb|CBN88131.1| chaperonin 10 Kd subunit [Neisseria lactamica 020-06]
 gi|325127404|gb|EGC50336.1| chaperonin GroS [Neisseria meningitidis N1568]
 gi|325133432|gb|EGC56096.1| chaperonin GroS [Neisseria meningitidis M13399]
 gi|325141292|gb|EGC63784.1| chaperonin GroS [Neisseria meningitidis 961-5945]
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 60  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 94


>gi|297250428|ref|ZP_06864273.2| chaperonin GroS [Neisseria polysaccharea ATCC 43768]
 gi|296838964|gb|EFH22902.1| chaperonin GroS [Neisseria polysaccharea ATCC 43768]
          Length = 108

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KTA+G I++P   +EKP    GE++ VGAG + + G     +V
Sbjct: 15  IRPLHDRVVVKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGAGKIGKDGARRPLDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++FGK+SG  +K  DGEE LVM+E DI GIV
Sbjct: 72  KVGDKIIFGKYSGQTVK-ADGEELLVMREEDIFGIV 106


>gi|170690651|ref|ZP_02881817.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
 gi|170143900|gb|EDT12062.1| chaperonin Cpn10 [Burkholderia graminis C4D1M]
          Length = 105

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+R++ +  TA+G I+IPD+ +EKP    GE++ VG G + + G    PE+
Sbjct: 3   IRPLYDRVVVKRIERQRTTASG-IVIPDSAAEKPE--QGEVIAVGDGRLLKDGTRRPPEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D++G++
Sbjct: 60  KVGDHVLFGKYAGQTVKI-DGEELLVMREEDVIGVL 94


>gi|12006267|gb|AAG44814.1|AF274871_1 GROES [Geobacillus stearothermophilus]
          Length = 94

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +++E KTA+G I++PDT  EKP    G+++ VG G +  +G+ + PEV
Sbjct: 2   LKPLGDRVVIEIVETEEKTASG-IVLPDTAKEKPQ--EGKVVAVGKGRVLDNGQRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|87121880|ref|ZP_01077766.1| putative Chaperonin [Marinomonas sp. MED121]
 gi|86162909|gb|EAQ64188.1| putative Chaperonin [Marinomonas sp. MED121]
          Length = 95

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E  TA+G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   IRPLHDRVVVRRKEEETTTASG-IVLPGSATEKPT--QGEIVAVGTGRIQANGEVAALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G+ V+FG++SG  IKL DGEE L+M+E +I GI+
Sbjct: 60  SVGETVVFGQYSGQTIKL-DGEELLIMKEEEIYGII 94


>gi|300313722|ref|YP_003777814.1| chaperonin GroES [Herbaspirillum seropedicae SmR1]
 gi|300076507|gb|ADJ65906.1| chaperonin GroES protein [Herbaspirillum seropedicae SmR1]
          Length = 105

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 66/95 (69%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++ + +TA+G I+IPD+ +EKP    GE++ VG G +   G +   ++
Sbjct: 3   LRPLYDRVIVKRIEHQRQTASG-IVIPDSATEKPE--QGEVLAVGNGRVLPDGSLRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD+VLFGK++G  +KL DGEE LV++E DI G+
Sbjct: 60  KVGDLVLFGKYAGQTVKL-DGEELLVLREEDIFGV 93


>gi|262372000|ref|ZP_06065279.1| chaperonin GroS [Acinetobacter junii SH205]
 gi|262312025|gb|EEY93110.1| chaperonin GroS [Acinetobacter junii SH205]
          Length = 110

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G +  +G V   +V
Sbjct: 18  IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITDNG-VRALDV 73

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K+N GEE L+M+ESDI+ ++
Sbjct: 74  KVGDKVLFGTYAGTTVKVN-GEELLIMKESDILAVL 108


>gi|295680527|ref|YP_003609101.1| chaperonin Cpn10 [Burkholderia sp. CCGE1002]
 gi|295440422|gb|ADG19590.1| Chaperonin Cpn10 [Burkholderia sp. CCGE1002]
          Length = 105

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++++  TA+G I+IPD+ +EKP    GE++ VG+G + Q G +   ++
Sbjct: 3   IRPLYDRVIVKRIETQRTTASG-IVIPDSAAEKPE--QGEVVAVGSGRLLQDGTLRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGE+ LVM+E D+MG++
Sbjct: 60  KVGDHVLFGKYAGQTVKV-DGEDLLVMREEDVMGVL 94


>gi|88799070|ref|ZP_01114651.1| Co-chaperonin GroES (HSP10) [Reinekea sp. MED297]
 gi|88778297|gb|EAR09491.1| Co-chaperonin GroES (HSP10) [Reinekea sp. MED297]
          Length = 95

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E +T  G IL+P +  EKPS   GE++ VG G +  +G+V   +V
Sbjct: 3   IRPLHDRVVVRRKEEE-ETTAGGILLPGSAKEKPS--QGEVLAVGNGRVLDNGEVRAVDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG++SG+ +K+ DGEE L+M ESDI G++
Sbjct: 60  KVGDTVVFGQYSGSTVKV-DGEELLIMSESDIFGVI 94


>gi|330819914|ref|YP_004348776.1| Chaperonin Cpn10 [Burkholderia gladioli BSR3]
 gi|327371909|gb|AEA63264.1| Chaperonin Cpn10 [Burkholderia gladioli BSR3]
          Length = 105

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGSGRLLQDGTQRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDQVIFGKYSGQTVKV-DGEELLVMREEDVMGVL 94


>gi|27262444|gb|AAN87503.1| 10 kDa chaperonin GroES [Heliobacillus mobilis]
          Length = 116

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 65/94 (69%), Gaps = 4/94 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E KTA+G I++PDT  EKP    GE++ VG G +  +G+    EV
Sbjct: 25  IKPLADRIVVKPIEAEAKTASG-IIVPDTAKEKPQ--QGEVVAVGIGRLLDNGERAAMEV 81

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
           + GD +++ K+SGTEIKL DG EYL++ E DI+ 
Sbjct: 82  AVGDKIIYSKYSGTEIKL-DGSEYLILNERDILA 114


>gi|228989432|ref|ZP_04149420.1| 10 kDa chaperonin [Bacillus pseudomycoides DSM 12442]
 gi|229015660|ref|ZP_04172646.1| 10 kDa chaperonin [Bacillus cereus AH1273]
 gi|228745632|gb|EEL95648.1| 10 kDa chaperonin [Bacillus cereus AH1273]
 gi|228770303|gb|EEM18879.1| 10 kDa chaperonin [Bacillus pseudomycoides DSM 12442]
          Length = 94

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ I+
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAII 93


>gi|76810985|ref|YP_334800.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b]
 gi|126438432|ref|YP_001060402.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668]
 gi|126453076|ref|YP_001067662.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a]
 gi|134280125|ref|ZP_01766836.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|167721203|ref|ZP_02404439.1| chaperonin, 10 kDa [Burkholderia pseudomallei DM98]
 gi|167825796|ref|ZP_02457267.1| chaperonin, 10 kDa [Burkholderia pseudomallei 9]
 gi|167847280|ref|ZP_02472788.1| chaperonin, 10 kDa [Burkholderia pseudomallei B7210]
 gi|167904256|ref|ZP_02491461.1| chaperonin, 10 kDa [Burkholderia pseudomallei NCTC 13177]
 gi|226196834|ref|ZP_03792413.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|242317468|ref|ZP_04816484.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
 gi|254190901|ref|ZP_04897407.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
 gi|254199126|ref|ZP_04905541.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|254260020|ref|ZP_04951074.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
 gi|76580438|gb|ABA49913.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710b]
 gi|126217925|gb|ABN81431.1| chaperonin, 10 kDa [Burkholderia pseudomallei 668]
 gi|126226718|gb|ABN90258.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106a]
 gi|134248132|gb|EBA48215.1| chaperonin, 10 kDa [Burkholderia pseudomallei 305]
 gi|157938575|gb|EDO94245.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pasteur 52237]
 gi|169656956|gb|EDS88353.1| chaperonin, 10 kDa [Burkholderia pseudomallei S13]
 gi|225931094|gb|EEH27102.1| chaperonin, 10 kDa [Burkholderia pseudomallei Pakistan 9]
 gi|242140707|gb|EES27109.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1106b]
 gi|254218709|gb|EET08093.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1710a]
          Length = 105

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GEI+ +G G + Q G +   +
Sbjct: 2   HVRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEIVALGNGRLLQDGTLRALQ 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  GD V+FGK++G  IK+ DGE++LVM+E D++G++
Sbjct: 59  LKVGDQVIFGKYAGQSIKV-DGEDFLVMREEDVLGVL 94


>gi|260061719|ref|YP_003194799.1| co-chaperonin GroES [Robiginitalea biformata HTCC2501]
 gi|88785851|gb|EAR17020.1| co-chaperonin GroES [Robiginitalea biformata HTCC2501]
          Length = 92

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  +++E KTA+G I+IPDT  EKP    G+++ VG G  D+     +  V
Sbjct: 6   IKPLADRVLVAPMEAETKTASG-IIIPDTAKEKPQ--KGKVVAVGPGTKDE-----KMTV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+GK+SGTE+K  DG +YL+M+ESDI+ I+
Sbjct: 58  SVGDTVLYGKYSGTELKF-DGADYLMMRESDILAII 92


>gi|126642699|ref|YP_001085683.1| co-chaperonin GroES [Acinetobacter baumannii ATCC 17978]
 gi|169632652|ref|YP_001706388.1| co-chaperonin GroES [Acinetobacter baumannii SDF]
 gi|169794985|ref|YP_001712778.1| co-chaperonin GroES [Acinetobacter baumannii AYE]
 gi|213158350|ref|YP_002320401.1| chaperonin GroS [Acinetobacter baumannii AB0057]
 gi|215482535|ref|YP_002324725.1| 10 kDa chaperonin (groES protein) [Acinetobacter baumannii
           AB307-0294]
 gi|239503401|ref|ZP_04662711.1| co-chaperonin GroES [Acinetobacter baumannii AB900]
 gi|301347501|ref|ZP_07228242.1| co-chaperonin GroES [Acinetobacter baumannii AB056]
 gi|301511907|ref|ZP_07237144.1| co-chaperonin GroES [Acinetobacter baumannii AB058]
 gi|301597051|ref|ZP_07242059.1| co-chaperonin GroES [Acinetobacter baumannii AB059]
 gi|166233974|sp|A3M837|CH10_ACIBT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701711|sp|B7GY35|CH10_ACIB3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701712|sp|B7I619|CH10_ACIB5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701713|sp|B0VSP4|CH10_ACIBS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701714|sp|B0VDR5|CH10_ACIBY RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|126388583|gb|ABO13081.1| chaperone Hsp10 [Acinetobacter baumannii ATCC 17978]
 gi|169147912|emb|CAM85775.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii
           AYE]
 gi|169151444|emb|CAP00184.1| chaperone Hsp10, affects cell division [Acinetobacter baumannii]
 gi|213057510|gb|ACJ42412.1| chaperonin GroS [Acinetobacter baumannii AB0057]
 gi|213986804|gb|ACJ57103.1| 10 kDa chaperonin (groES protein) [Acinetobacter baumannii
           AB307-0294]
          Length = 96

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G +  +G V   +V
Sbjct: 4   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITDNG-VRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K+N GEE L+M+ESDI+ ++
Sbjct: 60  KVGDKVLFGTYAGTTVKVN-GEELLIMKESDILAVL 94


>gi|161521789|ref|YP_001585216.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616]
 gi|189352049|ref|YP_001947676.1| chaperonin GroES [Burkholderia multivorans ATCC 17616]
 gi|221210584|ref|ZP_03583564.1| chaperonin, 10 kDa [Burkholderia multivorans CGD1]
 gi|160345839|gb|ABX18924.1| chaperonin Cpn10 [Burkholderia multivorans ATCC 17616]
 gi|189336071|dbj|BAG45140.1| chaperonin GroES [Burkholderia multivorans ATCC 17616]
 gi|221169540|gb|EEE02007.1| chaperonin, 10 kDa [Burkholderia multivorans CGD1]
          Length = 105

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGSGRLLQDGSQRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGEELLVMREEDVMGVL 94


>gi|229159421|ref|ZP_04287440.1| 10 kDa chaperonin [Bacillus cereus R309803]
 gi|228624051|gb|EEK80858.1| 10 kDa chaperonin [Bacillus cereus R309803]
          Length = 94

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++  G G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVVAAGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G+EYL+++ESDI+ ++
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGKEYLILRESDILAVI 93


>gi|262375895|ref|ZP_06069126.1| chaperonin GroS [Acinetobacter lwoffii SH145]
 gi|262308989|gb|EEY90121.1| chaperonin GroS [Acinetobacter lwoffii SH145]
          Length = 100

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  + GEI+ VG G +  +G V   +V
Sbjct: 8   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--AQGEIIAVGNGQITDNG-VRALDV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K+N GEE L+M+ESDI+ ++
Sbjct: 64  KVGDKVLFGTYAGTTVKVN-GEELLIMKESDILAVL 98


>gi|268317471|ref|YP_003291190.1| chaperonin Cpn10 [Rhodothermus marinus DSM 4252]
 gi|23813835|sp|Q9XCB0|CH10_RHOMR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|5020009|gb|AAD37975.1|AF145252_1 heat shock protein GroES [Rhodothermus marinus]
 gi|262335005|gb|ACY48802.1| chaperonin Cpn10 [Rhodothermus marinus DSM 4252]
          Length = 100

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 5/100 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++    E KT +G + IPDT  EKP    G ++ VG G + ++G  IE  V
Sbjct: 6   IKPLSDRVVIKPEPPEEKTESG-LYIPDTAKEKPQ--RGTVIAVGPGRV-ENGTKIEMSV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEK 108
            +GD VL+GK++GTEI + DGEEYL+M+E+DI+GI+ EEK
Sbjct: 62  KEGDKVLYGKYAGTEITI-DGEEYLIMRETDILGIIEEEK 100


>gi|138893898|ref|YP_001124351.1| co-chaperonin GroES [Geobacillus thermodenitrificans NG80-2]
 gi|196251099|ref|ZP_03149779.1| chaperonin Cpn10 [Geobacillus sp. G11MC16]
 gi|166198373|sp|A4IJV2|CH10_GEOTN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|134265411|gb|ABO65606.1| GroES [Geobacillus thermodenitrificans NG80-2]
 gi|196209393|gb|EDY04172.1| chaperonin Cpn10 [Geobacillus sp. G11MC16]
          Length = 94

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  +++E KTA+G I++PDT  EKP    G ++ VG G +  +G+ + PEV
Sbjct: 2   LKPLGDRIVIEVVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGTGRVLDNGQRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|221197488|ref|ZP_03570535.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2M]
 gi|221204161|ref|ZP_03577179.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2]
 gi|221176327|gb|EEE08756.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2]
 gi|221184042|gb|EEE16442.1| chaperonin, 10 kDa [Burkholderia multivorans CGD2M]
          Length = 105

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGSGRLLQDGSQRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDQVLFGKYAGQTVKV-DGEELLVMREEDVMGVL 94


>gi|254299249|ref|ZP_04966699.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
 gi|157809127|gb|EDO86297.1| chaperonin, 10 kDa [Burkholderia pseudomallei 406e]
          Length = 105

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GEI+ +G G + Q G +   +
Sbjct: 2   HVRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEIVALGNGRLLQDGTLRALQ 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  GD V+FGK++G  IK+ DGE++LVM+E D++G++
Sbjct: 59  LEVGDQVIFGKYAGQSIKV-DGEDFLVMREEDVLGVL 94


>gi|1682950|dbj|BAA09493.1| GroES [Bacillus sp.]
          Length = 88

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 67/90 (74%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           RVV+ ++++E KTA+G I++PDT  EKP    G ++ VG G + ++G+ I  EV +GD V
Sbjct: 2   RVVIEQVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGTGRVTENGEKIALEVKEGDSV 58

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +F K++GTE+K  DG+EYL+++ESDI+ I+
Sbjct: 59  IFSKYAGTEVKY-DGKEYLILRESDILAII 87


>gi|184159229|ref|YP_001847568.1| co-chaperonin GroES [Acinetobacter baumannii ACICU]
 gi|260549236|ref|ZP_05823456.1| predicted protein [Acinetobacter sp. RUH2624]
 gi|260556467|ref|ZP_05828685.1| chaperonin GroS [Acinetobacter baumannii ATCC 19606]
 gi|332855904|ref|ZP_08436078.1| chaperonin GroS [Acinetobacter baumannii 6013150]
 gi|332867133|ref|ZP_08437412.1| chaperonin GroS [Acinetobacter baumannii 6013113]
 gi|332876175|ref|ZP_08443954.1| chaperonin GroS [Acinetobacter baumannii 6014059]
 gi|183210823|gb|ACC58221.1| Co-chaperonin GroES (HSP10) [Acinetobacter baumannii ACICU]
 gi|260407642|gb|EEX01115.1| predicted protein [Acinetobacter sp. RUH2624]
 gi|260409726|gb|EEX03026.1| chaperonin GroS [Acinetobacter baumannii ATCC 19606]
 gi|322509143|gb|ADX04597.1| groES [Acinetobacter baumannii 1656-2]
 gi|323519171|gb|ADX93552.1| co-chaperonin GroES [Acinetobacter baumannii TCDC-AB0715]
 gi|332727223|gb|EGJ58672.1| chaperonin GroS [Acinetobacter baumannii 6013150]
 gi|332734206|gb|EGJ65336.1| chaperonin GroS [Acinetobacter baumannii 6013113]
 gi|332735609|gb|EGJ66657.1| chaperonin GroS [Acinetobacter baumannii 6014059]
          Length = 100

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G +  +G V   +V
Sbjct: 8   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITDNG-VRALDV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K+N GEE L+M+ESDI+ ++
Sbjct: 64  KVGDKVLFGTYAGTTVKVN-GEELLIMKESDILAVL 98


>gi|21715983|dbj|BAC02898.1| co-chaperonin [Thermus sp. TB1]
          Length = 101

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 70/104 (67%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M  E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG+G +  +
Sbjct: 1   MAAEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGSGRILDN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  EV +G IV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 58  GQKVPLEVKEGGIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 100


>gi|154251067|ref|YP_001411891.1| co-chaperonin GroES [Parvibaculum lavamentivorans DS-1]
 gi|171769561|sp|A7HQQ1|CH10_PARL1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|154155017|gb|ABS62234.1| chaperonin Cpn10 [Parvibaculum lavamentivorans DS-1]
          Length = 105

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            RP   RVVVRR++ E KTA G I+IPD+  EKPS   GE++ VG G     GK++  +V
Sbjct: 3   FRPLHDRVVVRRVEEESKTA-GGIIIPDSAQEKPS--QGEVVAVGPGARGDDGKLVALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGKWSGTE+K+ DGEE L+M+ESDIMG++
Sbjct: 60  KVGDRVIFGKWSGTEVKI-DGEELLIMKESDIMGVL 94


>gi|297562955|ref|YP_003681929.1| chaperonin Cpn10 [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847403|gb|ADH69423.1| Chaperonin Cpn10 [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 103

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 5/105 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  L+P   RVVVR L++E  TA+G ++IPDT  EKP    GE++ VG G  D  
Sbjct: 1   MSTATKTVLKPLEDRVVVRTLEAEQTTASG-LVIPDTAKEKPQ--EGEVLAVGPGRWDDE 57

Query: 61  GKVIEP-EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+   P +V  GD+VL+ K+ GTE+K  DGEEYLV+   D++ +V
Sbjct: 58  GENRIPLDVKVGDVVLYSKYGGTEVKY-DGEEYLVLSARDLLAVV 101


>gi|295694914|ref|YP_003588152.1| Chaperonin Cpn10 [Bacillus tusciae DSM 2912]
 gi|295410516|gb|ADG05008.1| Chaperonin Cpn10 [Bacillus tusciae DSM 2912]
          Length = 94

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 69/96 (71%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+R ++ E KTA+G I++PDT  EKP    GE++ VG G M++ G+ +E EV
Sbjct: 2   IKPLADRVVIRPVEKEEKTASG-IVLPDTAKEKPQ--EGEVVAVGPGRMEE-GRRVEMEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++GTE+K  DG EYL+++ESDI+ ++
Sbjct: 58  KVGDRVIYSKYAGTEVKY-DGVEYLILRESDILAVL 92


>gi|238025262|ref|YP_002909494.1| Chaperonin Cpn10 [Burkholderia glumae BGR1]
 gi|237879927|gb|ACR32259.1| Chaperonin Cpn10 [Burkholderia glumae BGR1]
          Length = 106

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGSGRLLQDGSQRALQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDQVIFGKYAGQAVKV-DGEELLVMREEDVMGVL 94


>gi|254250803|ref|ZP_04944122.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
 gi|124879937|gb|EAY67293.1| Chaperonin Cpn10 [Burkholderia cenocepacia PC184]
          Length = 105

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +E+P    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAERPE--QGEVIAVGSGRLLQDGSQRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+N GEE LVM+E D+MG++
Sbjct: 60  QVGDQVLFGKYAGQTVKVN-GEELLVMREEDVMGVL 94


>gi|91783187|ref|YP_558393.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400]
 gi|91783217|ref|YP_558423.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400]
 gi|91687141|gb|ABE30341.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400]
 gi|91687171|gb|ABE30371.1| 10 kDa chaperonin (Cpn10), groES [Burkholderia xenovorans LB400]
          Length = 105

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGDGRLLQDGTRRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDHVLFGKYSGQTVKV-DGEELLVMREEDVMGVL 94


>gi|34499470|ref|NP_903685.1| co-chaperonin GroES [Chromobacterium violaceum ATCC 12472]
 gi|34105322|gb|AAQ61677.1| chaperonin 10kD subunit [Chromobacterium violaceum ATCC 12472]
          Length = 95

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G I++P   +EKP    G+++ VG G + ++G+    E+
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASG-IVLPGAAAEKPDM--GQVLAVGNGKILENGERRPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K+ DGEE LVM+E D+MGIV
Sbjct: 60  KVGDKVIFGKYSGQTVKV-DGEEVLVMREEDVMGIV 94


>gi|165933548|ref|YP_001650337.1| co-chaperonin GroES [Rickettsia rickettsii str. Iowa]
 gi|165908635|gb|ABY72931.1| 10 kDa chaperonin GROES [Rickettsia rickettsii str. Iowa]
          Length = 99

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDTV EKP    GE++ VG G+ +Q G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEVVAVGNGIRNQKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 98


>gi|30260442|ref|NP_842819.1| co-chaperonin GroES [Bacillus anthracis str. Ames]
 gi|42779369|ref|NP_976616.1| co-chaperonin GroES [Bacillus cereus ATCC 10987]
 gi|47525525|ref|YP_016874.1| co-chaperonin GroES [Bacillus anthracis str. 'Ames Ancestor']
 gi|47567506|ref|ZP_00238218.1| chaperonin, 10 kDa [Bacillus cereus G9241]
 gi|49183284|ref|YP_026536.1| co-chaperonin GroES [Bacillus anthracis str. Sterne]
 gi|49477873|ref|YP_034592.1| co-chaperonin GroES [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52144976|ref|YP_081853.1| co-chaperonin GroES [Bacillus cereus E33L]
 gi|65317694|ref|ZP_00390653.1| COG0234: Co-chaperonin GroES (HSP10) [Bacillus anthracis str.
           A2012]
 gi|162382787|ref|YP_893163.2| co-chaperonin GroES [Bacillus thuringiensis str. Al Hakam]
 gi|165873318|ref|ZP_02217922.1| chaperonin, 10 kDa [Bacillus anthracis str. A0488]
 gi|167634211|ref|ZP_02392533.1| chaperonin, 10 kDa [Bacillus anthracis str. A0442]
 gi|167640101|ref|ZP_02398368.1| chaperonin, 10 kDa [Bacillus anthracis str. A0193]
 gi|170687725|ref|ZP_02878940.1| chaperonin, 10 kDa [Bacillus anthracis str. A0465]
 gi|177655763|ref|ZP_02937038.1| chaperonin, 10 kDa [Bacillus anthracis str. A0174]
 gi|190567404|ref|ZP_03020318.1| chaperonin, 10 kDa [Bacillus anthracis Tsiankovskii-I]
 gi|196036853|ref|ZP_03104241.1| chaperonin, 10 kDa [Bacillus cereus W]
 gi|196041131|ref|ZP_03108427.1| chaperonin, 10 kDa [Bacillus cereus NVH0597-99]
 gi|196046150|ref|ZP_03113377.1| chaperonin, 10 kDa [Bacillus cereus 03BB108]
 gi|217957825|ref|YP_002336369.1| co-chaperonin GroES [Bacillus cereus AH187]
 gi|218901458|ref|YP_002449292.1| chaperonin, 10 kDa [Bacillus cereus AH820]
 gi|222094024|ref|YP_002528076.1| co-chaperonin groes [Bacillus cereus Q1]
 gi|225862307|ref|YP_002747685.1| chaperonin, 10 kDa [Bacillus cereus 03BB102]
 gi|227812933|ref|YP_002812942.1| chaperonin, 10 kDa [Bacillus anthracis str. CDC 684]
 gi|228912996|ref|ZP_04076638.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228925512|ref|ZP_04088604.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228931758|ref|ZP_04094658.1| 10 kDa chaperonin [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228944064|ref|ZP_04106446.1| 10 kDa chaperonin [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228983513|ref|ZP_04143721.1| 10 kDa chaperonin [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|229028107|ref|ZP_04184253.1| 10 kDa chaperonin [Bacillus cereus AH1271]
 gi|229074303|ref|ZP_04207346.1| 10 kDa chaperonin [Bacillus cereus Rock4-18]
 gi|229089389|ref|ZP_04220662.1| 10 kDa chaperonin [Bacillus cereus Rock3-42]
 gi|229094968|ref|ZP_04225968.1| 10 kDa chaperonin [Bacillus cereus Rock3-29]
 gi|229101070|ref|ZP_04231841.1| 10 kDa chaperonin [Bacillus cereus Rock3-28]
 gi|229113922|ref|ZP_04243352.1| 10 kDa chaperonin [Bacillus cereus Rock1-3]
 gi|229119922|ref|ZP_04249179.1| 10 kDa chaperonin [Bacillus cereus 95/8201]
 gi|229154025|ref|ZP_04282153.1| 10 kDa chaperonin [Bacillus cereus ATCC 4342]
 gi|229171101|ref|ZP_04298698.1| 10 kDa chaperonin [Bacillus cereus MM3]
 gi|229182653|ref|ZP_04309897.1| 10 kDa chaperonin [Bacillus cereus BGSC 6E1]
 gi|229194643|ref|ZP_04321439.1| 10 kDa chaperonin [Bacillus cereus m1293]
 gi|229601777|ref|YP_002864891.1| chaperonin, 10 kDa [Bacillus anthracis str. A0248]
 gi|254686662|ref|ZP_05150520.1| co-chaperonin GroES [Bacillus anthracis str. CNEVA-9066]
 gi|254724729|ref|ZP_05186512.1| co-chaperonin GroES [Bacillus anthracis str. A1055]
 gi|254735441|ref|ZP_05193149.1| co-chaperonin GroES [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744185|ref|ZP_05201867.1| co-chaperonin GroES [Bacillus anthracis str. Kruger B]
 gi|254756029|ref|ZP_05208060.1| co-chaperonin GroES [Bacillus anthracis str. Vollum]
 gi|254761679|ref|ZP_05213697.1| co-chaperonin GroES [Bacillus anthracis str. Australia 94]
 gi|300119512|ref|ZP_07057064.1| co-chaperonin GroES [Bacillus cereus SJ1]
 gi|301051988|ref|YP_003790199.1| co-chaperonin GroES [Bacillus anthracis CI]
 gi|60389519|sp|Q63GV8|CH10_BACCZ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|60389648|sp|Q6HPC8|CH10_BACHK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|60389689|sp|Q73ES0|CH10_BACC1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|60389755|sp|Q81VE2|CH10_BACAN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701722|sp|B7JM59|CH10_BACC0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701725|sp|B7HS04|CH10_BACC7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813823|sp|C3PAV0|CH10_BACAA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813824|sp|C3L506|CH10_BACAC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813825|sp|C1EUB0|CH10_BACC3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813826|sp|B9J1H1|CH10_BACCQ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|30253763|gb|AAP24305.1| chaperonin, 10 kDa [Bacillus anthracis str. Ames]
 gi|42735285|gb|AAS39224.1| chaperonin, 10 kDa [Bacillus cereus ATCC 10987]
 gi|47500673|gb|AAT29349.1| chaperonin, 10 kDa [Bacillus anthracis str. 'Ames Ancestor']
 gi|47555908|gb|EAL14247.1| chaperonin, 10 kDa [Bacillus cereus G9241]
 gi|49177211|gb|AAT52587.1| chaperonin, 10 kDa [Bacillus anthracis str. Sterne]
 gi|49329429|gb|AAT60075.1| 10 kDa chaperonin (Protein Cpn10) (heat shock protein) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978445|gb|AAU19995.1| 10 kDa chaperonin (Protein Cpn10) (heat shock protein) [Bacillus
           cereus E33L]
 gi|164710938|gb|EDR16511.1| chaperonin, 10 kDa [Bacillus anthracis str. A0488]
 gi|167511912|gb|EDR87291.1| chaperonin, 10 kDa [Bacillus anthracis str. A0193]
 gi|167530525|gb|EDR93240.1| chaperonin, 10 kDa [Bacillus anthracis str. A0442]
 gi|170668252|gb|EDT19000.1| chaperonin, 10 kDa [Bacillus anthracis str. A0465]
 gi|172079992|gb|EDT65094.1| chaperonin, 10 kDa [Bacillus anthracis str. A0174]
 gi|190561531|gb|EDV15502.1| chaperonin, 10 kDa [Bacillus anthracis Tsiankovskii-I]
 gi|195990535|gb|EDX54515.1| chaperonin, 10 kDa [Bacillus cereus W]
 gi|196022895|gb|EDX61575.1| chaperonin, 10 kDa [Bacillus cereus 03BB108]
 gi|196028066|gb|EDX66677.1| chaperonin, 10 kDa [Bacillus cereus NVH0597-99]
 gi|217063305|gb|ACJ77555.1| chaperonin, 10 kDa [Bacillus cereus AH187]
 gi|218535454|gb|ACK87852.1| chaperonin, 10 kDa [Bacillus cereus AH820]
 gi|221238074|gb|ACM10784.1| 10 kDa chaperonin (Protein Cpn10) (heat shock protein) [Bacillus
           cereus Q1]
 gi|225789757|gb|ACO29974.1| chaperonin, 10 kDa [Bacillus cereus 03BB102]
 gi|227004886|gb|ACP14629.1| chaperonin, 10 kDa [Bacillus anthracis str. CDC 684]
 gi|228588836|gb|EEK46858.1| 10 kDa chaperonin [Bacillus cereus m1293]
 gi|228600822|gb|EEK58398.1| 10 kDa chaperonin [Bacillus cereus BGSC 6E1]
 gi|228612374|gb|EEK69599.1| 10 kDa chaperonin [Bacillus cereus MM3]
 gi|228629445|gb|EEK86144.1| 10 kDa chaperonin [Bacillus cereus ATCC 4342]
 gi|228663536|gb|EEL19119.1| 10 kDa chaperonin [Bacillus cereus 95/8201]
 gi|228669539|gb|EEL24951.1| 10 kDa chaperonin [Bacillus cereus Rock1-3]
 gi|228682347|gb|EEL36453.1| 10 kDa chaperonin [Bacillus cereus Rock3-28]
 gi|228688456|gb|EEL42334.1| 10 kDa chaperonin [Bacillus cereus Rock3-29]
 gi|228693938|gb|EEL47628.1| 10 kDa chaperonin [Bacillus cereus Rock3-42]
 gi|228708825|gb|EEL60955.1| 10 kDa chaperonin [Bacillus cereus Rock4-18]
 gi|228733198|gb|EEL84034.1| 10 kDa chaperonin [Bacillus cereus AH1271]
 gi|228776220|gb|EEM24578.1| 10 kDa chaperonin [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|228815614|gb|EEM61853.1| 10 kDa chaperonin [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228827907|gb|EEM73641.1| 10 kDa chaperonin [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228834150|gb|EEM79695.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228846650|gb|EEM91660.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|229266185|gb|ACQ47822.1| chaperonin, 10 kDa [Bacillus anthracis str. A0248]
 gi|298723102|gb|EFI63992.1| co-chaperonin GroES [Bacillus cereus SJ1]
 gi|300374157|gb|ADK03061.1| co-chaperonin GroES [Bacillus cereus biovar anthracis str. CI]
 gi|324324267|gb|ADY19527.1| co-chaperonin GroES [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 94

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|118415237|gb|ABK83656.1| 10 kDa chaperonin [Bacillus thuringiensis str. Al Hakam]
          Length = 100

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 8   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVIAVGTGRVLENGERVALEV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 65  AAGDLIIFSKYAGTEVK-YEGTDYLILRESDILAVI 99


>gi|206978307|ref|ZP_03239183.1| chaperonin, 10 kDa [Bacillus cereus H3081.97]
 gi|206743475|gb|EDZ54906.1| chaperonin, 10 kDa [Bacillus cereus H3081.97]
          Length = 94

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIEFVQAEEKTASG-IVLPDTAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|170735221|ref|YP_001774335.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3]
 gi|197295479|ref|YP_002154020.1| 10 kDa chaperonin 3 [Burkholderia cenocepacia J2315]
 gi|169821259|gb|ACA95840.1| chaperonin Cpn10 [Burkholderia cenocepacia MC0-3]
 gi|195944958|emb|CAR57570.1| 10 kDa chaperonin 3 [Burkholderia cenocepacia J2315]
          Length = 105

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +E+P    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAERPE--QGEVIAVGSGRLLQDGSQRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+N GEE LVM+E D+MG++
Sbjct: 60  QVGDQVLFGKYAGQTVKVN-GEELLVMREEDVMGVL 94


>gi|29894054|gb|AAP07346.1| 10 kDa chaperonin GROES [Bacillus cereus ATCC 14579]
          Length = 96

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 4   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRVLENGERVALEV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 61  AAGDLIIFSKYAGTEVK-YEGTDYLILRESDILAVI 95


>gi|134293864|ref|YP_001117600.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4]
 gi|134137021|gb|ABO58135.1| chaperonin Cpn10 [Burkholderia vietnamiensis G4]
          Length = 105

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEVIAVGSGRLLQDGSQQPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K+ DGEE LVM+E D+MG++
Sbjct: 60  KVGDRVLFGKYAGQTVKV-DGEELLVMREEDVMGVL 94


>gi|161511213|ref|NP_830145.2| co-chaperonin GroES [Bacillus cereus ATCC 14579]
 gi|206972696|ref|ZP_03233635.1| chaperonin, 10 kDa [Bacillus cereus AH1134]
 gi|218235725|ref|YP_002365093.1| co-chaperonin GroES [Bacillus cereus B4264]
 gi|218895377|ref|YP_002443788.1| chaperonin, 10 kDa [Bacillus cereus G9842]
 gi|228898995|ref|ZP_04063271.1| 10 kDa chaperonin [Bacillus thuringiensis IBL 4222]
 gi|228919190|ref|ZP_04082563.1| 10 kDa chaperonin [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228937547|ref|ZP_04100188.1| 10 kDa chaperonin [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228950787|ref|ZP_04112915.1| 10 kDa chaperonin [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228956689|ref|ZP_04118478.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228969271|ref|ZP_04130145.1| 10 kDa chaperonin [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970434|ref|ZP_04131088.1| 10 kDa chaperonin [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228977004|ref|ZP_04137411.1| 10 kDa chaperonin [Bacillus thuringiensis Bt407]
 gi|229068010|ref|ZP_04201321.1| 10 kDa chaperonin [Bacillus cereus F65185]
 gi|229083545|ref|ZP_04215878.1| 10 kDa chaperonin [Bacillus cereus Rock3-44]
 gi|229107928|ref|ZP_04237558.1| 10 kDa chaperonin [Bacillus cereus Rock1-15]
 gi|229125760|ref|ZP_04254788.1| 10 kDa chaperonin [Bacillus cereus BDRD-Cer4]
 gi|229143051|ref|ZP_04271487.1| 10 kDa chaperonin [Bacillus cereus BDRD-ST24]
 gi|229148653|ref|ZP_04276906.1| 10 kDa chaperonin [Bacillus cereus m1550]
 gi|229176847|ref|ZP_04304246.1| 10 kDa chaperonin [Bacillus cereus 172560W]
 gi|229188525|ref|ZP_04315567.1| 10 kDa chaperonin [Bacillus cereus ATCC 10876]
 gi|296501077|ref|YP_003662777.1| co-chaperonin GroES [Bacillus thuringiensis BMB171]
 gi|60389750|sp|Q814B1|CH10_BACCR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701723|sp|B7IUS9|CH10_BACC2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701724|sp|B7H4Q6|CH10_BACC4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|206732382|gb|EDZ49565.1| chaperonin, 10 kDa [Bacillus cereus AH1134]
 gi|218163682|gb|ACK63674.1| chaperonin, 10 kDa [Bacillus cereus B4264]
 gi|218541301|gb|ACK93695.1| chaperonin, 10 kDa [Bacillus cereus G9842]
 gi|228594953|gb|EEK52730.1| 10 kDa chaperonin [Bacillus cereus ATCC 10876]
 gi|228606629|gb|EEK64051.1| 10 kDa chaperonin [Bacillus cereus 172560W]
 gi|228634814|gb|EEK91390.1| 10 kDa chaperonin [Bacillus cereus m1550]
 gi|228640416|gb|EEK96810.1| 10 kDa chaperonin [Bacillus cereus BDRD-ST24]
 gi|228657700|gb|EEL13510.1| 10 kDa chaperonin [Bacillus cereus BDRD-Cer4]
 gi|228675526|gb|EEL30740.1| 10 kDa chaperonin [Bacillus cereus Rock1-15]
 gi|228699762|gb|EEL52414.1| 10 kDa chaperonin [Bacillus cereus Rock3-44]
 gi|228715113|gb|EEL66977.1| 10 kDa chaperonin [Bacillus cereus F65185]
 gi|228782714|gb|EEM30885.1| 10 kDa chaperonin [Bacillus thuringiensis Bt407]
 gi|228789283|gb|EEM37208.1| 10 kDa chaperonin [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228790418|gb|EEM38145.1| 10 kDa chaperonin [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228802990|gb|EEM49819.1| 10 kDa chaperonin [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228808874|gb|EEM55365.1| 10 kDa chaperonin [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228822121|gb|EEM68108.1| 10 kDa chaperonin [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228840468|gb|EEM85736.1| 10 kDa chaperonin [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228860650|gb|EEN05034.1| 10 kDa chaperonin [Bacillus thuringiensis IBL 4222]
 gi|296322129|gb|ADH05057.1| co-chaperonin GroES [Bacillus thuringiensis BMB171]
 gi|326938037|gb|AEA13933.1| co-chaperonin GroES [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 94

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|116749775|ref|YP_846462.1| chaperonin Cpn10 [Syntrophobacter fumaroxidans MPOB]
 gi|116698839|gb|ABK18027.1| chaperonin Cpn10 [Syntrophobacter fumaroxidans MPOB]
          Length = 95

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+++RR++ E +T  G I+IPDT  EKP    G+++  G G + ++G +    V
Sbjct: 3   VRPLHDRIIIRRVEEE-ETTAGGIIIPDTAREKPQ--QGKVVAAGKGRLLENGILTPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+VLF K+SGT++K+ +GE+ L+M E D++GI+
Sbjct: 60  KEGDLVLFNKYSGTDVKI-EGEDLLIMHEDDVLGII 94


>gi|257453399|ref|ZP_05618694.1| chaperonin GroS [Enhydrobacter aerosaccus SK60]
 gi|257449151|gb|EEV24099.1| chaperonin GroS [Enhydrobacter aerosaccus SK60]
          Length = 96

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E KTA G +L+  +  EKPS   GE++ VG G + ++G V   +V
Sbjct: 3   IRPLHDRIVVRRSEEEQKTA-GGLLLAGSAQEKPS--QGEVIAVGNGQIRENGDVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG+++G+ +K+ DGEE L+M+ESD++G++
Sbjct: 60  KVGDKVLFGQYAGSTVKV-DGEELLIMKESDVLGVI 94


>gi|89100204|ref|ZP_01173071.1| co-chaperonin GroES [Bacillus sp. NRRL B-14911]
 gi|89085054|gb|EAR64188.1| co-chaperonin GroES [Bacillus sp. NRRL B-14911]
          Length = 94

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+++  +++E KTA+G I++PDT  EKP    G+++ VG G   ++G+ +E EV
Sbjct: 2   LKPLGDRIIIELVETEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRALENGERVELEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G+EYL+++E+DI+ IV
Sbjct: 59  AAGDTIIFSKYAGTEVKY-EGKEYLILRENDILAIV 93


>gi|90437020|gb|ABD93985.1| 10 kDa heat shock protein [Rickettsia helvetica]
          Length = 95

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDT  EKP    GEI+ VG G+ ++ G+V   E+
Sbjct: 3   FKPLHDRIAIKPIEHEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGIRNKKGEVHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GEKLIVMKESDVFGII 94


>gi|157826030|ref|YP_001493750.1| co-chaperonin GroES [Rickettsia akari str. Hartford]
 gi|166198403|sp|A8GPB7|CH10_RICAH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157799988|gb|ABV75242.1| co-chaperonin GroES [Rickettsia akari str. Hartford]
          Length = 95

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDT  EKP    GEI+ VG GV ++ G++   E+
Sbjct: 3   FKPLHDRIAIKPIEHEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGVRNKKGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GEKLIVMKESDVFGII 94


>gi|184200321|ref|YP_001854528.1| 10 kDa chaperonin [Kocuria rhizophila DC2201]
 gi|183580551|dbj|BAG29022.1| 10 kDa chaperonin [Kocuria rhizophila DC2201]
          Length = 98

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G +D  G  I  +V
Sbjct: 5   IKPLEDRIVVQPLAAEQTTASG-LVIPDTAKEKPQ--EGTVLAVGPGRVDDKGNRIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V+F K+ GTE+K N GEEYLV+   D++ ++
Sbjct: 62  NEGDLVIFSKYGGTEVKYN-GEEYLVLPARDVLAVI 96


>gi|219847433|ref|YP_002461866.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485]
 gi|219541692|gb|ACL23430.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485]
          Length = 100

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +RP   RVVV+ ++ E KT TG I +PDT S E+P    G ++ VG G  D +GK+I   
Sbjct: 6   IRPLGDRVVVKPVEREEKTKTG-IFLPDTASKERPM--EGTVLAVGEGRRDDNGKLIPMS 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           V  GD V+F K+SGTE KL+D  EYL++ E DI+GIV E
Sbjct: 63  VKVGDRVIFAKYSGTEFKLDD-VEYLILSEKDILGIVQE 100


>gi|295402755|ref|ZP_06812695.1| chaperonin Cpn10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112502|ref|YP_003990818.1| chaperonin Cpn10 [Geobacillus sp. Y4.1MC1]
 gi|23813785|sp|Q8VV85|CH10_BACTR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|18250940|dbj|BAB83939.1| GroES [Geobacillus thermoglucosidasius]
 gi|294975219|gb|EFG50857.1| chaperonin Cpn10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217603|gb|ADP76207.1| Chaperonin Cpn10 [Geobacillus sp. Y4.1MC1]
          Length = 94

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+  +++E KTA+G I++PDT  EKP    G+++ VG G +  +G+ + PEV
Sbjct: 2   IKPLGDRVVIEIVETEEKTASG-IVLPDTAKEKPQ--EGKVVAVGKGRVLDNGQRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  EVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|227497243|ref|ZP_03927483.1| chaperone GroES [Actinomyces urogenitalis DSM 15434]
 gi|226833291|gb|EEH65674.1| chaperone GroES [Actinomyces urogenitalis DSM 15434]
          Length = 98

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L++E  TA+G ++IPDT  EKP    G+++ VG G +D SGK I  +V
Sbjct: 5   IKPLEDRIVVQTLEAEQTTASG-LVIPDTAKEKPQ--EGKVVAVGPGRVDDSGKRIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V++ K+ GTE+K   GE+YL++   D++ +V
Sbjct: 62  AEGDVVIYSKYGGTEVKYA-GEDYLILSARDVLAVV 96


>gi|296132295|ref|YP_003639542.1| Chaperonin Cpn10 [Thermincola sp. JR]
 gi|296030873|gb|ADG81641.1| Chaperonin Cpn10 [Thermincola potens JR]
          Length = 94

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ L +E KTA+G I++PDT  EKP    GE++ VG G   ++G+ +  EV
Sbjct: 2   IKPLGDRVVVKPLAAEEKTASG-IVLPDTAKEKPQ--QGEVIAVGTGRTLENGQKLALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++GTEIKLN+ EE+L++ E DI+ I+
Sbjct: 59  KVGDKVIYSKYAGTEIKLNN-EEHLILNERDILAIM 93


>gi|260222490|emb|CBA32105.1| 10 kDa chaperonin [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 106

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+R+  + +TA+G I+IPD+ +EKP    G+++ VG G +   G +   +V
Sbjct: 3   IRPLYDRIIVKRIDQQRQTASG-IVIPDSATEKPE--QGDVIAVGTGRLLHDGNIRPLQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +KGD VLFGK++G  +K++D +E LV++E D++GI+
Sbjct: 60  AKGDRVLFGKYAGQTVKVDD-QELLVLKEEDVLGII 94


>gi|115376731|ref|ZP_01463958.1| chaperonin GroS [Stigmatella aurantiaca DW4/3-1]
 gi|310822916|ref|YP_003955274.1| 10 kda chaperonin [Stigmatella aurantiaca DW4/3-1]
 gi|115366280|gb|EAU65288.1| chaperonin GroS [Stigmatella aurantiaca DW4/3-1]
 gi|309395988|gb|ADO73447.1| 10 kDa chaperonin [Stigmatella aurantiaca DW4/3-1]
          Length = 96

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++V+R+  E KT  G + IPDT  EKP    G+++ VG G + + GKV   ++
Sbjct: 3   IRPLQDRLIVKRVAEENKT-KGGLFIPDTAKEKPL--EGKVVAVGNGKILEDGKVRPLDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D +LF K++GTEIK+ DGEE+L+++E D++G++
Sbjct: 60  KANDTILFSKYAGTEIKI-DGEEHLILREEDVLGVI 94


>gi|229586975|ref|YP_002845476.1| co-chaperonin GroES [Rickettsia africae ESF-5]
 gi|228022025|gb|ACP53733.1| 10 kD chaperonin [Rickettsia africae ESF-5]
          Length = 99

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDTV EKP    GEI+ VG G+ ++ G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEIVAVGKGIRNEKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 98


>gi|291295474|ref|YP_003506872.1| chaperonin Cpn10 [Meiothermus ruber DSM 1279]
 gi|290470433|gb|ADD27852.1| chaperonin Cpn10 [Meiothermus ruber DSM 1279]
          Length = 98

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG+G +  +G  +  EV
Sbjct: 7   LRPLGDRVVVKRIEEEAKTK-GGIVLPDTAKEKPQ--RGKVIAVGSGRVLDNGTKVPLEV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 64  KEGDTVVFAKYGGTEIEI-DGEEYIILSERDLLAVL 98


>gi|224823822|ref|ZP_03696931.1| chaperonin Cpn10 [Lutiella nitroferrum 2002]
 gi|224604277|gb|EEG10451.1| chaperonin Cpn10 [Lutiella nitroferrum 2002]
          Length = 95

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G I++P   +EKP    GE++ VG G + ++G+    E+
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASG-IVLPGAAAEKPDM--GEVIAVGNGKILENGERRPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K+ DG+E LVM+E D+MGIV
Sbjct: 60  KVGDKVIFGKYSGQTVKV-DGDEVLVMREEDVMGIV 94


>gi|56962655|ref|YP_174381.1| co-chaperonin GroES [Bacillus clausii KSM-K16]
 gi|60389491|sp|Q5WJN5|CH10_BACSK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|56908893|dbj|BAD63420.1| chaperonin GroES [Bacillus clausii KSM-K16]
          Length = 94

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+++ ++QSE KTA+G I++PD+  EKP    G+++ VG G +  +G+ +  EV
Sbjct: 2   LKPLGDRIIIEQIQSEEKTASG-IVLPDSAKEKPQ--EGKVVAVGTGRVTDNGEKVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++GTE+K  +G EYL+++ESD++ I+
Sbjct: 59  KEGDSIIFSKYAGTEVKY-EGTEYLILRESDVLAII 93


>gi|229042153|ref|ZP_04189910.1| 10 kDa chaperonin [Bacillus cereus AH676]
 gi|228727188|gb|EEL78388.1| 10 kDa chaperonin [Bacillus cereus AH676]
          Length = 94

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  AAGDFIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|228906036|ref|ZP_04069927.1| 10 kDa chaperonin [Bacillus thuringiensis IBL 200]
 gi|228853606|gb|EEM98372.1| 10 kDa chaperonin [Bacillus thuringiensis IBL 200]
          Length = 94

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K   G +YL+++ESDI+ ++
Sbjct: 59  AAGDLIIFSKYAGTEVKYA-GTDYLILRESDILAVI 93


>gi|107023132|ref|YP_621459.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054]
 gi|116686628|ref|YP_839875.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424]
 gi|105893321|gb|ABF76486.1| chaperonin Cpn10 [Burkholderia cenocepacia AU 1054]
 gi|116652343|gb|ABK12982.1| chaperonin Cpn10 [Burkholderia cenocepacia HI2424]
          Length = 105

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R++ +  TA+G I+IPD+ +E+P    GE++ VG+G + Q G     ++
Sbjct: 3   IRPLYDRVIVKRIEQQRTTASG-IVIPDSAAERPE--QGEVIAVGSGRLLQDGSQRPLQL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  +K N GEE LVM+E D+MG++
Sbjct: 60  QVGDQVLFGKYAGQTVKAN-GEELLVMREEDVMGVL 94


>gi|120609640|ref|YP_969318.1| chaperonin Cpn10 [Acidovorax citrulli AAC00-1]
 gi|166233973|sp|A1TKQ6|CH10_ACIAC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|120588104|gb|ABM31544.1| chaperonin Cpn10 [Acidovorax citrulli AAC00-1]
          Length = 96

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R++SE  TA+G I+IPD  +EKP    G ++ VG G  +  G++    V
Sbjct: 3   LRPLHDRVIVKRIESETTTASG-IVIPDNAAEKPD--QGVVLAVGPGKKNDKGELSVLSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG  +K+N G+E LVM+E D+  +V
Sbjct: 60  KVGDRVLFGKYSGQTVKVN-GDELLVMKEDDLFAVV 94


>gi|21673364|ref|NP_661429.1| co-chaperonin GroES [Chlorobium tepidum TLS]
 gi|25089864|sp|Q8KF03|CH10_CHLTE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|21646460|gb|AAM71771.1| chaperonin, 10 kDa [Chlorobium tepidum TLS]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VG G +  +G+V+  +V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPM--YGEVVAVGPGKVSDAGQVVAMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  KAGDKVLYGKYSGTEVHV-EGEDYLIMRESDIFAIL 94


>gi|221633281|ref|YP_002522506.1| chaperonin, 10 kDa [Thermomicrobium roseum DSM 5159]
 gi|221156304|gb|ACM05431.1| chaperonin, 10 kDa [Thermomicrobium roseum DSM 5159]
          Length = 101

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ +Q E  T +G I++PDT  EKP    G+++ VG G +   GK +  EV
Sbjct: 8   IRPLGDRVVVKPIQKEEVTKSG-IVLPDTAKEKPQ--RGQVVAVGPGRLTDDGKRLPMEV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD VLF K++GTE+K++D EEYL++ E DI+ ++ E
Sbjct: 65  KVGDEVLFAKYAGTELKIDD-EEYLILSEKDILAVLSE 101


>gi|157828822|ref|YP_001495064.1| co-chaperonin GroES [Rickettsia rickettsii str. 'Sheila Smith']
 gi|166198406|sp|A8GT31|CH10_RICRS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157801303|gb|ABV76556.1| co-chaperonin GroES [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDTV EKP    GE++ VG G+ +Q G++   E+
Sbjct: 3   FKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEVVAVGNGIRNQKGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 94


>gi|293609961|ref|ZP_06692263.1| chaperonin [Acinetobacter sp. SH024]
 gi|299769026|ref|YP_003731052.1| co-chaperonin GroES [Acinetobacter sp. DR1]
 gi|292828413|gb|EFF86776.1| chaperonin [Acinetobacter sp. SH024]
 gi|298699114|gb|ADI89679.1| co-chaperonin GroES [Acinetobacter sp. DR1]
          Length = 96

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G + ++G V   +V
Sbjct: 4   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITENG-VRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K++ GEE L+M+ESDI+ ++
Sbjct: 60  KVGDKVLFGTYAGTTVKVS-GEELLIMKESDILAVL 94


>gi|15620082|gb|AAL03507.1| 10 kD chaperonin [Rickettsia conorii str. Malish 7]
          Length = 99

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDTV EKP    GEI+ VG G+ ++ G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEIVAVGNGIRNEKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 98


>gi|224370144|ref|YP_002604308.1| GroES [Desulfobacterium autotrophicum HRM2]
 gi|259585877|sp|C0QKQ4|CH10_DESAH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|223692861|gb|ACN16144.1| GroES [Desulfobacterium autotrophicum HRM2]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP + R++V R+Q   KT  G I+IPDT  EKP+   G+++  G G + + GK+I  ++
Sbjct: 3   LRPLQDRILVERVQETEKTK-GGIIIPDTAKEKPA--EGKVVASGNGRVGEDGKLIPMDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K+ GTE+K+ DG +YL+M++ D++G++
Sbjct: 60  KVGDTILFSKYGGTEVKI-DGTDYLIMRQDDVLGVI 94


>gi|228995628|ref|ZP_04155293.1| 10 kDa chaperonin [Bacillus mycoides Rock3-17]
 gi|228764124|gb|EEM13006.1| 10 kDa chaperonin [Bacillus mycoides Rock3-17]
          Length = 94

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PD   EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDAAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ I+
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAII 93


>gi|163848287|ref|YP_001636331.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl]
 gi|222526202|ref|YP_002570673.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl]
 gi|163669576|gb|ABY35942.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl]
 gi|222450081|gb|ACM54347.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl]
          Length = 100

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 63/98 (64%), Gaps = 3/98 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ ++ E KT TG I +PDT S K     G ++ VG G  D +GK+I   V
Sbjct: 6   IRPLGDRVVVKPVEREEKTKTG-IYLPDTAS-KERPMEGTVLAVGEGRRDDNGKLIPMNV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD V+F K+SGTE KL+D  EYL++ E DI+GIV E
Sbjct: 64  KVGDRVIFAKYSGTEFKLDD-VEYLILSEKDILGIVQE 100


>gi|290969295|ref|ZP_06560820.1| chaperonin GroS [Megasphaera genomosp. type_1 str. 28L]
 gi|290780801|gb|EFD93404.1| chaperonin GroS [Megasphaera genomosp. type_1 str. 28L]
          Length = 93

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++R L+ E KTA G I +PDT  EKPS   GE++  G G M   GK +  +V
Sbjct: 2   LKPLGDRVIIRVLEQEEKTA-GGIYLPDTAKEKPS--RGEVVAAGPGKMTDDGKRVALDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+K  +G +YL++ E DI+ + 
Sbjct: 59  KAGDTVIFSKYAGTEVKF-EGTDYLIVSERDILAVC 93


>gi|77920361|ref|YP_358176.1| 10 Kd chaperone GroES [Pelobacter carbinolicus DSM 2380]
 gi|123729386|sp|Q3A0V1|CH10_PELCD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|77546444|gb|ABA90006.1| 10 Kd chaperone GroES [Pelobacter carbinolicus DSM 2380]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP R R++V R++ E  TA G ++IPD+  EKP    G +  VG G + + G V+  ++
Sbjct: 3   IRPLRDRIIVERIEEETTTA-GGLIIPDSAKEKPQ--QGIVKAVGKGKVLEDGTVLPMDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G+EIK+ DG EY +M+E DI+G++
Sbjct: 60  KVGDRVLFGKYAGSEIKI-DGLEYQIMREDDILGVL 94


>gi|194335945|ref|YP_002017739.1| chaperonin Cpn10 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226704019|sp|B4SEN0|CH10_PELPB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|194308422|gb|ACF43122.1| chaperonin Cpn10 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VGAG +  +G+++E +V
Sbjct: 3   LKPLSDRVIVKPAAAEEKT-KGGLYIPDTGKEKPQ--YGEVVAVGAGKIADNGQLLEMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  KVGSKVLYGKYSGTEVSV-EGEDYLIMRESDIFAIL 94


>gi|239918139|ref|YP_002957697.1| Co-chaperonin GroES [Micrococcus luteus NCTC 2665]
 gi|281415673|ref|ZP_06247415.1| Co-chaperonin GroES [Micrococcus luteus NCTC 2665]
 gi|289706597|ref|ZP_06502947.1| chaperonin GroS [Micrococcus luteus SK58]
 gi|259585888|sp|C5CC02|CH10_MICLC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|239839346|gb|ACS31143.1| Co-chaperonin GroES [Micrococcus luteus NCTC 2665]
 gi|289556732|gb|EFD50073.1| chaperonin GroS [Micrococcus luteus SK58]
          Length = 98

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VVR L++E  TA+G ++IPDT  EKP    G+++ VG G + ++G  +  +V
Sbjct: 5   IKPLEDRIVVRPLEAEQTTASG-LVIPDTAKEKPQ--EGQVVAVGPGRVAENGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+VL+ K+ GTE+K+  GEEYLV+   D++ +V
Sbjct: 62  AEGDVVLYSKYGGTEVKVG-GEEYLVLSARDVLAVV 96


>gi|163938257|ref|YP_001643141.1| co-chaperonin GroES [Bacillus weihenstephanensis KBAB4]
 gi|229009757|ref|ZP_04166979.1| 10 kDa chaperonin [Bacillus mycoides DSM 2048]
 gi|229055097|ref|ZP_04195527.1| 10 kDa chaperonin [Bacillus cereus AH603]
 gi|229131262|ref|ZP_04260166.1| 10 kDa chaperonin [Bacillus cereus BDRD-ST196]
 gi|229165239|ref|ZP_04293029.1| 10 kDa chaperonin [Bacillus cereus AH621]
 gi|226701726|sp|A9VQG7|CH10_BACWK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|163860454|gb|ABY41513.1| chaperonin Cpn10 [Bacillus weihenstephanensis KBAB4]
 gi|228618234|gb|EEK75269.1| 10 kDa chaperonin [Bacillus cereus AH621]
 gi|228652200|gb|EEL08133.1| 10 kDa chaperonin [Bacillus cereus BDRD-ST196]
 gi|228721245|gb|EEL72771.1| 10 kDa chaperonin [Bacillus cereus AH603]
 gi|228751517|gb|EEM01321.1| 10 kDa chaperonin [Bacillus mycoides DSM 2048]
          Length = 94

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++P+T  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPETAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+++F K++GTE+K  +G +YL+++ESDI+ I+
Sbjct: 59  AAGDLIIFSKYAGTEVKY-EGTDYLILRESDILAII 93


>gi|194333513|ref|YP_002015373.1| co-chaperonin GroES [Prosthecochloris aestuarii DSM 271]
 gi|226704022|sp|B4S6H1|CH10_PROA2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|194311331|gb|ACF45726.1| chaperonin Cpn10 [Prosthecochloris aestuarii DSM 271]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GEI+ VG G + ++G+V+E +V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPQ--YGEIVAVGTGKVAENGQVLEMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G  VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  NIGQKVLYGKYSGTEVTV-EGEDYLIMRESDIFAIL 94


>gi|262278077|ref|ZP_06055862.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
 gi|262258428|gb|EEY77161.1| predicted protein [Acinetobacter calcoaceticus RUH2202]
 gi|325123169|gb|ADY82692.1| chaperonin GroES [Acinetobacter calcoaceticus PHEA-2]
          Length = 100

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G + ++G V   +V
Sbjct: 8   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITENG-VRALDV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K++ GEE L+M+ESDI+ ++
Sbjct: 64  KVGDKVLFGTYAGTTVKVS-GEELLIMKESDILAVL 98


>gi|157964775|ref|YP_001499599.1| co-chaperonin GroES [Rickettsia massiliae MTU5]
 gi|157844551|gb|ABV85052.1| 10 kDa chaperonin [Rickettsia massiliae MTU5]
          Length = 99

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDTV EKP    GEI+ VG G+ ++ G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEIVAVGDGIRNKKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 98


>gi|294497085|ref|YP_003560785.1| 10 kDa chaperonin [Bacillus megaterium QM B1551]
 gi|295702450|ref|YP_003595525.1| 10 kDa chaperonin [Bacillus megaterium DSM 319]
 gi|149776885|gb|ABR28464.1| chaperonin GroES [Bacillus megaterium]
 gi|294347022|gb|ADE67351.1| 10 kDa chaperonin [Bacillus megaterium QM B1551]
 gi|294800109|gb|ADF37175.1| 10 kDa chaperonin [Bacillus megaterium DSM 319]
          Length = 94

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+I+ VG G + +SG+ +  EV
Sbjct: 2   LKPLGDRVVIELVKSEEKTASG-IVLPDSAKEKPQ--EGKIVAVGTGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 59  AAGDRIIFSKYAGTEVK-YEGTEYLILRESDILAVI 93


>gi|83647305|ref|YP_435740.1| co-chaperonin GroES [Hahella chejuensis KCTC 2396]
 gi|123753566|sp|Q2SDF9|CH10_HAHCH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|83635348|gb|ABC31315.1| Co-chaperonin GroES (HSP10) [Hahella chejuensis KCTC 2396]
          Length = 96

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E KTA G I++P   +EKPS   GE++ VG G +  +G V    V
Sbjct: 3   IRPLHERVVVRRKEEETKTA-GGIVLPGNAAEKPS--QGEVLAVGEGRILDNGDVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+ +K+ DGEE L+M ESDI G++
Sbjct: 60  KVGDKVVFGQYAGSTVKI-DGEELLIMSESDIFGVI 94


>gi|206901343|ref|YP_002250678.1| chaperonin GroS [Dictyoglomus thermophilum H-6-12]
 gi|206740446|gb|ACI19504.1| chaperonin GroS [Dictyoglomus thermophilum H-6-12]
          Length = 96

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+ ++ E KT +G I++PDT  EKP    G+++ VG G +  +G+ +  E+
Sbjct: 3   LRPIGDRVVVKVIEQEEKTKSG-IVLPDTAKEKPQ--QGKVIAVGTGRILDNGQKVPLEI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD V+F K++GTE+K+ +GEEYL++ E DI+ ++ E
Sbjct: 60  KEGDRVIFAKYAGTEVKI-EGEEYLILSERDILAVIEE 96


>gi|167895868|ref|ZP_02483270.1| chaperonin, 10 kDa [Burkholderia pseudomallei 7894]
 gi|167920468|ref|ZP_02507559.1| chaperonin, 10 kDa [Burkholderia pseudomallei BCC215]
 gi|217420489|ref|ZP_03451994.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
 gi|217395901|gb|EEC35918.1| chaperonin, 10 kDa [Burkholderia pseudomallei 576]
          Length = 105

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GEI+ +G G + Q G +   +
Sbjct: 2   HVRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEIVALGNGRLLQDGTLRALQ 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  GD V+FG+++G  IK+ DGE++LVM+E D++G++
Sbjct: 59  LEVGDQVIFGEYAGQSIKV-DGEDFLVMREEDVLGVL 94


>gi|116623877|ref|YP_826033.1| chaperonin Cpn10 [Candidatus Solibacter usitatus Ellin6076]
 gi|116227039|gb|ABJ85748.1| chaperonin Cpn10 [Candidatus Solibacter usitatus Ellin6076]
          Length = 107

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+RL  E +   G I+IPDT  EKP  +  E+  VG G + ++G+ +  +V
Sbjct: 15  LRPLHDRVMVKRL-DEGEQVRGGIIIPDTAKEKPQQA--EVKAVGNGKLLENGERVALDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+ G EIK+ DGEEYL+++E +I+ I+
Sbjct: 72  KAGDRILFGKYGGAEIKI-DGEEYLILREDEILAIL 106


>gi|58177186|pdb|1WNR|A Chain A, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177187|pdb|1WNR|B Chain B, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177188|pdb|1WNR|C Chain C, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177189|pdb|1WNR|D Chain D, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177190|pdb|1WNR|E Chain E, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177191|pdb|1WNR|F Chain F, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
 gi|58177192|pdb|1WNR|G Chain G, Crystal Structure Of The Cpn10 From Thermus Thermophilus
           Hb8
          Length = 94

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   IKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGTGRVLENGQRVPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 59  KEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 93


>gi|242280485|ref|YP_002992614.1| chaperonin Cpn10 [Desulfovibrio salexigens DSM 2638]
 gi|242123379|gb|ACS81075.1| chaperonin Cpn10 [Desulfovibrio salexigens DSM 2638]
          Length = 95

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRRL+ E KT  G I+IPD+  EKP    GE++  G G +D +G  +   V
Sbjct: 3   LKPLADRVLVRRLEVEEKT-VGGIIIPDSAKEKPL--KGEVIAAGPGKLDDNGSRVALGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLF K++GTEI + +G ++L+M+E DI+ +V
Sbjct: 60  KEGDAVLFAKYAGTEISI-EGVDHLIMREDDILAVV 94


>gi|294788675|ref|ZP_06753917.1| chaperonin GroS [Simonsiella muelleri ATCC 29453]
 gi|294483552|gb|EFG31237.1| chaperonin GroS [Simonsiella muelleri ATCC 29453]
          Length = 95

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+RL++E KT++G IL P + +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVVKRLEAEEKTSSGIILAP-SATEKPDM--GEVIAVGAGKLGRDGNRRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DG E LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGVELLVMKEEDIFGIV 94


>gi|67004333|gb|AAY61259.1| 10 kDa chaperonin [Rickettsia felis URRWXCal2]
          Length = 99

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDT  EKP    GEI+ VG G+ ++ G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEHEEKTK-GGIIIPDTAKEKPM--QGEIVAVGNGIRNKKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+GTEI++  GE+ +VM+E+D+ GI+
Sbjct: 59  HPLELKIGDKVLYGKWAGTEIEIK-GEKLIVMKETDVFGII 98


>gi|260892085|ref|YP_003238182.1| chaperonin Cpn10 [Ammonifex degensii KC4]
 gi|260864226|gb|ACX51332.1| chaperonin Cpn10 [Ammonifex degensii KC4]
          Length = 94

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ L +E +   G I++PDT  EKP    GE++ VG G + ++G+ +  +V
Sbjct: 2   IRPLGDRVVVKPLPAE-EVTKGGIVLPDTAKEKPQ--KGEVVAVGPGRLLENGQRVPIDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++G E+K+ DGEEYL+++ESDI+G++
Sbjct: 59  KVGDKVLYSKYAGNEVKI-DGEEYLILRESDILGVL 93


>gi|239948349|ref|ZP_04700102.1| chaperonin GroS [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239922625|gb|EER22649.1| chaperonin GroS [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 99

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 67/101 (66%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E K   +P   R+ ++ ++ E KT  G I+IPDT  EKP    GEI+ VG G+ ++ G++
Sbjct: 2   EVKMSFKPLHDRIAIKPIEHEEKT-KGGIIIPDTAKEKPM--QGEIVAVGNGIRNKKGEI 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              E+  GD VL+GKW+G+EI++  GE+ +VM+ESD+ GI+
Sbjct: 59  HPLELKVGDKVLYGKWAGSEIEIK-GEKLIVMKESDVFGII 98


>gi|229542561|ref|ZP_04431621.1| chaperonin Cpn10 [Bacillus coagulans 36D1]
 gi|229326981|gb|EEN92656.1| chaperonin Cpn10 [Bacillus coagulans 36D1]
          Length = 94

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PDT  EKP    G+++ VG+G    +G+ +  +V
Sbjct: 2   LKPLGDRVVIELVESEEKTASG-IVLPDTAKEKPQ--EGKVVAVGSGRTLDNGERVAIDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  DG+EYL+++ESDI+ +V
Sbjct: 59  AVGDRIIFSKYAGTEVKY-DGKEYLILRESDILAVV 93


>gi|20378123|gb|AAM20895.1|AF373777_1 putative chaperonin protein [Cyanothece sp. PCC 8801]
          Length = 103

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GEI+ VG G  +  G   EPEV
Sbjct: 11  VKPLGDRVFVKVSASEEKTA-GGILLPDTAKEKPQI--GEIVTVGPGKRNDDGSRSEPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  GE+Y+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GEDYVLLSEKDILAIV 102


>gi|226952455|ref|ZP_03822919.1| Co-chaperonin GroES (HSP10) [Acinetobacter sp. ATCC 27244]
 gi|294649741|ref|ZP_06727147.1| chaperone GroES [Acinetobacter haemolyticus ATCC 19194]
 gi|226836777|gb|EEH69160.1| Co-chaperonin GroES (HSP10) [Acinetobacter sp. ATCC 27244]
 gi|292824372|gb|EFF83169.1| chaperone GroES [Acinetobacter haemolyticus ATCC 19194]
          Length = 100

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G IL+P + +EKP  S GE++ VG G +  +G V   +V
Sbjct: 8   IRPLHDRVVIRRVEEETKTA-GGILLPGSAAEKP--SQGEVIAVGNGQITDNG-VRALDV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT +K++ GEE L+M+ESDI+ ++
Sbjct: 64  KVGDKVLFGTYAGTTVKVS-GEELLIMKESDILAVL 98


>gi|72162998|ref|YP_290655.1| 10 kD chaperone [Thermobifida fusca YX]
 gi|71916730|gb|AAZ56632.1| 10 kD chaperone [Thermobifida fusca YX]
          Length = 103

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 67/105 (63%), Gaps = 5/105 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  L+P   RVVV+ L++E  TA+G ++IPDT  EKP    G+++ VG G  D  
Sbjct: 1   MSTATKIVLKPLEDRVVVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVLAVGPGRWDDE 57

Query: 61  G-KVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G K I  +V +GDIVL+ K+ GTE+K  DGEEYLV+   D++ +V
Sbjct: 58  GSKRIPLDVKEGDIVLYSKYGGTEVKY-DGEEYLVLSARDLLAVV 101


>gi|297565068|ref|YP_003684040.1| chaperonin Cpn10 [Meiothermus silvanus DSM 9946]
 gi|296849517|gb|ADH62532.1| Chaperonin Cpn10 [Meiothermus silvanus DSM 9946]
          Length = 98

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG+G    +G  +  EV
Sbjct: 7   LKPLGDRVVVKRIEEEAKTK-GGIVLPDTAKEKPQ--KGKVVAVGSGRTLDNGTKVPLEV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 64  KEGDTVVFAKYGGTEIEI-DGEEYIILSERDLLAVI 98


>gi|225176007|ref|ZP_03729999.1| chaperonin Cpn10 [Dethiobacter alkaliphilus AHT 1]
 gi|225168595|gb|EEG77397.1| chaperonin Cpn10 [Dethiobacter alkaliphilus AHT 1]
          Length = 95

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 67/94 (71%), Gaps = 4/94 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++ +++E KTA+G +++P+   EKP    GE++  G G + ++G  +E +V
Sbjct: 3   IKPLADRVVIKVMEAEEKTASG-LVLPEKAKEKPQ--EGEVVAAGGGRILENGTRVEMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
             GD VLF K++GTEIK+ DGEEYL+M++ DI+G
Sbjct: 60  KVGDRVLFSKYAGTEIKV-DGEEYLIMRQDDILG 92


>gi|162022124|ref|YP_246424.2| co-chaperonin GroES [Rickettsia felis URRWXCal2]
 gi|126215687|sp|Q4UMF3|CH10_RICFE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
          Length = 95

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDT  EKP    GEI+ VG G+ ++ G++   E+
Sbjct: 3   FKPLHDRIAIKPIEHEEKTK-GGIIIPDTAKEKPM--QGEIVAVGNGIRNKKGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+E+D+ GI+
Sbjct: 60  KIGDKVLYGKWAGTEIEIK-GEKLIVMKETDVFGII 94


>gi|254448451|ref|ZP_05061912.1| chaperonin GroS [gamma proteobacterium HTCC5015]
 gi|198262064|gb|EDY86348.1| chaperonin GroS [gamma proteobacterium HTCC5015]
          Length = 95

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+R + E K+A G I+IPD+ +EKP+   GE++ VG G   ++G+     V
Sbjct: 3   IRPLYDRVVVKRQEEESKSA-GGIIIPDSAAEKPA--QGEVVAVGEGKPLENGETRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SGT++K+ DG++ L+M+E DI  IV
Sbjct: 60  KVGDKVLFGKYSGTDVKV-DGDDLLIMREDDIQAIV 94


>gi|1945118|dbj|BAA19726.1| groES [Bacillus subtilis]
          Length = 108

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 70/98 (71%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           + L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+I+  G+G + +SG+ +  
Sbjct: 14  SLLKPLGDRVVIELVESEEKTASG-IVLPDSAKEKPQ--EGKIVAAGSGRVLESGERVAL 70

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           EV +GD ++F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 71  EVKEGDRIIFSKYAGTEVK-YEGTEYLILRESDILAVI 107


>gi|163840513|ref|YP_001624918.1| 10 kDa chaperonin GroES [Renibacterium salmoninarum ATCC 33209]
 gi|189044116|sp|A9WN15|CH10_RENSM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|162953989|gb|ABY23504.1| 10 kDa chaperonin GroES [Renibacterium salmoninarum ATCC 33209]
          Length = 98

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 66/98 (67%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VVR+L +E  TA+G ++IPD+  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVVRQLDAEQTTASG-LVIPDSAKEKPQ--EGEVVAVGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD+VL+ K+ GTE+K   GEE LV+   D++ IVV+
Sbjct: 62  AVGDVVLYSKYGGTEVKTG-GEELLVLSARDVLAIVVK 98


>gi|34581406|ref|ZP_00142886.1| 10 kD chaperonin [Rickettsia sibirica 246]
 gi|161723842|ref|NP_360606.2| co-chaperonin GroES [Rickettsia conorii str. Malish 7]
 gi|20137859|sp|Q92H03|CH10_RICCN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|28262791|gb|EAA26295.1| 10 kD chaperonin [Rickettsia sibirica 246]
          Length = 95

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDTV EKP    GEI+ VG G+ ++ G++   E+
Sbjct: 3   FKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEIVAVGNGIRNEKGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 94


>gi|1122941|gb|AAA83440.1| GroES-like chaperonin [Thermus aquaticus]
          Length = 102

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M  E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++
Sbjct: 1   MAAEVKTVIKPLGDRVVVKRIEEEPKT-KGGIVLPDTAKEKPQ--KGKVIAVGTGRVLEN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  EV +GDIV+F K+ GTEI++     Y+++ E D++ ++
Sbjct: 58  GQRVPLEVKEGDIVVFAKYGGTEIEIAPRRTYVILSERDLLAVL 101


>gi|46445665|ref|YP_007030.1| chaperonin groES [Candidatus Protochlamydia amoebophila UWE25]
 gi|46399306|emb|CAF22755.1| probable chaperonin groES [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 115

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   RVVV+R ++   T+ G IL+PD+  EKP    G ++  G G M +SG++  
Sbjct: 21  KTKIKPLGDRVVVQRAKA--ATSKGGILLPDSAQEKPR--EGHVIAAGPGKMSESGQLEP 76

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             V  GD +LFG ++GTE+K ND E+YL++ E+DI+GI+
Sbjct: 77  ISVKVGDRILFGAYAGTEVKDND-EDYLILSENDILGIL 114


>gi|317127104|ref|YP_004093386.1| chaperonin Cpn10 [Bacillus cellulosilyticus DSM 2522]
 gi|315472052|gb|ADU28655.1| Chaperonin Cpn10 [Bacillus cellulosilyticus DSM 2522]
          Length = 94

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  ++ E KTA+G I++PD+  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRIVIELVEQEEKTASG-IVLPDSAKEKPQ--EGKVVAVGTGRVTENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD ++F K++GTE+K  +G+EYL+++ESD++ ++
Sbjct: 59  SEGDAIIFSKYAGTEVKY-EGKEYLILRESDVLAVI 93


>gi|238651081|ref|YP_002916939.1| co-chaperonin GroES [Rickettsia peacockii str. Rustic]
 gi|259585891|sp|C4K2U0|CH10_RICPU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|238625179|gb|ACR47885.1| co-chaperonin GroES [Rickettsia peacockii str. Rustic]
          Length = 95

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDTV EKP    GEI+ VG G+ ++ G++   E+
Sbjct: 3   FKPLHDRIAIKPIEQEEKTK-GGIIIPDTVKEKPM--QGEIVAVGNGIRNKKGEIHPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  G + +VM+ESD+ GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GTKLIVMKESDVFGII 94


>gi|312897882|ref|ZP_07757297.1| chaperonin GroS [Megasphaera micronuciformis F0359]
 gi|310621081|gb|EFQ04626.1| chaperonin GroS [Megasphaera micronuciformis F0359]
          Length = 93

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+R L+ E KTA+G I +PDT  EKPS   GE++ VG G +  +G     EV
Sbjct: 2   IKPLGDRVVIRVLEQEEKTASG-IFLPDTAKEKPS--QGEVIAVGTGKLQDNGTRTPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD ++F K++GTE+K  DG +YL++ E DI+  +
Sbjct: 59  SVGDKIIFSKYAGTEVKY-DGVDYLIVSERDILATI 93


>gi|167042801|gb|ABZ07519.1| putative chaperonin 10 Kd subunit [uncultured marine microorganism
           HF4000_ANIW137I15]
          Length = 94

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++VR L+ + K   G I+IPDT  EKP    GEI+ VG+G + + G     EV
Sbjct: 2   VRPLQDRILVRPLEEDEKK-QGGIIIPDTAKEKPQ--EGEIVAVGSGRILKDGGKQALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            KGD VLF K++GTE+K+  GEE L+M+E D++ ++V
Sbjct: 59  KKGDRVLFAKYAGTEVKMG-GEELLIMREDDVLAVLV 94


>gi|237755990|ref|ZP_04584575.1| chaperonin GroS [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691853|gb|EEP60876.1| chaperonin GroS [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 98

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV++R++ E+      I+IPDT  EKP    GE++ VG G + ++G V+  +V
Sbjct: 4   LKPLYDRVVIKRVEEEVSKTPAGIIIPDTAKEKPQI--GEVIAVGEGRVLENGNVVPLKV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V F K++G E+K+ DGEE ++++E DI+ I+
Sbjct: 62  KVGDKVYFSKYAGNEVKV-DGEELIILREDDILAII 96


>gi|188996528|ref|YP_001930779.1| chaperonin Cpn10 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931595|gb|ACD66225.1| chaperonin Cpn10 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 98

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV++R++ E+      I+IPDT  EKP    GE++ VG G + ++G V+  +V
Sbjct: 4   LKPLYDRVVIKRVEEEVAKTPAGIIIPDTAKEKPQI--GEVVAVGEGRVLENGNVVPLKV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V F K++G E+K+ DGEE ++++E DI+ I+
Sbjct: 62  KVGDKVYFSKYAGNEVKV-DGEELIILREDDILAII 96


>gi|152974095|ref|YP_001373612.1| co-chaperonin GroES [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|189044092|sp|A7GKF9|CH10_BACCN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|152022847|gb|ABS20617.1| chaperonin Cpn10 [Bacillus cytotoxicus NVH 391-98]
          Length = 94

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +Q+E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRVVIELVQAEEKTASG-IVLPDTAKEKPQ--EGKVIAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  AAGDRIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|218247639|ref|YP_002373010.1| co-chaperonin GroES [Cyanothece sp. PCC 8801]
 gi|257061026|ref|YP_003138914.1| co-chaperonin GroES [Cyanothece sp. PCC 8802]
 gi|226693509|sp|Q8L373|CH10_CYAP8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|218168117|gb|ACK66854.1| chaperonin Cpn10 [Cyanothece sp. PCC 8801]
 gi|256591192|gb|ACV02079.1| chaperonin Cpn10 [Cyanothece sp. PCC 8802]
          Length = 103

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GEI+ VG G  +  G   EPEV
Sbjct: 11  VKPLGDRVFVKVSASEEKTA-GGILLPDTAKEKPQI--GEIVTVGPGKRNDDGSRSEPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  GE+Y+++ E DI+ +V
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GEDYVLLSEKDILAVV 102


>gi|331699108|ref|YP_004335347.1| 10 kDa chaperonin [Pseudonocardia dioxanivorans CB1190]
 gi|326953797|gb|AEA27494.1| 10 kDa chaperonin [Pseudonocardia dioxanivorans CB1190]
          Length = 96

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G I+IPDT  EKP    G+++ VG G +D +G  +  +V
Sbjct: 4   IKPLEDKIVVQASEAETTTASG-IVIPDTAKEKPQ--EGKVLAVGPGRIDDNGNRVPLDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+V++ K+ GTE+K N GEEYL++   D++ +V
Sbjct: 61  AVGDVVIYSKYGGTEVKYN-GEEYLILSARDVLAVV 95


>gi|85857895|ref|YP_460097.1| co-chaperonin [Syntrophus aciditrophicus SB]
 gi|85720986|gb|ABC75929.1| co-chaperonin [Syntrophus aciditrophicus SB]
          Length = 96

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 62/94 (65%), Gaps = 4/94 (4%)

Query: 11  PTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSK 70
           P   RV+V R ++  KTA G I+IPDT  EKP    G+++  G G  D  G  I   V +
Sbjct: 5   PLHDRVLVLRTENTEKTA-GGIIIPDTAKEKPQ--EGKVIAAGPGKRDDKGNRIPLNVRE 61

Query: 71  GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GD +LFG+++GTE+K+ DG E+L+M+E DI+G++
Sbjct: 62  GDRILFGRYAGTEVKI-DGVEHLIMREDDILGVI 94


>gi|269836875|ref|YP_003319103.1| chaperonin Cpn10 [Sphaerobacter thermophilus DSM 20745]
 gi|269786138|gb|ACZ38281.1| chaperonin Cpn10 [Sphaerobacter thermophilus DSM 20745]
          Length = 101

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 5/100 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVI 64
           K  +RP   RV+VR +Q E  T +G I++PDT  EKP    GE++ VG G  D+ G K I
Sbjct: 5   KTQVRPLGDRVLVRPVQREEVTKSG-IVLPDTAKEKPQ--RGEVLAVGPGRFDEDGEKRI 61

Query: 65  EPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             +V  GD VLF K++GTE+K++D EE L++ E DI+ +V
Sbjct: 62  PLDVKVGDHVLFAKYAGTELKIDD-EELLILSEKDILAVV 100


>gi|157691327|ref|YP_001485789.1| co-chaperonin GroES [Bacillus pumilus SAFR-032]
 gi|194015946|ref|ZP_03054561.1| chaperonin GroS [Bacillus pumilus ATCC 7061]
 gi|167008678|sp|A8FAG2|CH10_BACP2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157680085|gb|ABV61229.1| chaperone GroES [Bacillus pumilus SAFR-032]
 gi|194012301|gb|EDW21868.1| chaperonin GroS [Bacillus pumilus ATCC 7061]
          Length = 94

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++  ++SE KTA+G I++PD+  EKP    G+I+  G+G + +SG+ +  EV
Sbjct: 2   LKPLGDRVIIELVESEEKTASG-IVLPDSAKEKPQ--EGKIVAAGSGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G+EYL+++ESDI+ ++
Sbjct: 59  NTGDRIIFSKYAGTEVKY-EGKEYLILRESDILAVI 93


>gi|332971831|gb|EGK10777.1| chaperone GroES [Kingella kingae ATCC 23330]
          Length = 95

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KT++G IL P + +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVIKRLEAEEKTSSGIILAP-SATEKPDM--GEVIAVGAGKLGRDGNRRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DG E+LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGVEWLVMREEDIFGIV 94


>gi|308172430|ref|YP_003919135.1| class I heat-shock protein (chaperonin) GroES [Bacillus
           amyloliquefaciens DSM 7]
 gi|307605294|emb|CBI41665.1| class I heat-shock protein (chaperonin) GroES [Bacillus
           amyloliquefaciens DSM 7]
 gi|328552254|gb|AEB22746.1| co-chaperonin GroES [Bacillus amyloliquefaciens TA208]
 gi|328910527|gb|AEB62123.1| class I heat-shock protein (chaperonin) GroES [Bacillus
           amyloliquefaciens LL3]
          Length = 94

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+I+  G+G + +SG+ +  EV
Sbjct: 2   LKPLGDRVVIELVESEEKTASG-IVLPDSAKEKPQ--EGKIVAAGSGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 59  KEGDRIIFSKYAGTEVKY-EGAEYLILRESDILAVI 93


>gi|126665042|ref|ZP_01736025.1| Co-chaperonin GroES (HSP10) [Marinobacter sp. ELB17]
 gi|126630412|gb|EBA01027.1| Co-chaperonin GroES (HSP10) [Marinobacter sp. ELB17]
          Length = 95

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E KTA G I++P    EKPS   GE++ VG G +  +G+V    V
Sbjct: 3   IRPLHDRVVVRRKEEEEKTA-GGIVLPGNAKEKPS--QGEVIAVGNGRVQDNGEVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G  +K+ DGE+ L+M ESDI G++
Sbjct: 60  KAGDTVVFGQYAGNTVKI-DGEDLLIMSESDIYGVL 94


>gi|256830390|ref|YP_003159118.1| chaperonin Cpn10 [Desulfomicrobium baculatum DSM 4028]
 gi|256579566|gb|ACU90702.1| chaperonin Cpn10 [Desulfomicrobium baculatum DSM 4028]
          Length = 96

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R++V+RL+ E +   G I+IPD+  EKP    GE++  G G +   GK I   V
Sbjct: 3   LRPLHDRILVKRLEEE-QVTKGGIIIPDSAKEKPI--KGEVVAAGPGKVADDGKQIPMGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTEIK+ DG+E L+M+E DI+ ++
Sbjct: 60  KTGDKVIFNKYAGTEIKI-DGDELLIMREDDILAVI 94


>gi|298530168|ref|ZP_07017570.1| Chaperonin Cpn10 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509542|gb|EFI33446.1| Chaperonin Cpn10 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 95

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+RL+ E +   G I+IPDT  EKP    GE++  G G     GK I   V
Sbjct: 3   LKPLHDRVLVKRLEEE-EVTKGGIIIPDTAKEKPI--KGEVVAAGPGKTGDDGKNIPMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K++D  E+LVM+E DI+ I+
Sbjct: 60  KTGDKVLFNKYAGTEVKIDD-VEHLVMREDDILAII 94


>gi|119962669|ref|YP_948584.1| co-chaperonin GroES [Arthrobacter aurescens TC1]
 gi|166233979|sp|A1R8M2|CH10_ARTAT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|119949528|gb|ABM08439.1| chaperonin groES [Arthrobacter aurescens TC1]
          Length = 98

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VVR L++E  TA+G ++IPD+  EKP    GE++ +G G  D +G  +  +V
Sbjct: 5   IKPLEDRIVVRPLEAEQTTASG-LVIPDSAQEKPQ--EGEVVAIGPGRFDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD+V++ K+ GTE+K   G EYLV+   D++ IVV+
Sbjct: 62  AVGDVVIYSKYGGTEVKTG-GNEYLVLSARDVLAIVVK 98


>gi|95930573|ref|ZP_01313308.1| chaperonin Cpn10 [Desulfuromonas acetoxidans DSM 684]
 gi|95133408|gb|EAT15072.1| chaperonin Cpn10 [Desulfuromonas acetoxidans DSM 684]
          Length = 97

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +RP + R++V  ++ E  TA G I+IPDT S EKP    G I+  G G +   GKV+  +
Sbjct: 3   IRPLQDRLIVECVEEETTTA-GGIIIPDTASKEKPQ--EGVIIAAGKGKVTAEGKVLGMD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGK++GTEIK+ DG+ YL+M+E DI+G++
Sbjct: 60  VQVGDRVLFGKYAGTEIKV-DGKAYLMMREDDILGVL 95


>gi|217967346|ref|YP_002352852.1| co-chaperonin GroES [Dictyoglomus turgidum DSM 6724]
 gi|217336445|gb|ACK42238.1| chaperonin Cpn10 [Dictyoglomus turgidum DSM 6724]
          Length = 96

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 66/98 (67%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+ ++ E KT  G I++PDT  EKP    G ++ VG G +  +G+ +  E+
Sbjct: 3   LRPIGDRVVVKVIEQEEKT-KGGIVLPDTAKEKPQ--QGRVIAVGTGRILDNGQKVPLEI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD V+F K++GTE+K+ +GEEYL++ E DI+ ++ E
Sbjct: 60  KEGDRVIFAKYAGTEVKI-EGEEYLILSERDILAVIEE 96


>gi|297582889|ref|YP_003698669.1| chaperonin Cpn10 [Bacillus selenitireducens MLS10]
 gi|297141346|gb|ADH98103.1| chaperonin Cpn10 [Bacillus selenitireducens MLS10]
          Length = 94

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  ++ E KTA+G I++PD+  EKP    G+++ VG G + ++G+ + PE+
Sbjct: 2   LKPLGDRIVIELVEQEEKTASG-IVLPDSAKEKPQ--EGKVVAVGKGRVTENGETVTPEL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++G+E+K  +G+EY++++ESD++ ++
Sbjct: 59  KEGDKIVFSKYAGSEVKF-EGKEYMILRESDVLAVI 93


>gi|324998044|ref|ZP_08119156.1| chaperonin Cpn10 [Pseudonocardia sp. P1]
          Length = 96

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G I+IPDT  EKP    G+++ VG G +D +G  +  +V
Sbjct: 4   IKPLEDKIVVQASEAETTTASG-IVIPDTAKEKPQ--EGKVLAVGPGRVDDNGNRVPLDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+V++ K+ GTE+K N GEEYL++   D++ +V
Sbjct: 61  AVGDVVIYSKYGGTEVKYN-GEEYLILSARDVLAVV 95


>gi|147678942|ref|YP_001213157.1| Co-chaperonin GroES [Pelotomaculum thermopropionicum SI]
 gi|146275039|dbj|BAF60788.1| Co-chaperonin GroES [Pelotomaculum thermopropionicum SI]
          Length = 95

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ L SE +T  G I++PDT  EKP    GE++ VG+G + ++G+ +  ++
Sbjct: 2   IRPLGDRVVVKPLPSEERT-KGGIVLPDTAKEKPQ--EGEVVAVGSGRLLENGQRVPIDL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++G E+K++D  EYL+M+E+D++G++
Sbjct: 59  KPGDRILFSKYAGNEVKIDD-VEYLIMREADVLGVI 93


>gi|119357733|ref|YP_912377.1| co-chaperonin GroES [Chlorobium phaeobacteroides DSM 266]
 gi|166233993|sp|A1BHS6|CH10_CHLPD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|119355082|gb|ABL65953.1| chaperonin Cpn10 [Chlorobium phaeobacteroides DSM 266]
          Length = 95

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G ++IPDT  EKP    GE++ VG G +  SG+++E ++
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLIIPDTGKEKPQ--YGEVVAVGTGKVADSGQLLEMQI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  KVGQKVLYGKYSGTEVSV-EGEDYLIMRESDIFAIL 94


>gi|134103145|ref|YP_001108806.1| 10 kD chaperonin cpn10 [Saccharopolyspora erythraea NRRL 2338]
 gi|291003911|ref|ZP_06561884.1| co-chaperonin GroES [Saccharopolyspora erythraea NRRL 2338]
 gi|133915768|emb|CAM05881.1| 10 kD chaperonin cpn10 [Saccharopolyspora erythraea NRRL 2338]
          Length = 96

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G I+IPDT  EKP    G+++ VG G +D  G  I  +V
Sbjct: 4   IKPLEDKIVVQASEAETTTASG-IVIPDTAKEKPQ--EGKVLAVGPGRVDDKGTRIPVDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V++ K+ GTE+K N GEEYL++   D++ +V
Sbjct: 61  KEGDVVIYSKYGGTEVKYN-GEEYLILSARDVLAVV 95


>gi|311029228|ref|ZP_07707318.1| co-chaperonin GroES [Bacillus sp. m3-13]
          Length = 95

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  +QSE KTA+G I++PD+  EKP    G+++ VG G + +SG+ +  EV
Sbjct: 2   LKPLGDRIVIELVQSEEKTASG-IVLPDSAKEKPQ--EGKVVAVGTGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F K++GTE+K  +G E L+++E+D++ +V
Sbjct: 59  AEGDSVIFSKYAGTEVKF-EGRELLILKETDVLAVV 93


>gi|269955492|ref|YP_003325281.1| chaperonin Cpn10 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304173|gb|ACZ29723.1| chaperonin Cpn10 [Xylanimonas cellulosilytica DSM 15894]
          Length = 98

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (64%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPDT  EKP    GE++ VG G  D +G  +  +V
Sbjct: 5   IKPLEDRIVVKAIEAETTTASG-LVIPDTAKEKPQ--EGEVLAVGEGRFDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD V++ K+ GTE+K   GEEYLV+   DI+ +VV
Sbjct: 62  KVGDKVIYSKYGGTEVKYA-GEEYLVLSARDILAVVV 97


>gi|50812190|ref|NP_388483.2| co-chaperonin GroES [Bacillus subtilis subsp. subtilis str. 168]
 gi|154685102|ref|YP_001420263.1| co-chaperonin GroES [Bacillus amyloliquefaciens FZB42]
 gi|221308435|ref|ZP_03590282.1| co-chaperonin GroES [Bacillus subtilis subsp. subtilis str. 168]
 gi|221312757|ref|ZP_03594562.1| co-chaperonin GroES [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221317680|ref|ZP_03598974.1| co-chaperonin GroES [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221321956|ref|ZP_03603250.1| co-chaperonin GroES [Bacillus subtilis subsp. subtilis str. SMY]
 gi|296333065|ref|ZP_06875521.1| co-chaperonin GroES [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305673309|ref|YP_003864981.1| co-chaperonin GroES [Bacillus subtilis subsp. spizizenii str. W23]
 gi|311067074|ref|YP_003971997.1| co-chaperonin GroES [Bacillus atrophaeus 1942]
 gi|321314257|ref|YP_004206544.1| co-chaperonin GroES [Bacillus subtilis BSn5]
 gi|399235|sp|P28599|CH10_BACSU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166233981|sp|A7Z206|CH10_BACA2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|143026|gb|AAA22502.1| heat shock protein [Bacillus subtilis]
 gi|143062|gb|AAA22530.1| heat shock protein [Bacillus subtilis]
 gi|4433780|dbj|BAA22518.1| GroES protein [Bacillus subtilis]
 gi|32468706|emb|CAB12421.2| chaperonin small subunit [Bacillus subtilis subsp. subtilis str.
           168]
 gi|154350953|gb|ABS73032.1| GroES [Bacillus amyloliquefaciens FZB42]
 gi|291483039|dbj|BAI84114.1| co-chaperonin GroES [Bacillus subtilis subsp. natto BEST195]
 gi|296149790|gb|EFG90683.1| co-chaperonin GroES [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305411553|gb|ADM36672.1| co-chaperonin GroES [Bacillus subtilis subsp. spizizenii str. W23]
 gi|310867591|gb|ADP31066.1| co-chaperonin GroES [Bacillus atrophaeus 1942]
 gi|320020531|gb|ADV95517.1| co-chaperonin GroES [Bacillus subtilis BSn5]
          Length = 94

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+I+  G+G + +SG+ +  EV
Sbjct: 2   LKPLGDRVVIELVESEEKTASG-IVLPDSAKEKPQ--EGKIVAAGSGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 59  KEGDRIIFSKYAGTEVKY-EGTEYLILRESDILAVI 93


>gi|256380530|ref|YP_003104190.1| chaperonin Cpn10 [Actinosynnema mirum DSM 43827]
 gi|255924833|gb|ACU40344.1| chaperonin Cpn10 [Actinosynnema mirum DSM 43827]
          Length = 97

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G ++IPDT  EKP    G+++ VG G +D  G  I  +V
Sbjct: 5   IKPLEDKIVVQASEAETTTASG-LVIPDTAKEKPQ--EGKVLAVGPGRIDDKGNRIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+VL+ K+ GTE+K N GEEYL++   D++ ++
Sbjct: 62  AVGDVVLYSKYGGTEVKYN-GEEYLILSSRDVLAVI 96


>gi|325266588|ref|ZP_08133265.1| chaperone GroES [Kingella denitrificans ATCC 33394]
 gi|324982031|gb|EGC17666.1| chaperone GroES [Kingella denitrificans ATCC 33394]
          Length = 95

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KT++G IL P + +EKP    GE++ VGAG + + G     +V
Sbjct: 3   IRPLHDRVVIKRLEAEEKTSSGIILAP-SATEKPDM--GEVIAVGAGKIGKDGSRRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DG E LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGVELLVMREEDIFGIV 94


>gi|220910481|ref|YP_002485792.1| co-chaperonin GroES [Cyanothece sp. PCC 7425]
 gi|254813838|sp|B8HQ34|CH10_CYAP4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219867092|gb|ACL47431.1| chaperonin Cpn10 [Cyanothece sp. PCC 7425]
          Length = 103

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GEI+ VG G  +  G   EPEV
Sbjct: 11  VKPLGDRVFVKVSASEEKTA-GGILLPDTAKEKPQV--GEIVAVGPGKRNDDGSRQEPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   EEY+++ E DI+ IV
Sbjct: 68  KIGDKVLYSKYAGTDIKLGT-EEYVLLSEKDILAIV 102


>gi|167038117|ref|YP_001665695.1| co-chaperonin GroES [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039171|ref|YP_001662156.1| co-chaperonin GroES [Thermoanaerobacter sp. X514]
 gi|256750857|ref|ZP_05491741.1| chaperonin Cpn10 [Thermoanaerobacter ethanolicus CCSD1]
 gi|289577799|ref|YP_003476426.1| chaperonin Cpn10 [Thermoanaerobacter italicus Ab9]
 gi|297544086|ref|YP_003676388.1| chaperonin Cpn10 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|300913234|ref|ZP_07130551.1| Chaperonin Cpn10 [Thermoanaerobacter sp. X561]
 gi|307723752|ref|YP_003903503.1| chaperonin Cpn10 [Thermoanaerobacter sp. X513]
 gi|320116523|ref|YP_004186682.1| Chaperonin Cpn10 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|226704055|sp|B0KBR4|CH10_THEP3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226704056|sp|B0K3P5|CH10_THEPX RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166853411|gb|ABY91820.1| chaperonin Cpn10 [Thermoanaerobacter sp. X514]
 gi|166856951|gb|ABY95359.1| chaperonin Cpn10 [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750192|gb|EEU63212.1| chaperonin Cpn10 [Thermoanaerobacter ethanolicus CCSD1]
 gi|289527512|gb|ADD01864.1| Chaperonin Cpn10 [Thermoanaerobacter italicus Ab9]
 gi|296841861|gb|ADH60377.1| Chaperonin Cpn10 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|300889919|gb|EFK85064.1| Chaperonin Cpn10 [Thermoanaerobacter sp. X561]
 gi|307580813|gb|ADN54212.1| Chaperonin Cpn10 [Thermoanaerobacter sp. X513]
 gi|319929614|gb|ADV80299.1| Chaperonin Cpn10 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 94

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVV+ +Q+E +   G +++P T  EKP    GE++ VG G     GK +E EV
Sbjct: 3   LKPLGDRVVVKVIQAE-EVTKGGVILPGTAKEKPQ--QGEVVAVGTG-QYIDGKKVELEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+KL DGEEYL+++ESDI+ I+
Sbjct: 59  KVGDRVIFSKYAGTEVKL-DGEEYLLLRESDILAII 93


>gi|332669584|ref|YP_004452592.1| Chaperonin Cpn10 [Cellulomonas fimi ATCC 484]
 gi|332338622|gb|AEE45205.1| Chaperonin Cpn10 [Cellulomonas fimi ATCC 484]
          Length = 98

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPD+  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVVKTLDAETTTASG-LVIPDSAKEKPQ--EGEVLAVGPGRVDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD V++ K+ GTE+K   GEEYL++   DI+ +VV+
Sbjct: 62  AVGDKVIYSKYGGTEVKYA-GEEYLILSARDILAVVVK 98


>gi|332286893|ref|YP_004418804.1| co-chaperonin GroES [Pusillimonas sp. T7-7]
 gi|330430846|gb|AEC22180.1| co-chaperonin GroES [Pusillimonas sp. T7-7]
          Length = 95

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++RL +E  TA+G I+IP++ +EKP    GE++ VG G     GKV   ++
Sbjct: 3   LRPLHDRVIIKRLDNERTTASG-IVIPESATEKPD--QGEVIAVGPGKRSDDGKVQPVDL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGK++G  +K+ DGEE LV++E +I+ +V+
Sbjct: 60  KVGDKVLFGKYAGQTVKV-DGEEVLVIREEEILAVVL 95


>gi|307267549|ref|ZP_07549027.1| Chaperonin Cpn10 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390927|ref|ZP_08212478.1| Chaperonin Cpn10 [Thermoanaerobacter ethanolicus JW 200]
 gi|2493659|sp|Q60023|CH10_THEBR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1326190|gb|AAB00558.1| chaperonin 10 [Thermoanaerobacter brockii]
 gi|306917428|gb|EFN47724.1| Chaperonin Cpn10 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993075|gb|EGD51516.1| Chaperonin Cpn10 [Thermoanaerobacter ethanolicus JW 200]
          Length = 94

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   RVVV+ +Q+E +   G +++P T  EKP    GE++ VG G  +D  GK +E E
Sbjct: 3   LKPLGDRVVVKVIQAE-EVTKGGVILPGTAKEKPQ--QGEVVAVGTGEYID--GKKVELE 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V+F K++GTE+KL DGEEYL+++ESDI+ I+
Sbjct: 58  VKVGDRVIFSKYAGTEVKL-DGEEYLLLRESDILAII 93


>gi|16804108|ref|NP_465593.1| co-chaperonin GroES [Listeria monocytogenes EGD-e]
 gi|46908304|ref|YP_014693.1| co-chaperonin GroES [Listeria monocytogenes serotype 4b str. F2365]
 gi|47094068|ref|ZP_00231796.1| chaperone protein GroES [Listeria monocytogenes str. 4b H7858]
 gi|217963782|ref|YP_002349460.1| chaperonin GroS [Listeria monocytogenes HCC23]
 gi|224498484|ref|ZP_03666833.1| co-chaperonin GroES [Listeria monocytogenes Finland 1988]
 gi|224501132|ref|ZP_03669439.1| co-chaperonin GroES [Listeria monocytogenes FSL R2-561]
 gi|226224675|ref|YP_002758782.1| class I heat-shock protein (chaperonin) GroES [Listeria
           monocytogenes Clip81459]
 gi|254826175|ref|ZP_05231176.1| predicted protein [Listeria monocytogenes FSL J1-194]
 gi|254827043|ref|ZP_05231730.1| predicted protein [Listeria monocytogenes FSL N3-165]
 gi|254831690|ref|ZP_05236345.1| co-chaperonin GroES [Listeria monocytogenes 10403S]
 gi|254853994|ref|ZP_05243342.1| predicted protein [Listeria monocytogenes FSL R2-503]
 gi|254899233|ref|ZP_05259157.1| co-chaperonin GroES [Listeria monocytogenes J0161]
 gi|254912626|ref|ZP_05262638.1| predicted protein [Listeria monocytogenes J2818]
 gi|254933497|ref|ZP_05266856.1| predicted protein [Listeria monocytogenes HPB2262]
 gi|254936953|ref|ZP_05268650.1| predicted protein [Listeria monocytogenes F6900]
 gi|254992575|ref|ZP_05274765.1| co-chaperonin GroES [Listeria monocytogenes FSL J2-064]
 gi|255521391|ref|ZP_05388628.1| co-chaperonin GroES [Listeria monocytogenes FSL J1-175]
 gi|284802514|ref|YP_003414379.1| co-chaperonin GroES [Listeria monocytogenes 08-5578]
 gi|284995656|ref|YP_003417424.1| co-chaperonin GroES [Listeria monocytogenes 08-5923]
 gi|290892216|ref|ZP_06555212.1| predicted protein [Listeria monocytogenes FSL J2-071]
 gi|300765505|ref|ZP_07075486.1| hypothetical protein LMHG_12374 [Listeria monocytogenes FSL N1-017]
 gi|20137920|sp|Q9AGE7|CH10_LISMO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|60389671|sp|Q71XU5|CH10_LISMF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813847|sp|B8DH58|CH10_LISMH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|259585887|sp|C1KX22|CH10_LISMC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|16411539|emb|CAD00147.1| class I heat-shock protein (chaperonin) GroES [Listeria
           monocytogenes EGD-e]
 gi|46881575|gb|AAT04870.1| chaperone protein GroES [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017568|gb|EAL08373.1| chaperone protein GroES [Listeria monocytogenes str. 4b H7858]
 gi|217333052|gb|ACK38846.1| chaperonin GroS [Listeria monocytogenes HCC23]
 gi|225877137|emb|CAS05849.1| class I heat-shock protein (chaperonin) GroES [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258599425|gb|EEW12750.1| predicted protein [Listeria monocytogenes FSL N3-165]
 gi|258607384|gb|EEW19992.1| predicted protein [Listeria monocytogenes FSL R2-503]
 gi|258609555|gb|EEW22163.1| predicted protein [Listeria monocytogenes F6900]
 gi|284058076|gb|ADB69017.1| co-chaperonin GroES [Listeria monocytogenes 08-5578]
 gi|284061123|gb|ADB72062.1| co-chaperonin GroES [Listeria monocytogenes 08-5923]
 gi|290558339|gb|EFD91857.1| predicted protein [Listeria monocytogenes FSL J2-071]
 gi|293585061|gb|EFF97093.1| predicted protein [Listeria monocytogenes HPB2262]
 gi|293590620|gb|EFF98954.1| predicted protein [Listeria monocytogenes J2818]
 gi|293595415|gb|EFG03176.1| predicted protein [Listeria monocytogenes FSL J1-194]
 gi|300513816|gb|EFK40882.1| hypothetical protein LMHG_12374 [Listeria monocytogenes FSL N1-017]
 gi|307571645|emb|CAR84824.1| chaperone protein [Listeria monocytogenes L99]
 gi|313607676|gb|EFR83933.1| chaperonin GroS [Listeria monocytogenes FSL F2-208]
 gi|313617925|gb|EFR90106.1| chaperonin GroS [Listeria innocua FSL S4-378]
 gi|313622953|gb|EFR93253.1| chaperonin GroS [Listeria innocua FSL J1-023]
 gi|328466048|gb|EGF37224.1| co-chaperonin GroES [Listeria monocytogenes 1816]
 gi|328472656|gb|EGF43518.1| co-chaperonin GroES [Listeria monocytogenes 220]
 gi|332312518|gb|EGJ25613.1| 10 kDa chaperonin [Listeria monocytogenes str. Scott A]
          Length = 94

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%), Gaps = 8/97 (8%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEP- 66
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G V+D   K  EP 
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVLDNGTK--EPL 56

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           EV++GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 57  EVAEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|229917842|ref|YP_002886488.1| chaperonin Cpn10 [Exiguobacterium sp. AT1b]
 gi|259585881|sp|C4L1L1|CH10_EXISA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|229469271|gb|ACQ71043.1| chaperonin Cpn10 [Exiguobacterium sp. AT1b]
          Length = 94

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++  ++ E KT  G I++PDT  EKP    G+++ VG G +   GK I+ +V
Sbjct: 2   LKPLGDRVIIEVVEKEEKT-IGGIVLPDTAKEKPQ--QGKVVAVGTGRVTDEGKRIDLDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            + D+V++ K++GTE+K +DG+EYL+++ESDI+ IV
Sbjct: 59  KENDLVIYSKYAGTEVK-HDGKEYLIVRESDILAIV 93


>gi|325290770|ref|YP_004266951.1| 10 kDa chaperonin [Syntrophobotulus glycolicus DSM 8271]
 gi|324966171|gb|ADY56950.1| 10 kDa chaperonin [Syntrophobotulus glycolicus DSM 8271]
          Length = 94

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++ + SE +T +G I++PDT  EKP    GEI+ VG G +++ G+ I  +V
Sbjct: 3   LRPLADRVIIKAVPSEERTKSG-IIMPDTAKEKPQ--EGEIIAVGPGRIEK-GERIAVDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++GTE+K  DGEEYL+++ESDI  ++
Sbjct: 59  QVGDKVIYSKYAGTEVKF-DGEEYLILRESDIQAVI 93


>gi|16801240|ref|NP_471508.1| co-chaperonin GroES [Listeria innocua Clip11262]
 gi|20137850|sp|Q929U9|CH10_LISIN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|16414688|emb|CAC97404.1| class I heat-shock protein (chaperonin) GroES [Listeria innocua
           Clip11262]
          Length = 94

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%), Gaps = 8/97 (8%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEP- 66
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G V+D   K  EP 
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVLDNGTK--EPL 56

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           EV++GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 57  EVAEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|167627323|ref|YP_001677823.1| co-chaperonin GroES [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|241667881|ref|ZP_04755459.1| co-chaperonin GroES [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876421|ref|ZP_05249131.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|189044104|sp|B0TX64|CH10_FRAP2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|167597324|gb|ABZ87322.1| co-chaperonin GroES (HSP10) [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254842442|gb|EET20856.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 95

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+VRR + E K+A G I++  +  EKPS   GE++ VG G    +G     +V
Sbjct: 3   IRPLQDRVLVRRAEEETKSA-GGIILTGSAQEKPS--QGEVVAVGNGKKLDNGSTQPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG+E+K+ND E  L+M+E DIMGI+
Sbjct: 60  KVGDKVLFGKYSGSEVKVND-ETLLMMREDDIMGII 94


>gi|188585088|ref|YP_001916633.1| chaperonin Cpn10 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226704015|sp|B2A5V2|CH10_NATTJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|179349775|gb|ACB84045.1| chaperonin Cpn10 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 95

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V++ L++E KT +G I++P+   EKP    GE++ VG+G     G  +EPEV
Sbjct: 3   LKPLGDRIVIKILEAEEKTESG-IVLPEKAKEKPQ--EGEVVAVGSGKTLDDGSKVEPEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++G E+++ DGEEYL+M++ DI+ ++
Sbjct: 60  KAGDKVVYSKFAGNEVEV-DGEEYLIMRQDDILAVI 94


>gi|229821538|ref|YP_002883064.1| chaperonin Cpn10 [Beutenbergia cavernae DSM 12333]
 gi|259585873|sp|C5BZX2|CH10_BEUC1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|229567451|gb|ACQ81302.1| chaperonin Cpn10 [Beutenbergia cavernae DSM 12333]
          Length = 98

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L++E  TA+G ++IPDT  EKP    GE++ +G G +D +G  +  +V
Sbjct: 5   IKPLEDRIVVKTLEAEQTTASG-LVIPDTAKEKPQ--EGEVLAIGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+V++ K+ GTE+K   G+EYL++   D++ +V
Sbjct: 62  AVGDVVIYSKYGGTEVKYA-GQEYLILSARDVLAVV 96


>gi|291298611|ref|YP_003509889.1| chaperonin Cpn10 [Stackebrandtia nassauensis DSM 44728]
 gi|290567831|gb|ADD40796.1| chaperonin Cpn10 [Stackebrandtia nassauensis DSM 44728]
          Length = 98

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+  ++E  TA+G I+IPDT  EKP    G ++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDRIVVQTNEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRVDDKGNRVPIDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N GE+YLV+   D++ ++
Sbjct: 62  KTGDVVLYSKYGGTEVKYN-GEDYLVLSARDVLAVI 96


>gi|53720527|ref|YP_109513.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243]
 gi|53725721|ref|YP_103981.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344]
 gi|67643519|ref|ZP_00442264.1| chaperonin GroS [Burkholderia mallei GB8 horse 4]
 gi|121599729|ref|YP_991695.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1]
 gi|124385950|ref|YP_001027190.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229]
 gi|126448232|ref|YP_001082142.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247]
 gi|166998507|ref|ZP_02264365.1| chaperonin, 10 kDa [Burkholderia mallei PRL-20]
 gi|167740175|ref|ZP_02412949.1| chaperonin, 10 kDa [Burkholderia pseudomallei 14]
 gi|167817390|ref|ZP_02449070.1| chaperonin, 10 kDa [Burkholderia pseudomallei 91]
 gi|167912517|ref|ZP_02499608.1| chaperonin, 10 kDa [Burkholderia pseudomallei 112]
 gi|237813790|ref|YP_002898241.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|254178984|ref|ZP_04885638.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399]
 gi|254180667|ref|ZP_04887265.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|254202696|ref|ZP_04909059.1| chaperonin, 10 kDa [Burkholderia mallei FMH]
 gi|254208036|ref|ZP_04914386.1| chaperonin, 10 kDa [Burkholderia mallei JHU]
 gi|52210941|emb|CAH36929.1| 10 kDa chaperonin [Burkholderia pseudomallei K96243]
 gi|52429144|gb|AAU49737.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 23344]
 gi|121228539|gb|ABM51057.1| chaperonin, 10 kDa [Burkholderia mallei SAVP1]
 gi|124293970|gb|ABN03239.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10229]
 gi|126241102|gb|ABO04195.1| chaperonin, 10 kDa [Burkholderia mallei NCTC 10247]
 gi|147746943|gb|EDK54020.1| chaperonin, 10 kDa [Burkholderia mallei FMH]
 gi|147751930|gb|EDK58997.1| chaperonin, 10 kDa [Burkholderia mallei JHU]
 gi|160694898|gb|EDP84906.1| chaperonin, 10 kDa [Burkholderia mallei ATCC 10399]
 gi|184211206|gb|EDU08249.1| chaperonin, 10 kDa [Burkholderia pseudomallei 1655]
 gi|237506277|gb|ACQ98595.1| chaperonin GroS [Burkholderia pseudomallei MSHR346]
 gi|238524881|gb|EEP88311.1| chaperonin GroS [Burkholderia mallei GB8 horse 4]
 gi|243065192|gb|EES47378.1| chaperonin, 10 kDa [Burkholderia mallei PRL-20]
          Length = 105

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 69/97 (71%), Gaps = 4/97 (4%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RV+V+R++ +  TA+G I+IPD+ +EKP    GEI+ +G G + Q G +   +
Sbjct: 2   HVRPLYDRVIVKRIEQQRTTASG-IVIPDSAAEKPE--QGEIVALGNGRLLQDGTLRALQ 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  GD V+FG+++G  IK+ DGE++LV++E D++G++
Sbjct: 59  LEVGDQVIFGEYAGQSIKV-DGEDFLVIREEDVLGVL 94


>gi|315274264|ref|ZP_07869336.1| chaperonin GroS [Listeria marthii FSL S4-120]
 gi|313616006|gb|EFR89166.1| chaperonin GroS [Listeria marthii FSL S4-120]
          Length = 94

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 68/95 (71%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G + ++G     EV
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVLENGTRETLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           ++GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 59  AEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|254488194|ref|ZP_05101399.1| chaperonin GroS [Roseobacter sp. GAI101]
 gi|214045063|gb|EEB85701.1| chaperonin GroS [Roseobacter sp. GAI101]
          Length = 71

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (72%), Gaps = 3/73 (4%)

Query: 32  ILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEE 91
           ++IPD+  EKPS   GE++  G G    SG++IE  V  GD +LFGKWSGTE+ L DGEE
Sbjct: 1   MIIPDSAKEKPS--EGEVVACGEGARKDSGELIEMAVKPGDKILFGKWSGTEVTL-DGEE 57

Query: 92  YLVMQESDIMGIV 104
            L+M+ESDIMGI+
Sbjct: 58  LLMMKESDIMGII 70


>gi|189485681|ref|YP_001956622.1| chaperonin Cpn10 [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|170287640|dbj|BAG14161.1| chaperonin Cpn10 [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 94

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   +V+V+  + + +   G I+IPDT  EKP    GEI+ VG G   + GK+I  +V
Sbjct: 2   IRPLGEKVLVKPAEPK-EVKKGGIIIPDTAKEKPQ--EGEIIAVGTGKRTEDGKIIALDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SGTE K++D  EYL+M + DI+GI+
Sbjct: 59  KVGDKILFGKYSGTEAKIDD-VEYLIMSQDDILGII 93


>gi|302392819|ref|YP_003828639.1| Chaperonin Cpn10 [Acetohalobium arabaticum DSM 5501]
 gi|302204896|gb|ADL13574.1| Chaperonin Cpn10 [Acetohalobium arabaticum DSM 5501]
          Length = 96

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ +++E +T    I++P++  E+P    GE++ VGAG    +G+ +  +V
Sbjct: 3   IKPLGDRVVVKDIEAEEETTESGIVLPESAKEEPQ--EGEVVAVGAGKKLDNGERLTMDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD V++GK++GTEI+  DGEEYLV+ E D++ IV
Sbjct: 61  SEGDRVIYGKYAGTEIEF-DGEEYLVISEKDVLAIV 95


>gi|146283473|ref|YP_001173626.1| co-chaperonin GroES [Pseudomonas stutzeri A1501]
 gi|166198400|sp|A4VP83|CH10_PSEU5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|145571678|gb|ABP80784.1| chaperonin, 10 kDa [Pseudomonas stutzeri A1501]
 gi|327481870|gb|AEA85180.1| co-chaperonin GroES [Pseudomonas stutzeri DSM 4166]
          Length = 97

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V  P V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRAPAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVI 95


>gi|123966849|ref|YP_001011930.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9515]
 gi|166198395|sp|A2BYG2|CH10_PROM5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123201215|gb|ABM72823.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. MIT
           9515]
          Length = 103

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  +SE KTA G IL+PD+  EKP    GE+  VG G ++  G    PEV
Sbjct: 11  VKPLGDRIFIKVSESEEKTA-GGILLPDSAKEKPQV--GEVAQVGPGKLNDDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|148244664|ref|YP_001219358.1| chaperonin GroES [Candidatus Vesicomyosocius okutanii HA]
 gi|166198423|sp|A5CWP5|CH10_VESOH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|146326491|dbj|BAF61634.1| chaperonin GroES [Candidatus Vesicomyosocius okutanii HA]
          Length = 95

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR++ E KT +  ++IPD+ +EKPS   G ++ VG G  + +G  I  +V
Sbjct: 3   IRPLHDRVVVRRVE-EKKTTSSGLIIPDSATEKPS--EGVVVAVGNGKKNDNGDTIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ VLF +++GTEIK+ DG++ L+M+E DI+ ++
Sbjct: 60  TIGNKVLFAQYAGTEIKV-DGKKLLIMKEGDIVAVI 94


>gi|13507271|gb|AAK28537.1|AF335323_1 GroES [Listeria monocytogenes]
          Length = 94

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G +  +G     EV
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVPDNGTKEPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           ++GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 59  AEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|258593192|emb|CBE69530.1| chaperone Hsp10 (GroES), part of GroE chaperone system [NC10
           bacterium 'Dutch sediment']
          Length = 95

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+RL+ E +   G I+IPDT  EKP    GE++ VG G +   GK    +V
Sbjct: 3   VKPLHDRILVKRLE-EKEIKKGGIIIPDTAKEKPQ--EGEVIAVGPGKVGDDGKRQPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK+SG+E+K+ D EE+L+M+E D++ I+
Sbjct: 60  KAGDKILFGKYSGSEVKV-DNEEFLIMREEDVLCIL 94


>gi|269796151|ref|YP_003315606.1| Co-chaperonin GroES [Sanguibacter keddieii DSM 10542]
 gi|269098336|gb|ACZ22772.1| Co-chaperonin GroES [Sanguibacter keddieii DSM 10542]
          Length = 97

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L+ E+ T +G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVVKTLEVELTTPSG-LVIPDTAKEKPQ--EGEVLAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K  DGEEYL++   D++ ++
Sbjct: 62  AVGDKVIYSKYGGTEVKY-DGEEYLILSARDVLAVI 96


>gi|116873506|ref|YP_850287.1| co-chaperonin GroES [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|123461335|sp|A0AKH6|CH10_LISW6 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|116742384|emb|CAK21508.1| chaperone protein GroES [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 94

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 68/95 (71%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G + ++G     EV
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVLENGTKEPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           ++GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 59  AEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|72382807|ref|YP_292162.1| co-chaperonin GroES [Prochlorococcus marinus str. NATL2A]
 gi|124026542|ref|YP_001015657.1| co-chaperonin GroES [Prochlorococcus marinus str. NATL1A]
 gi|123732596|sp|Q46J69|CH10_PROMT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198394|sp|A2C4I3|CH10_PROM1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|72002657|gb|AAZ58459.1| Co-chaperonin GroES [Prochlorococcus marinus str. NATL2A]
 gi|123961610|gb|ABM76393.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str.
           NATL1A]
          Length = 103

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE+  VG G  ++ G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVAQVGPGKRNEDGSRQSPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  SVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|206895265|ref|YP_002246990.1| chaperonin GroS [Coprothermobacter proteolyticus DSM 5265]
 gi|226701749|sp|B5Y893|CH10_COPPD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|206737882|gb|ACI16960.1| chaperonin GroS [Coprothermobacter proteolyticus DSM 5265]
          Length = 98

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++ ++ E KT +G I+IPDT  EKP    G+++ VG G    +G  +  EV
Sbjct: 3   IKPLGDRVLLKPMEEEEKTKSG-IVIPDTAKEKPQ--KGKVLAVGTGRTLDNGTRVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIV+F K++GTE+K+ DGEEYL++ E DI+ +V
Sbjct: 60  QVGDIVVFSKYAGTEVKV-DGEEYLIVSERDILAVV 94


>gi|123969171|ref|YP_001010029.1| co-chaperonin GroES [Prochlorococcus marinus str. AS9601]
 gi|166198396|sp|A2BT11|CH10_PROMS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123199281|gb|ABM70922.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str.
           AS9601]
          Length = 103

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++   SE KTA G IL+PD+  EKP    GE+  VG G +++ G    PEV
Sbjct: 11  VKPLGDRIFIKVSASEEKTA-GGILLPDSAKEKPQV--GEVAQVGPGKLNEDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|51894034|ref|YP_076725.1| 10 kDa chaperonin [Symbiobacterium thermophilum IAM 14863]
 gi|60389542|sp|Q67KB7|CH10_SYMTH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|51857723|dbj|BAD41881.1| 10 kDa chaperonin [Symbiobacterium thermophilum IAM 14863]
          Length = 97

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++ L+ E +T +G I++PDT  EKP    G+++ VG G   +SG  +E EV
Sbjct: 3   VKPLGARVVIKPLEKEERTKSG-IVLPDTAKEKPQ--QGKVIAVGPGRTLESGTKVELEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQ-ESDIMGIV 104
            +GD V+F K++GTE+K+ DGEEY+++  E DI+ IV
Sbjct: 60  KEGDTVIFSKYAGTEVKI-DGEEYIILDGERDILAIV 95


>gi|148655230|ref|YP_001275435.1| chaperonin Cpn10 [Roseiflexus sp. RS-1]
 gi|148567340|gb|ABQ89485.1| chaperonin Cpn10 [Roseiflexus sp. RS-1]
          Length = 98

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++RP   RVVV+    E KT  G +++PDT S K     GE++ VG G     GK+I   
Sbjct: 2   HVRPLGDRVVVKPKPREEKTK-GGVILPDTAS-KERPMQGEVIAVGPGRHTDDGKLIPIS 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
           V  G  VLF K++GTE K++D EEYL++QE D++GI+ EE
Sbjct: 60  VEVGQQVLFAKYAGTEFKIDD-EEYLILQERDLLGIIQEE 98


>gi|33861993|ref|NP_893554.1| co-chaperonin GroES [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|60389724|sp|Q7TU43|CH10_PROMP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|33640361|emb|CAE19896.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 103

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  +SE KTA G IL+PD+  EKP    GE+  VG G ++  G    PEV
Sbjct: 11  VKPLGDRIFIKVSESEEKTA-GGILLPDSAKEKPQV--GEVAQVGPGKLNDDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|261414474|ref|YP_003248157.1| chaperonin Cpn10 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261370930|gb|ACX73675.1| chaperonin Cpn10 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302326850|gb|ADL26051.1| chaperonin, 10 kDa [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 93

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 65/94 (69%), Gaps = 4/94 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+  ++E KT++G + IPD   EKP    G+++ VG G  +  G+V+  EV
Sbjct: 2   IKPLADRIVVKPAEAEQKTSSG-LFIPDNAKEKPM--QGKVVAVGPGRKNDKGEVVAMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
             GD+VL+GK+SGTE+ + DGE +L+++ESD++ 
Sbjct: 59  KVGDVVLYGKYSGTEVTV-DGENFLIVKESDVIA 91


>gi|238020719|ref|ZP_04601145.1| hypothetical protein GCWU000324_00609 [Kingella oralis ATCC 51147]
 gi|237867699|gb|EEP68705.1| hypothetical protein GCWU000324_00609 [Kingella oralis ATCC 51147]
          Length = 95

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++RL++E KTA+G IL P + +EKP    GE++ VG G + + G     +V
Sbjct: 3   IRPLHDRVVIKRLEAEEKTASGIILAP-SAAEKPDM--GEVVAVGEGKIGKDGNRRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK+SG  +K  DG E LVM+E DI GIV
Sbjct: 60  KVGDKVIFGKYSGQTVK-ADGVELLVMREEDIFGIV 94


>gi|237786296|ref|YP_002907001.1| molecular chaperone protein [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259585876|sp|C4LKV3|CH10_CORK4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|237759208|gb|ACR18458.1| molecular chaperone protein [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 99

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+ +++E  TA+G ++IPDT  EKP  ++  ++ VG G  D++GK +  +V
Sbjct: 6   IKPLEDKLLVQIVEAETTTASG-LVIPDTAKEKPQEAT--VVAVGPGRTDENGKRVPMDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V+F K+ GTEIK   GEEYL++ + D++ +V
Sbjct: 63  AEGDVVIFSKYGGTEIKYA-GEEYLILSQRDVLAVV 97


>gi|323357260|ref|YP_004223656.1| co-chaperonin GroES (HSP10) [Microbacterium testaceum StLB037]
 gi|323273631|dbj|BAJ73776.1| co-chaperonin GroES (HSP10) [Microbacterium testaceum StLB037]
          Length = 98

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIKQVEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + GD VL+ K+ GTE+K    EEYLV+   D++ +VV
Sbjct: 62  AVGDRVLYSKYGGTEVKFG-AEEYLVLSARDVLAVVV 97


>gi|319790194|ref|YP_004151827.1| Chaperonin Cpn10 [Thermovibrio ammonificans HB-1]
 gi|317114696|gb|ADU97186.1| Chaperonin Cpn10 [Thermovibrio ammonificans HB-1]
          Length = 96

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 69/98 (70%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVV++++ E KTA G I++PDT  E+  +  GE++ VG G + ++G++   +V
Sbjct: 3   LKPLYDRVVVKKIEMEQKTA-GGIILPDTAKEE--SQIGEVIAVGEGRLLENGEIRPLKV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD VLF K++G E+K+ DGEE LV++E DI+ IV E
Sbjct: 60  KEGDKVLFSKYAGNEVKI-DGEELLVIREEDILAIVEE 96


>gi|87123627|ref|ZP_01079477.1| Co-chaperonin GroES [Synechococcus sp. RS9917]
 gi|86168196|gb|EAQ69453.1| Co-chaperonin GroES [Synechococcus sp. RS9917]
          Length = 103

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|193213016|ref|YP_001998969.1| co-chaperonin GroES [Chlorobaculum parvum NCIB 8327]
 gi|226701735|sp|B3QPB6|CH10_CHLP8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|193086493|gb|ACF11769.1| chaperonin Cpn10 [Chlorobaculum parvum NCIB 8327]
          Length = 95

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VG G +  +G++++ +V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLYIPDTGKEKPQ--YGEVVAVGEGKVADNGQLVQMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+++ + E+YL+M+ESDI  I+
Sbjct: 60  KVGDKVLYGKYSGTEVQV-EAEDYLIMRESDIFAIL 94


>gi|189346040|ref|YP_001942569.1| co-chaperonin GroES [Chlorobium limicola DSM 245]
 gi|226701734|sp|B3EGF3|CH10_CHLL2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189340187|gb|ACD89590.1| chaperonin Cpn10 [Chlorobium limicola DSM 245]
          Length = 95

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPDT  EKP    GE++ VG G +  +G++++ +V
Sbjct: 3   LKPLADRVIVKPAPAEEKT-KGGLFIPDTGKEKPQ--YGEVVAVGPGKVADNGQLLDMQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G  VL+GK+SGTE+ + +GE+YL+M+ESDI  I+
Sbjct: 60  TVGKKVLYGKYSGTEVNV-EGEDYLIMRESDIFAIL 94


>gi|260655739|ref|ZP_05861208.1| chaperonin GroS [Jonquetella anthropi E3_33 E1]
 gi|260629355|gb|EEX47549.1| chaperonin GroS [Jonquetella anthropi E3_33 E1]
          Length = 96

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ +  E +T  G + +PDT  EKP    GE++ VG+G + ++G+ + PEV
Sbjct: 3   LKPLADRIVVKVISKEERT-KGGLYLPDTAQEKPQ--EGEVLAVGSGKVLENGQKLLPEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTEIKL DGEE ++  E D++ I+
Sbjct: 60  KVGDHIIFSKYAGTEIKL-DGEELVIFSERDVLAIL 94


>gi|110833494|ref|YP_692353.1| chaperonin, 10 kDa [Alcanivorax borkumensis SK2]
 gi|122959630|sp|Q0VRW7|CH10_ALCBS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|110646605|emb|CAL16081.1| chaperonin, 10 kDa [Alcanivorax borkumensis SK2]
          Length = 96

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+VRR + E K+A G I++P + +EKPS   GE++ VG G + ++G V   +V
Sbjct: 3   IRPLHDRVLVRREEEETKSA-GGIVLPGSAAEKPS--RGEVIAVGNGKITENGDVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG++SG+ +K+ +GEE L+M E++I+ +V
Sbjct: 60  KAGDTVIFGQYSGSTVKV-EGEELLIMSEAEILAVV 94


>gi|289523418|ref|ZP_06440272.1| chaperonin GroS [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503110|gb|EFD24274.1| chaperonin GroS [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 98

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (67%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  L+P   RVV++ L  E KT  G I++PDT  EKP    GE++ VG+G + ++G+ + 
Sbjct: 2   KMQLKPLGDRVVIKVLSQEEKT-KGGIVLPDTAKEKPQ--EGEVVAVGSGRVLENGQKLP 58

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            EV  G+ V+F K++GTE+K+ +GEEYL++ E DI+ +V
Sbjct: 59  LEVKVGERVIFSKYAGTEVKI-EGEEYLILSERDILAVV 96


>gi|86609081|ref|YP_477843.1| co-chaperonin GroES [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123765473|sp|Q2JL42|CH10_SYNJB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|86557623|gb|ABD02580.1| chaperonin, 10 kDa [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 103

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+  Q + KTA G I +PDT  EKP    GE++ VG G  +  GK+I  E+
Sbjct: 11  LKPLGDRVLVKIAQQDEKTA-GGIFLPDTAKEKPQV--GEVVAVGPGKRNDEGKLIPMEL 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GTE+KL   +EY+++ E DI+ IV
Sbjct: 68  KAGDKVLYSKYAGTEVKLG-SDEYVLLAERDILAIV 102


>gi|152996058|ref|YP_001340893.1| chaperonin Cpn10 [Marinomonas sp. MWYL1]
 gi|189044108|sp|A6VWX9|CH10_MARMS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|150836982|gb|ABR70958.1| chaperonin Cpn10 [Marinomonas sp. MWYL1]
          Length = 96

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E  TA+G I++P +  EKP+   GE++ VG G +  +G V    V
Sbjct: 3   IRPLHDRVVVRRKEEETTTASG-IVLPGSAKEKPT--QGEVLAVGTGRIQSNGDVQALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG++SG  +K+ +G+E L+M+E +I GIV
Sbjct: 60  KVGDTVLFGQYSGQTVKI-EGDELLIMKEDEIYGIV 94


>gi|154491509|ref|ZP_02031135.1| hypothetical protein PARMER_01120 [Parabacteroides merdae ATCC
           43184]
 gi|218263550|ref|ZP_03477631.1| hypothetical protein PRABACTJOHN_03319 [Parabacteroides johnsonii
           DSM 18315]
 gi|154088310|gb|EDN87355.1| hypothetical protein PARMER_01120 [Parabacteroides merdae ATCC
           43184]
 gi|218222673|gb|EEC95323.1| hypothetical protein PRABACTJOHN_03319 [Parabacteroides johnsonii
           DSM 18315]
          Length = 89

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++   +E KT  G I+IPD+  EKP    GE++ VG G  D+     E  V
Sbjct: 3   IRPLADRVLIKPAAAEEKT-LGGIIIPDSAKEKPL--KGEVVAVGNGTKDE-----EMVV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTEI+L DGE+YL+M++SDI+ I+
Sbjct: 55  KNGDTVLYGKYAGTEIEL-DGEKYLIMRQSDILAII 89


>gi|156741198|ref|YP_001431327.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941]
 gi|156232526|gb|ABU57309.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941]
          Length = 101

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 62/98 (63%), Gaps = 3/98 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ ++ E KT  G I +PDT S K     G ++ VG G +D +GK I   V
Sbjct: 7   IRPLADRVVVKPVEREEKTK-GGIYLPDTAS-KERPMEGTVLAVGEGRIDDNGKRIPMNV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD V+F K+SGTE K++D  EYL++ E DI+GI+ E
Sbjct: 65  KAGDRVIFAKYSGTEFKIDD-VEYLILSEKDILGIIQE 101


>gi|313896679|ref|ZP_07830227.1| chaperonin GroS [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320530050|ref|ZP_08031123.1| chaperonin GroS [Selenomonas artemidis F0399]
 gi|312974596|gb|EFR40063.1| chaperonin GroS [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137719|gb|EFW29628.1| chaperonin GroS [Selenomonas artemidis F0399]
          Length = 93

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+   +S++ TA+G I++PDT  EKP    G+++ VG G +  +G+   PEV
Sbjct: 2   IKPLGERVVIEVAESDVTTASG-IVLPDTAKEKPQ--KGKVVAVGTGKLLDNGQRATPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SG+EIK++D ++YL+++ESDI+ I+
Sbjct: 59  KVGDGVVFSKYSGSEIKVDD-KDYLIVRESDILAIL 93


>gi|298373320|ref|ZP_06983309.1| chaperonin GroS [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274372|gb|EFI15924.1| chaperonin GroS [Bacteroidetes oral taxon 274 str. F0058]
          Length = 89

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 67/96 (69%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E KTA+G I+IPDT  EKP    G+++ VG G  D++  +++P  
Sbjct: 3   IKPLADRVLVLPAQAEEKTASG-IIIPDTAKEKPQ--RGKVVAVGNGTKDET-MIVKP-- 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D VL+GK++GTE +L DGE+YL+M++SDI+ I+
Sbjct: 57  --NDTVLYGKYAGTEFEL-DGEKYLIMRQSDILAII 89


>gi|295112238|emb|CBL28988.1| Co-chaperonin GroES (HSP10) [Synergistetes bacterium SGP1]
          Length = 97

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ L  E KT  G I++PDT  EKP+   GE++ VG G +  +G+ +  EV
Sbjct: 3   LKPLGDRIVVKVLSREEKTK-GGIVLPDTAKEKPT--EGEVIAVGTGKVLDNGQKLPIEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+KL DGE+Y++  E D++ IV
Sbjct: 60  KVGDRIIFSKYAGTEVKL-DGEDYVIFSERDVLAIV 94


>gi|193215323|ref|YP_001996522.1| co-chaperonin GroES [Chloroherpeton thalassium ATCC 35110]
 gi|226701738|sp|B3QSM8|CH10_CHLT3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|193088800|gb|ACF14075.1| chaperonin Cpn10 [Chloroherpeton thalassium ATCC 35110]
          Length = 95

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G + IPD+  EKP    GE++ VG G    +G V+  EV
Sbjct: 3   LKPLADRVIVKPSPAEEKT-KGGLYIPDSGKEKPQ--HGEVVAVGPGKAADNGTVVAMEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  VL+GK+SGTE+ + DGE+YL+M+ESDI  I+
Sbjct: 60  QVGQKVLYGKYSGTEVTV-DGEDYLIMRESDIFAII 94


>gi|50843233|ref|YP_056460.1| 10 kDa chaperonin [Propionibacterium acnes KPA171202]
 gi|282855117|ref|ZP_06264449.1| chaperonin GroS [Propionibacterium acnes J139]
 gi|289424865|ref|ZP_06426644.1| chaperonin GroS [Propionibacterium acnes SK187]
 gi|289427604|ref|ZP_06429316.1| chaperonin GroS [Propionibacterium acnes J165]
 gi|295131300|ref|YP_003581963.1| chaperonin GroS [Propionibacterium acnes SK137]
 gi|81692401|sp|Q6A6W1|CH10_PROAC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|50840835|gb|AAT83502.1| 10 kDa chaperonin [Propionibacterium acnes KPA171202]
 gi|282581705|gb|EFB87090.1| chaperonin GroS [Propionibacterium acnes J139]
 gi|289154564|gb|EFD03250.1| chaperonin GroS [Propionibacterium acnes SK187]
 gi|289159095|gb|EFD07287.1| chaperonin GroS [Propionibacterium acnes J165]
 gi|291375194|gb|ADD99048.1| chaperonin GroS [Propionibacterium acnes SK137]
 gi|313763147|gb|EFS34511.1| chaperonin GroS [Propionibacterium acnes HL013PA1]
 gi|313773185|gb|EFS39151.1| chaperonin GroS [Propionibacterium acnes HL074PA1]
 gi|313793348|gb|EFS41406.1| chaperonin GroS [Propionibacterium acnes HL110PA1]
 gi|313801009|gb|EFS42277.1| chaperonin GroS [Propionibacterium acnes HL110PA2]
 gi|313808749|gb|EFS47203.1| chaperonin GroS [Propionibacterium acnes HL087PA2]
 gi|313810457|gb|EFS48171.1| chaperonin GroS [Propionibacterium acnes HL083PA1]
 gi|313812208|gb|EFS49922.1| chaperonin GroS [Propionibacterium acnes HL025PA1]
 gi|313816486|gb|EFS54200.1| chaperonin GroS [Propionibacterium acnes HL059PA1]
 gi|313817930|gb|EFS55644.1| chaperonin GroS [Propionibacterium acnes HL046PA2]
 gi|313819841|gb|EFS57555.1| chaperonin GroS [Propionibacterium acnes HL036PA1]
 gi|313823332|gb|EFS61046.1| chaperonin GroS [Propionibacterium acnes HL036PA2]
 gi|313824806|gb|EFS62520.1| chaperonin GroS [Propionibacterium acnes HL063PA1]
 gi|313828349|gb|EFS66063.1| chaperonin GroS [Propionibacterium acnes HL063PA2]
 gi|313830045|gb|EFS67759.1| chaperonin GroS [Propionibacterium acnes HL007PA1]
 gi|313832681|gb|EFS70395.1| chaperonin GroS [Propionibacterium acnes HL056PA1]
 gi|313838038|gb|EFS75752.1| chaperonin GroS [Propionibacterium acnes HL086PA1]
 gi|314914423|gb|EFS78254.1| chaperonin GroS [Propionibacterium acnes HL005PA4]
 gi|314917746|gb|EFS81577.1| chaperonin GroS [Propionibacterium acnes HL050PA1]
 gi|314919527|gb|EFS83358.1| chaperonin GroS [Propionibacterium acnes HL050PA3]
 gi|314924094|gb|EFS87925.1| chaperonin GroS [Propionibacterium acnes HL001PA1]
 gi|314925835|gb|EFS89666.1| chaperonin GroS [Propionibacterium acnes HL036PA3]
 gi|314930118|gb|EFS93949.1| chaperonin GroS [Propionibacterium acnes HL067PA1]
 gi|314957139|gb|EFT01243.1| chaperonin GroS [Propionibacterium acnes HL027PA1]
 gi|314957745|gb|EFT01848.1| chaperonin GroS [Propionibacterium acnes HL002PA1]
 gi|314960779|gb|EFT04880.1| chaperonin GroS [Propionibacterium acnes HL002PA2]
 gi|314963453|gb|EFT07553.1| chaperonin GroS [Propionibacterium acnes HL082PA1]
 gi|314964933|gb|EFT09032.1| chaperonin GroS [Propionibacterium acnes HL082PA2]
 gi|314969964|gb|EFT14062.1| chaperonin GroS [Propionibacterium acnes HL037PA1]
 gi|314973105|gb|EFT17201.1| chaperonin GroS [Propionibacterium acnes HL053PA1]
 gi|314975601|gb|EFT19696.1| chaperonin GroS [Propionibacterium acnes HL045PA1]
 gi|314979822|gb|EFT23916.1| chaperonin GroS [Propionibacterium acnes HL072PA2]
 gi|314982215|gb|EFT26308.1| chaperonin GroS [Propionibacterium acnes HL110PA3]
 gi|314984885|gb|EFT28977.1| chaperonin GroS [Propionibacterium acnes HL005PA1]
 gi|314986144|gb|EFT30236.1| chaperonin GroS [Propionibacterium acnes HL005PA2]
 gi|314988757|gb|EFT32848.1| chaperonin GroS [Propionibacterium acnes HL005PA3]
 gi|315077182|gb|EFT49247.1| chaperonin GroS [Propionibacterium acnes HL053PA2]
 gi|315079982|gb|EFT51958.1| chaperonin GroS [Propionibacterium acnes HL078PA1]
 gi|315083309|gb|EFT55285.1| chaperonin GroS [Propionibacterium acnes HL027PA2]
 gi|315086918|gb|EFT58894.1| chaperonin GroS [Propionibacterium acnes HL002PA3]
 gi|315090009|gb|EFT61985.1| chaperonin GroS [Propionibacterium acnes HL072PA1]
 gi|315090530|gb|EFT62506.1| chaperonin GroS [Propionibacterium acnes HL110PA4]
 gi|315093766|gb|EFT65742.1| chaperonin GroS [Propionibacterium acnes HL060PA1]
 gi|315096669|gb|EFT68645.1| chaperonin GroS [Propionibacterium acnes HL038PA1]
 gi|315097896|gb|EFT69872.1| chaperonin GroS [Propionibacterium acnes HL059PA2]
 gi|315100661|gb|EFT72637.1| chaperonin GroS [Propionibacterium acnes HL046PA1]
 gi|315103951|gb|EFT75927.1| chaperonin GroS [Propionibacterium acnes HL050PA2]
 gi|315106104|gb|EFT78080.1| chaperonin GroS [Propionibacterium acnes HL030PA1]
 gi|315109141|gb|EFT81117.1| chaperonin GroS [Propionibacterium acnes HL030PA2]
 gi|327325084|gb|EGE66890.1| chaperonin GroS [Propionibacterium acnes HL096PA3]
 gi|327325289|gb|EGE67094.1| chaperonin GroS [Propionibacterium acnes HL096PA2]
 gi|327325586|gb|EGE67385.1| chaperonin GroS [Propionibacterium acnes HL103PA1]
 gi|327332304|gb|EGE74040.1| chaperonin GroS [Propionibacterium acnes HL097PA1]
 gi|327444091|gb|EGE90745.1| chaperonin GroS [Propionibacterium acnes HL043PA1]
 gi|327449283|gb|EGE95937.1| chaperonin GroS [Propionibacterium acnes HL013PA2]
 gi|327449489|gb|EGE96143.1| chaperonin GroS [Propionibacterium acnes HL043PA2]
 gi|327451512|gb|EGE98166.1| chaperonin GroS [Propionibacterium acnes HL087PA3]
 gi|327451515|gb|EGE98169.1| chaperonin GroS [Propionibacterium acnes HL092PA1]
 gi|327451797|gb|EGE98451.1| chaperonin GroS [Propionibacterium acnes HL083PA2]
 gi|328752013|gb|EGF65629.1| chaperonin GroS [Propionibacterium acnes HL087PA1]
 gi|328755454|gb|EGF69070.1| chaperonin GroS [Propionibacterium acnes HL025PA2]
 gi|328756372|gb|EGF69988.1| chaperonin GroS [Propionibacterium acnes HL020PA1]
 gi|328761294|gb|EGF74821.1| chaperonin GroS [Propionibacterium acnes HL099PA1]
 gi|332676173|gb|AEE72989.1| 10 kDa chaperonin [Propionibacterium acnes 266]
          Length = 98

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ L++E  TA+G ++IPDT  EKP    G+++  G G +D  G  +  +V
Sbjct: 5   IKPLEDRVLVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVISAGPGRVDDKGTRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V+F K+ GTE+K  DG+EYL++   DI+ +V
Sbjct: 62  KEGDVVIFSKYGGTEVKY-DGQEYLLLNARDILAVV 96


>gi|86606076|ref|YP_474839.1| co-chaperonin GroES [Synechococcus sp. JA-3-3Ab]
 gi|123751804|sp|Q2JUN8|CH10_SYNJA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|86554618|gb|ABC99576.1| chaperonin, 10 kDa [Synechococcus sp. JA-3-3Ab]
          Length = 103

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+  Q + KTA G I +PDT  EKP    GE++ VG G  +  GK+I  E+
Sbjct: 11  LKPLGDRVLVKIAQQDEKTA-GGIFLPDTAKEKPQV--GEVVAVGPGKRNDEGKLIPMEL 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GTE+KL   +EY+++ E DI+ IV
Sbjct: 68  KAGDRVLYSKYAGTEVKLG-SDEYVLLAERDILAIV 102


>gi|91203321|emb|CAJ72960.1| strongly similar to 10 kDa chaperonin (GroES protein) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 96

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ +++E KT  G I++P+T  EKP    G+I+ VG G + ++GK  +  V
Sbjct: 4   IKPLDDRVVVQPMEAEEKT-KGGIVLPETAKEKPI--KGKIIAVGEGKLLENGKRADLLV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+GK++GTE+ + DG+EYL+M+ESDI+  V
Sbjct: 61  KVGDVVLYGKYAGTEVTV-DGKEYLIMRESDILAKV 95


>gi|257054536|ref|YP_003132368.1| Co-chaperonin GroES [Saccharomonospora viridis DSM 43017]
 gi|256584408|gb|ACU95541.1| Co-chaperonin GroES [Saccharomonospora viridis DSM 43017]
          Length = 97

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+  ++E  TA+G ++IPDT  EKP    G+++ VG G +D  G  I  +V
Sbjct: 5   IKPLEDRIVVQTSEAEETTASG-LVIPDTAKEKPQ--EGKVLAVGPGRIDDKGNRIPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V++ K+ GTE+K N GEEYL++   D++ +V
Sbjct: 62  KVGDVVIYSKYGGTEVKYN-GEEYLILSARDVLAVV 96


>gi|313836123|gb|EFS73837.1| chaperonin GroS [Propionibacterium acnes HL037PA2]
 gi|314970566|gb|EFT14664.1| chaperonin GroS [Propionibacterium acnes HL037PA3]
 gi|328906142|gb|EGG25917.1| 10 kDa chaperonin [Propionibacterium sp. P08]
          Length = 98

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ L++E  TA+G ++IPDT  EKP    G+++  G G +D  G  +  +V
Sbjct: 5   IKPLEDRVLVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVISAGPGRVDDKGTRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V+F K+ GTE+K  DG+EYL++   DI+ +V
Sbjct: 62  KEGDVVIFSKYGGTEVKY-DGQEYLLLNARDILAVV 96


>gi|126696965|ref|YP_001091851.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9301]
 gi|157414038|ref|YP_001484904.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9215]
 gi|254526127|ref|ZP_05138179.1| chaperonin GroS [Prochlorococcus marinus str. MIT 9202]
 gi|166198393|sp|A3PES5|CH10_PROM0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|167008683|sp|A8G6T7|CH10_PROM2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|126544008|gb|ABO18250.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. MIT
           9301]
 gi|157388613|gb|ABV51318.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. MIT
           9215]
 gi|221537551|gb|EEE40004.1| chaperonin GroS [Prochlorococcus marinus str. MIT 9202]
          Length = 103

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++   SE KTA G IL+PD+  EKP    GE+  VG G ++  G    PEV
Sbjct: 11  VKPLGDRIFIKVSASEEKTA-GGILLPDSAKEKPQV--GEVAQVGPGKLNDDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|195953234|ref|YP_002121524.1| chaperonin Cpn10 [Hydrogenobaculum sp. Y04AAS1]
 gi|226701776|sp|B4U8T5|CH10_HYDS0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|195932846|gb|ACG57546.1| chaperonin Cpn10 [Hydrogenobaculum sp. Y04AAS1]
          Length = 96

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   ++VV+R++ + +     I+IPDT  EKP    GE++ VG G +  +G++    V
Sbjct: 3   LKPIYDKIVVKRMEEKEQKTPSGIIIPDTAKEKPQV--GEVIAVGNGKVLNNGEIRPLAV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VLF K++GTE++L DGE+YLVM E +++ I+
Sbjct: 61  NVGDKVLFNKYAGTEVEL-DGEKYLVMAEDEVLAII 95


>gi|78779914|ref|YP_398026.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9312]
 gi|123755046|sp|Q318V5|CH10_PROM9 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78713413|gb|ABB50590.1| groES protein [Prochlorococcus marinus str. MIT 9312]
          Length = 103

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++   SE KTA G IL+PD+  EKP    GE+  VG G ++  G    PEV
Sbjct: 11  VKPLGDRIFIKVSASEEKTA-GGILLPDSAKEKPQV--GEVAQVGPGKLNDDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|90020530|ref|YP_526357.1| Bvg accessory factor [Saccharophagus degradans 2-40]
 gi|89950130|gb|ABD80145.1| chaperonin Cpn10 [Saccharophagus degradans 2-40]
          Length = 96

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 64/96 (66%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E  TA+G I++P +  EKP+   GE++ +G+G +  SG V   +V
Sbjct: 3   IRPLHDRVVVRRKEEEATTASG-IVLPGSAKEKPN--QGEVIAIGSGRVLDSGDVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V+FGK++G++    DGEE +++ ESDI  IV
Sbjct: 60  KVGDVVVFGKYAGSDTIEVDGEELVILSESDIKAIV 95


>gi|314929658|gb|EFS93489.1| chaperonin GroS [Propionibacterium acnes HL044PA1]
          Length = 98

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ L++E  TA+G ++IPDT  EKP    G+++  G G +D  G  +  +V
Sbjct: 5   IKPLEDRVLVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVISAGPGRVDDKGTRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V+F K+ GTE+K  DG+EYL++   DI+ +V
Sbjct: 62  KEGDVVIFSKYGGTEVKY-DGQEYLLLNARDILAVV 96


>gi|327438496|dbj|BAK14861.1| co-chaperonin GroES [Solibacillus silvestris StLB046]
          Length = 94

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R+++  ++ E KTA G I++PD+  EKP   +G+++ VG G +  +G  +E +V
Sbjct: 2   LRPLGDRIIIELVEVEEKTAFG-IVLPDSAKEKPQ--TGKVVAVGTGRVLDNGTRLELDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K+SGTE+K  DG EYL+++ESD++ IV
Sbjct: 59  KEGDEIIFSKFSGTEVKY-DGVEYLILRESDVLAIV 93


>gi|254426866|ref|ZP_05040573.1| chaperonin GroS [Alcanivorax sp. DG881]
 gi|196193035|gb|EDX87994.1| chaperonin GroS [Alcanivorax sp. DG881]
          Length = 96

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+VRR + E KTA G I++P + +EKPS   GE++ VG G + ++G V   +V
Sbjct: 3   IRPLHDRVLVRREEEETKTA-GGIVLPGSAAEKPS--RGEVIAVGNGKITENGDVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+ +K+ +GEE L+M E++I+ +V
Sbjct: 60  KAGDKVIFGQYAGSTVKV-EGEELLIMSEAEILAVV 94


>gi|118444966|ref|YP_878934.1| co-chaperonin GroES [Clostridium novyi NT]
 gi|168186044|ref|ZP_02620679.1| chaperonin GroS [Clostridium botulinum C str. Eklund]
 gi|166233998|sp|A0Q2T2|CH10_CLONN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118135422|gb|ABK62466.1| chaperonin, 10 kDa [Clostridium novyi NT]
 gi|169296076|gb|EDS78209.1| chaperonin GroS [Clostridium botulinum C str. Eklund]
          Length = 94

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++RL++E KT +G I++P +  EKP  +  EI+ VG G +   GK +  EV
Sbjct: 3   IKPLGDRVVIKRLEAEEKTKSG-IVLPGSAKEKPQEA--EIVAVGPGGL-VDGKEVRMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K+SGTE+KL DGEEY +++++DI+ IV
Sbjct: 59  KVGDKVLFSKYSGTEVKL-DGEEYTILRQNDILAIV 93


>gi|305666321|ref|YP_003862608.1| co-chaperonin GroES [Maribacter sp. HTCC2170]
 gi|88708313|gb|EAR00550.1| co-chaperonin GroES [Maribacter sp. HTCC2170]
          Length = 92

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G I IPDT  EKP    G+++ VG G  D+     +  V
Sbjct: 6   IKPLADRVLIEPMAAETKTASG-IYIPDTAKEKPQ--KGKVVAVGPGTKDE-----QVTV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G +YL+M+ESDI+ I+
Sbjct: 58  KVGDTVLYGKYAGTELKL-EGTDYLMMRESDILAII 92


>gi|319654651|ref|ZP_08008732.1| chaperonin [Bacillus sp. 2_A_57_CT2]
 gi|317393717|gb|EFV74474.1| chaperonin [Bacillus sp. 2_A_57_CT2]
          Length = 94

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 70/96 (72%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+++  +++E KTA+G I++PDT  EKP    G+++ VG G + ++G+ +  EV
Sbjct: 2   LKPLGDRIIIELVETEEKTASG-IVLPDTAKEKPQ--EGKVVAVGTGRVLENGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K++GTE+K  +G+EYL+++E+DI+ ++
Sbjct: 59  ADGDRIIFSKYAGTEVKY-EGKEYLILRENDILAVI 93


>gi|332184651|gb|AEE26905.1| Heat shock protein 60 family co-chaperone GroES [Francisella cf.
           novicida 3523]
          Length = 95

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (64%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+VRR + E K+A G I++  +  EKPS   GE++ VG G    +G  +  +V
Sbjct: 3   IRPLQDRVLVRRAEEETKSA-GGIILTGSAQEKPS--QGEVVAVGNGKKLDNGSTLPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGK+SG+E+K  D E  L+M+E DIMGI+ 
Sbjct: 60  KVGDKVLFGKYSGSEVKAGD-ETLLMMREEDIMGIIA 95


>gi|148658219|ref|YP_001278424.1| chaperonin Cpn10 [Roseiflexus sp. RS-1]
 gi|148570329|gb|ABQ92474.1| chaperonin Cpn10 [Roseiflexus sp. RS-1]
          Length = 101

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 62/98 (63%), Gaps = 3/98 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ ++ E KT  G I +PDT S K     G ++ VG G +D +GK I   V
Sbjct: 7   IRPLADRVVVKPVEREEKTK-GGIYLPDTAS-KERPMEGTVLAVGEGRIDDNGKRIPMNV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD V+F K+SGTE K++D  EYL++ E DI+GI+ E
Sbjct: 65  KPGDRVIFAKYSGTEFKVDD-VEYLILSEKDILGIIQE 101


>gi|320533702|ref|ZP_08034321.1| chaperonin GroS [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134097|gb|EFW26426.1| chaperonin GroS [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 98

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPDT  EKP    G+++ VG G +D SGK +  +V
Sbjct: 5   IKPLEDRIVVQTVEAEQTTASG-LVIPDTAKEKPQ--EGKVVAVGPGRVDDSGKRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V++ K+ GTE+    GE+YL++   D++ +V
Sbjct: 62  AEGDVVIYSKYGGTEVSYA-GEDYLILSARDVLAVV 96


>gi|288574619|ref|ZP_06392976.1| chaperonin Cpn10 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570360|gb|EFC91917.1| chaperonin Cpn10 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 96

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ + SE KT  G + +PDT  EKP    GE+M VG+G + ++G+ +  E+
Sbjct: 3   LKPLADRIVVKVVTSEEKT-KGGLFLPDTAKEKPQ--EGEVMAVGSGKVLENGQKLPIEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K+ DG+EY++  E D++ ++
Sbjct: 60  KVGDRIIFSKYAGTEVKI-DGDEYVIFSERDVLAVI 94


>gi|260887964|ref|ZP_05899227.1| chaperonin GroS [Selenomonas sputigena ATCC 35185]
 gi|330838552|ref|YP_004413132.1| Chaperonin Cpn10 [Selenomonas sputigena ATCC 35185]
 gi|260862317|gb|EEX76817.1| chaperonin GroS [Selenomonas sputigena ATCC 35185]
 gi|329746316|gb|AEB99672.1| Chaperonin Cpn10 [Selenomonas sputigena ATCC 35185]
          Length = 93

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++  + ++KTA+G I++PDT  EKP    GE++ VG G M  +G   + EV
Sbjct: 2   IRPLGDRVVIKVSEGDMKTASG-IVLPDTAKEKPQ--EGEVVAVGTGKMLDNGTRAQMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SG+E+K+ D + YL+++ESDI+ ++
Sbjct: 59  KTGDKVIFSKYSGSEVKV-DEQNYLIVRESDILAVL 93


>gi|302388862|ref|YP_003824683.1| Chaperonin Cpn10 [Thermosediminibacter oceani DSM 16646]
 gi|302199490|gb|ADL07060.1| Chaperonin Cpn10 [Thermosediminibacter oceani DSM 16646]
          Length = 94

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           +RP   R+V++ L+ E KT  G I++PDT  EKP    GE++ VG G ++D  GK +  E
Sbjct: 3   IRPLGDRIVIKVLEKEEKTK-GGIVLPDTAKEKPQ--KGEVIAVGTGEIID--GKRVPLE 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD ++F K++GTE+K +D EEYL++++SD++ I+
Sbjct: 58  VKVGDKIIFSKYAGTEVKFDD-EEYLILRQSDVLAII 93


>gi|289435419|ref|YP_003465291.1| chaperone protein GroES [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171663|emb|CBH28209.1| chaperone protein GroES [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|313632430|gb|EFR99453.1| chaperonin GroS [Listeria seeligeri FSL N1-067]
 gi|313636964|gb|EFS02551.1| chaperonin GroS [Listeria seeligeri FSL S4-171]
          Length = 94

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G + ++G     EV
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIIAVGSGRILENGTKEPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
            +GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 59  VEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|205372359|ref|ZP_03225173.1| co-chaperonin GroES [Bacillus coahuilensis m4-4]
          Length = 95

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+++ VG G +  +G+ +  EV
Sbjct: 2   LKPLGDRVVIELVESEEKTASG-IVLPDSAKEKPQ--EGKVVAVGTGKVLDNGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           S GD ++F K++GTE+K   G EYL++++SDI+ ++ E
Sbjct: 59  SVGDKIIFSKYAGTEVKYQ-GAEYLILRDSDILAVIGE 95


>gi|157803504|ref|YP_001492053.1| co-chaperonin GroES [Rickettsia canadensis str. McKiel]
 gi|166198405|sp|A8EY35|CH10_RICCK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|157784767|gb|ABV73268.1| co-chaperonin GroES [Rickettsia canadensis str. McKiel]
          Length = 95

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R+ ++ ++ E KT  G I+IPDT  EKP    G I  VG G  ++ G+V   E+
Sbjct: 3   FKPLHDRIAIKPIEHEEKTK-GGIIIPDTAKEKPM--QGIITAVGTGTRNEKGEVYPLEL 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GKW+GTEI++  GE+ +VM+E+D++GI+
Sbjct: 60  KVGDKVLYGKWAGTEIEIK-GEKLIVMKENDVLGII 94


>gi|315304152|ref|ZP_07874533.1| chaperonin GroS [Listeria ivanovii FSL F6-596]
 gi|313627477|gb|EFR96229.1| chaperonin GroS [Listeria ivanovii FSL F6-596]
          Length = 94

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (70%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G + ++G     EV
Sbjct: 2   LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIIAVGSGRVLENGTKEPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
            +GD V+F K+SGTE+   +G +YL+++ESDI+ I
Sbjct: 59  VEGDTVIFAKYSGTEVTY-EGTDYLILRESDILAI 92


>gi|444100|prf||1906220A groES gene
          Length = 94

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE K A+G I++PD+  EKP    G+I+  G+G + +SG+ +  EV
Sbjct: 2   LKPLGDRVVIELVESEEKYASG-IVLPDSAKEKPQ--EGKIVAAGSGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 59  KEGDRIIFSKYAGTEVKY-EGTEYLILRESDILAVI 93


>gi|239929446|ref|ZP_04686399.1| co-chaperonin GroES [Streptomyces ghanaensis ATCC 14672]
 gi|291437772|ref|ZP_06577162.1| heat shock protein 18 [Streptomyces ghanaensis ATCC 14672]
 gi|291340667|gb|EFE67623.1| heat shock protein 18 [Streptomyces ghanaensis ATCC 14672]
          Length = 102

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ +G G + + GK +E
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAIGPGRV-EDGKRVE 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD+VL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 63  LDVKVGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|297622056|ref|YP_003710193.1| Co-chaperonin GroES [Waddlia chondrophila WSU 86-1044]
 gi|297377357|gb|ADI39187.1| Co-chaperonin GroES [Waddlia chondrophila WSU 86-1044]
          Length = 103

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 66/102 (64%), Gaps = 7/102 (6%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   RV+++R ++E  T+ G IL+PD+  EKP    G ++ VG G +D++G +  
Sbjct: 4   KMKIKPLGNRVLIKRSKAE--TSKGGILLPDSAQEKPK--QGTVLAVGPGKLDENGTMEA 59

Query: 66  PEVSKGDIVLFGKWSGTEIK---LNDGEEYLVMQESDIMGIV 104
             V++GD VLF  ++GTE+K    N  +EYL++ + DI+GI+
Sbjct: 60  MHVAEGDCVLFSSYAGTEVKDVDENSEDEYLILSQEDILGIL 101


>gi|116071283|ref|ZP_01468552.1| co-chaperonin GroES [Synechococcus sp. BL107]
 gi|116066688|gb|EAU72445.1| co-chaperonin GroES [Synechococcus sp. BL107]
          Length = 103

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  ++ G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKSNEDGSRQSPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ IV
Sbjct: 68  GIGDKVLYSKYAGTDIKLGS-DEYVLLSEKDILAIV 102


>gi|37522465|ref|NP_925842.1| co-chaperonin GroES [Gloeobacter violaceus PCC 7421]
 gi|35213466|dbj|BAC90837.1| chaperonin GroES [Gloeobacter violaceus PCC 7421]
          Length = 103

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (62%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+ L  E KTA G IL+PDT  EKP    GE+  VG G +   G  +  EV
Sbjct: 11  LKPLGDRVLVKVLAQEEKTA-GGILLPDTAKEKPQV--GEVTAVGEGRITDKGDRLPLEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VL+ K++GTE+K+  GEEY+++ E DI+ I +
Sbjct: 68  KVGDKVLYAKYAGTELKVA-GEEYILLAEKDILAITL 103


>gi|148240335|ref|YP_001225722.1| co-chaperonin GroES [Synechococcus sp. WH 7803]
 gi|166198419|sp|A5GNB0|CH10_SYNPW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|147848874|emb|CAK24425.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Synechococcus
           sp. WH 7803]
          Length = 103

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  ++ G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKANEDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLGS-DEYVLLSEKDILAVV 102


>gi|116206|sp|P26210|CH10_BACP3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock 12 kDa protein; AltName:
           Full=Protein Cpn10
 gi|321652|pir||JC1479 heat shock protein TGroES - thermophilic bacterium PS-3
 gi|299325|gb|AAB25914.1| TGroES [Bacillus sp. PS3]
          Length = 94

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+V+  +++E KTA+G I++PDT  EKP    G ++ VGAG +  +G+ I  + 
Sbjct: 2   LKPLGDRIVIEVVETEEKTASG-IVLPDTAKEKPQ--EGRVVAVGAGRVLDNGQRIGRKS 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+K  DG+EYL+++ESDI+ ++
Sbjct: 59  KVGDRVIFSKYAGTEVKY-DGKEYLILRESDILAVI 93


>gi|256390212|ref|YP_003111776.1| chaperonin Cpn10 [Catenulispora acidiphila DSM 44928]
 gi|256356438|gb|ACU69935.1| chaperonin Cpn10 [Catenulispora acidiphila DSM 44928]
          Length = 98

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + GK +E +V
Sbjct: 6   IKPLEDRVVVKPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRW-EDGKRVELDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GDIVL+ K+ GTE+K N+ EEYLV+   D++ IV
Sbjct: 62  KEGDIVLYSKYGGTEVKYNN-EEYLVLSARDLLAIV 96


>gi|84497902|ref|ZP_00996699.1| co-chaperonin GroES [Janibacter sp. HTCC2649]
 gi|84381402|gb|EAP97285.1| co-chaperonin GroES [Janibacter sp. HTCC2649]
          Length = 97

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++ L++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIKSLEAEQTTASG-LVIPDTAKEKPQ--EGEVLAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K + GEE+L++   D++ IV
Sbjct: 62  NVGDKVIYSKYGGTEVK-HGGEEFLILSARDVLAIV 96


>gi|226310112|ref|YP_002770006.1| 10 kDa chaperonin [Brevibacillus brevis NBRC 100599]
 gi|254813829|sp|C0ZK51|CH10_BREBN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226093060|dbj|BAH41502.1| 10 kDa chaperonin [Brevibacillus brevis NBRC 100599]
          Length = 94

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +  +  TA+G I++PD+  EKP    G ++ VG+G +  +G+ I  EV
Sbjct: 2   LKPLGDRVVIEAISKDETTASG-IVLPDSAKEKPQ--EGRVIAVGSGRVADNGERIALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+K+ D  EYLV++ESDI+ I+
Sbjct: 59  KEGDKVIFSKYAGTEVKV-DNNEYLVLRESDILAII 93


>gi|225010055|ref|ZP_03700527.1| chaperonin Cpn10 [Flavobacteria bacterium MS024-3C]
 gi|225005534|gb|EEG43484.1| chaperonin Cpn10 [Flavobacteria bacterium MS024-3C]
          Length = 92

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G I IPDT  EKP   +G+++ VG G  D+     +  V
Sbjct: 6   IKPLADRVLIAPMAAETKTASG-IYIPDTAKEKPQ--NGKVVAVGPGTKDE-----KMTV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G +Y++M+ESDI+ IV
Sbjct: 58  KVGDTVLYGKYAGTELKL-EGADYIMMRESDILAIV 92


>gi|118595282|ref|ZP_01552629.1| chaperonins cpn10 (10 kDa subunit) [Methylophilales bacterium
           HTCC2181]
 gi|118441060|gb|EAV47687.1| chaperonins cpn10 (10 kDa subunit) [Methylophilales bacterium
           HTCC2181]
          Length = 96

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +RP   RV+V+RL+ E  TA+G I+IP++ S EKP    G I  +G G + + G +   +
Sbjct: 3   IRPLHDRVIVKRLEEERTTASG-IVIPESASAEKP--DQGTIEAIGNGKVLEDGSIRALD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGK++G  +K+ DG+E LVM+E DIMGIV
Sbjct: 60  VKVGDKVLFGKYAGQAVKV-DGDELLVMREEDIMGIV 95


>gi|328953601|ref|YP_004370935.1| 10 kDa chaperonin [Desulfobacca acetoxidans DSM 11109]
 gi|328453925|gb|AEB09754.1| 10 kDa chaperonin [Desulfobacca acetoxidans DSM 11109]
          Length = 96

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 63/94 (67%), Gaps = 4/94 (4%)

Query: 11  PTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSK 70
           P   RV+V+R + E++   G I IPDT  EKP    G I+ VG+G +  +G+ +   V  
Sbjct: 5   PLNDRVLVKRTE-ELQVTKGGIYIPDTAKEKPI--EGRIIAVGSGKIADNGERVPLTVKP 61

Query: 71  GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GD VLFGK++GTEIK+ +GEE+L+M+E DI+ I+
Sbjct: 62  GDRVLFGKYAGTEIKV-EGEEHLMMREDDILAIL 94


>gi|56708704|ref|YP_170600.1| co-chaperonin GroES [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110671176|ref|YP_667733.1| co-chaperonin GroES [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118498108|ref|YP_899158.1| co-chaperonin GroES [Francisella tularensis subsp. novicida U112]
 gi|134301379|ref|YP_001121347.1| co-chaperonin GroES [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|187931106|ref|YP_001891090.1| co-chaperonin GroES [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|194323335|ref|ZP_03057119.1| chaperonin GroS [Francisella tularensis subsp. novicida FTE]
 gi|208779480|ref|ZP_03246825.1| chaperonin GroS [Francisella novicida FTG]
 gi|224457915|ref|ZP_03666388.1| co-chaperonin GroES [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254371333|ref|ZP_04987335.1| chaperone GroES [Francisella tularensis subsp. tularensis FSC033]
 gi|254373460|ref|ZP_04988948.1| chaperonin protein [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374920|ref|ZP_04990401.1| co-chaperonin GroES [Francisella novicida GA99-3548]
 gi|254875578|ref|ZP_05248288.1| co-chaperonin groES [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81597040|sp|Q5NEE2|CH10_FRATT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123359342|sp|Q14FU5|CH10_FRAT1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198371|sp|A0Q839|CH10_FRATN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198372|sp|A4IWC5|CH10_FRATW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701769|sp|B2SFF9|CH10_FRATM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|54114409|gb|AAV29838.1| NT02FT1539 [synthetic construct]
 gi|56605196|emb|CAG46328.1| Chaperonin protein, groES [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110321509|emb|CAL09711.1| Chaperonin protein, groES [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118424014|gb|ABK90404.1| co-chaperonin GroES (HSP10) [Francisella novicida U112]
 gi|134049156|gb|ABO46227.1| chaperonin GroS [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151569573|gb|EDN35227.1| chaperone GroES [Francisella tularensis subsp. tularensis FSC033]
 gi|151571186|gb|EDN36840.1| chaperonin protein [Francisella novicida GA99-3549]
 gi|151572639|gb|EDN38293.1| co-chaperonin GroES [Francisella novicida GA99-3548]
 gi|187712015|gb|ACD30312.1| co-chaperonin GroES (HSP10) [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194322699|gb|EDX20179.1| chaperonin GroS [Francisella tularensis subsp. novicida FTE]
 gi|208744441|gb|EDZ90740.1| chaperonin GroS [Francisella novicida FTG]
 gi|254841577|gb|EET20013.1| co-chaperonin groES [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159958|gb|ADA79349.1| co-chaperonin GroES [Francisella tularensis subsp. tularensis
           NE061598]
 gi|332678833|gb|AEE87962.1| Heat shock protein 60 family co-chaperone GroES [Francisella cf.
           novicida Fx1]
          Length = 95

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+VRR + E K+A G I++  +  EKPS   GE++ VG G    +G  +  +V
Sbjct: 3   IRPLQDRVLVRRAEEEKKSA-GGIILTGSAQEKPS--QGEVVAVGNGKKLDNGTTLPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG+E+K+ D E  L+M+E DIMGI+
Sbjct: 60  KVGDKVLFGKYSGSEVKVGD-ETLLMMREEDIMGII 94


>gi|308178051|ref|YP_003917457.1| co-chaperonin GroES [Arthrobacter arilaitensis Re117]
 gi|307745514|emb|CBT76486.1| co-chaperonin GroES [Arthrobacter arilaitensis Re117]
          Length = 98

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++   TA+G ++IPD+  EKP    G ++ VG G +D +G  I  +V
Sbjct: 5   IKPLEDRIVIKQVEAVTTTASG-LVIPDSAKEKPQ--EGTVVAVGPGRIDDNGNRIPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           ++GD+VL+ K+ GTE+K+ + EEYLV+   D++ +VV+
Sbjct: 62  AEGDVVLYSKYGGTEVKVGN-EEYLVLSARDVLAVVVK 98


>gi|52079059|ref|YP_077850.1| co-chaperonin GroES [Bacillus licheniformis ATCC 14580]
 gi|52784429|ref|YP_090258.1| co-chaperonin GroES [Bacillus licheniformis ATCC 14580]
 gi|319648638|ref|ZP_08002850.1| chaperonin [Bacillus sp. BT1B_CT2]
 gi|81691183|sp|Q65MZ9|CH10_BACLD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|52002270|gb|AAU22212.1| class I heat-shock protein (chaperonin) [Bacillus licheniformis
           ATCC 14580]
 gi|52346931|gb|AAU39565.1| GroES [Bacillus licheniformis ATCC 14580]
 gi|317389286|gb|EFV70101.1| chaperonin [Bacillus sp. BT1B_CT2]
          Length = 94

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  ++SE KTA+G I++PD+  EKP    G+++  G+G + +SG+ +  EV
Sbjct: 2   LKPLGDRVVIELVESEEKTASG-IVLPDSAKEKPQ--EGKVVAAGSGRVLESGERVALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+K  +G +YL+++ESDI+ ++
Sbjct: 59  KTGDRIIFSKYAGTEVKY-EGTDYLILRESDILAVI 93


>gi|146329116|ref|YP_001210206.1| co-chaperonin GroES [Dichelobacter nodosus VCS1703A]
 gi|166234001|sp|A5EX18|CH10_DICNV RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|146232586|gb|ABQ13564.1| co-chaperonin GroES [Dichelobacter nodosus VCS1703A]
          Length = 95

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R Q E K + G I++P + +EKPS   GE++ VG G + ++G+  +  V
Sbjct: 3   LRPLHDRVIVKR-QEEEKVSAGGIVLPGSAAEKPS--QGEVIAVGEGKLLENGERRKMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LFGK++G+E+K+ DG +Y++M+E +I  ++
Sbjct: 60  KAGDKILFGKYTGSEVKV-DGVDYIIMREDEIFAVI 94


>gi|254431631|ref|ZP_05045334.1| chaperonin GroS [Cyanobium sp. PCC 7001]
 gi|197626084|gb|EDY38643.1| chaperonin GroS [Cyanobium sp. PCC 7001]
          Length = 103

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  +SE KTA G IL+PDT  EKP    GE++ VG G  ++ G    PEV
Sbjct: 11  VKPLGDRIFIKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNEDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLGT-DEYVLLSEKDILAVV 102


>gi|294101582|ref|YP_003553440.1| chaperonin Cpn10 [Aminobacterium colombiense DSM 12261]
 gi|293616562|gb|ADE56716.1| chaperonin Cpn10 [Aminobacterium colombiense DSM 12261]
          Length = 96

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ +  E KT  G I++PDT  EKP    GE++ VG G + ++G+ +  EV
Sbjct: 3   LKPLGDRLVVKVINQEEKT-RGGIVLPDTAKEKPQ--EGEVVAVGTGKVLENGQKLPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K++GTE+KL DG+EY++  E D++ IV
Sbjct: 60  KVGDRIIFSKYAGTEVKL-DGDEYIIFSERDVLAIV 94


>gi|282890564|ref|ZP_06299087.1| Co-chaperonin GroES [Parachlamydia acanthamoebae str. Hall's
           coccus]
 gi|281499561|gb|EFB41857.1| Co-chaperonin GroES [Parachlamydia acanthamoebae str. Hall's
           coccus]
          Length = 109

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           + KN L+P   RV+VRRL++E K   G I++PDT  +K      E++ +G G  D+ G +
Sbjct: 11  QAKNTLKPLGDRVLVRRLEAEEKL-KGGIILPDTAKKK--QEQAEVVAIGTGKKDKDGNL 67

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           I P V  GDIVL  K+SG E+ L D +EY++++  D++ I+
Sbjct: 68  IPPPVKIGDIVLMEKYSGQEVTLGD-QEYVIVRGDDLIAII 107


>gi|325954198|ref|YP_004237858.1| 10 kDa chaperonin [Weeksella virosa DSM 16922]
 gi|323436816|gb|ADX67280.1| 10 kDa chaperonin [Weeksella virosa DSM 16922]
          Length = 92

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+    +E KTA+G I+IPD+  EKP    G ++ VG G  D+     +  V
Sbjct: 6   IKPLADRVVIEPSPAETKTASG-IIIPDSAKEKPQ--EGTVVAVGNGKKDE-----QMTV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VL+GK+SGTE+KL DG++YL+M+E+DI+ I+
Sbjct: 58  AVGDKVLYGKYSGTELKL-DGKDYLIMREADILAII 92


>gi|317969007|ref|ZP_07970397.1| co-chaperonin GroES [Synechococcus sp. CB0205]
          Length = 103

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRIFIKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  SVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|325285682|ref|YP_004261472.1| 10 kDa chaperonin [Cellulophaga lytica DSM 7489]
 gi|324321136|gb|ADY28601.1| 10 kDa chaperonin [Cellulophaga lytica DSM 7489]
          Length = 92

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G ++IPDT  EKP    G+++ VG G  D+     +  V
Sbjct: 6   IKPLADRVLIEPMAAETKTASG-LIIPDTAKEKPQ--QGKVVAVGPGTKDE-----KITV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G +YL+M+ESDI+ I+
Sbjct: 58  KIGDTVLYGKYAGTELKL-EGSDYLMMRESDILAII 92


>gi|119717869|ref|YP_924834.1| co-chaperonin GroES [Nocardioides sp. JS614]
 gi|166198389|sp|A1SMW2|CH10_NOCSJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|119538530|gb|ABL83147.1| chaperonin Cpn10 [Nocardioides sp. JS614]
          Length = 97

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    GE++ +G G +D +G  +  +V
Sbjct: 5   IKPLEDRIVVKPLDAEQTTASG-LVIPDTAKEKPQ--EGEVLAIGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K   GEEYL++   D++ +V
Sbjct: 62  TVGDKVIYSKYGGTEVKYA-GEEYLILSARDVLAVV 96


>gi|320162067|ref|YP_004175292.1| 10 kDa chaperonin [Anaerolinea thermophila UNI-1]
 gi|319995921|dbj|BAJ64692.1| 10 kDa chaperonin [Anaerolinea thermophila UNI-1]
          Length = 97

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVVV  ++SE     G I++P+T  EKP    G+++ VG G  D  G  I  +V
Sbjct: 5   LKPLGSRVVVEPIESE-DVTPGGIVLPETAKEKPQ--KGKVLSVGPGDRDDKGNRISMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLF K++GTEIK+ DG++ L+++ESD++ IV
Sbjct: 62  KVGDVVLFAKYAGTEIKV-DGKKLLILRESDLLAIV 96


>gi|167629510|ref|YP_001680009.1| chaperonin groes [Heliobacterium modesticaldum Ice1]
 gi|226701772|sp|B0TC99|CH10_HELMI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|167592250|gb|ABZ83998.1| chaperonin groes [Heliobacterium modesticaldum Ice1]
          Length = 94

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 65/94 (69%), Gaps = 4/94 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++ +++E KTA G I++PDT  EKP    GE++ VG G +  +G+    EV
Sbjct: 3   IKPLADRVVLKPIEAEEKTAFG-IIVPDTAKEKPQ--QGEVVAVGIGRLLDNGERAALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
           + GD V++ K+SGTEIK+ +G+EYL++ E DI+ 
Sbjct: 60  AVGDRVIYSKYSGTEIKI-EGKEYLILNERDILA 92


>gi|296268606|ref|YP_003651238.1| chaperonin Cpn10 [Thermobispora bispora DSM 43833]
 gi|296091393|gb|ADG87345.1| chaperonin Cpn10 [Thermobispora bispora DSM 43833]
          Length = 104

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   R+VV+ L++E  TA+G ++IPDT  EKP    G+++ VG G  D+ G K I  +
Sbjct: 10  IKPLGDRIVVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVLAVGPGNWDEDGEKRIPLD 66

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V +GDIVL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 67  VKEGDIVLYSKYGGTEVKFG-GEEYLVLSSRDVLAII 102


>gi|57339512|gb|AAW49743.1| hypothetical protein FTT1695 [synthetic construct]
          Length = 130

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (65%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+VRR + E K+A G I++  +  EKPS   GE++ VG G    +G  +  +V
Sbjct: 29  IRPLQDRVLVRRAEEEKKSA-GGIILTGSAQEKPS--QGEVVAVGNGKKLDNGTTLPMDV 85

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VLFGK+SG+E+K+ D E  L+M+E DIMGI+ 
Sbjct: 86  KVGDKVLFGKYSGSEVKVGD-ETLLMMREEDIMGIIA 121


>gi|159900195|ref|YP_001546442.1| chaperonin Cpn10 [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893234|gb|ABX06314.1| chaperonin Cpn10 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 100

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +RP   RVV++    E KT +G + +PDT + EKP    G ++ VG G +D +GK +   
Sbjct: 6   IRPLADRVVIKPQAKEEKTKSG-LFLPDTANKEKPQ--EGLVVAVGEGKLDDNGKRVPVA 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLF K++GTEIKL+D E+YL++ E DI+ +V
Sbjct: 63  VQVGDRVLFAKYAGTEIKLDD-EDYLILAEKDILAVV 98


>gi|318042249|ref|ZP_07974205.1| co-chaperonin GroES [Synechococcus sp. CB0101]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRIFIKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQTPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  SVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|78184082|ref|YP_376517.1| co-chaperonin GroES [Synechococcus sp. CC9902]
 gi|123743559|sp|Q3AZK4|CH10_SYNS9 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78168376|gb|ABB25473.1| Co-chaperonin GroES [Synechococcus sp. CC9902]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  ++ G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKPNEDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ IV
Sbjct: 68  GIGDKVLYSKYAGTDIKLGS-DEYVLLSEKDILAIV 102


>gi|120437914|ref|YP_863600.1| co-chaperonin GroES [Gramella forsetii KT0803]
 gi|117580064|emb|CAL68533.1| protein Cpn10 (GroES protein) [Gramella forsetii KT0803]
          Length = 91

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+    +E KTA+G I+IP+T  EKP    G+++ VG G  D      E  V
Sbjct: 5   VKPLSDRVVIEPAAAENKTASG-IIIPETAKEKPQ--RGKVVAVGKGTKDH-----EMTV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+VL+GK++GTE+KL +G +YL+M+E DI+ IV
Sbjct: 57  KEGDMVLYGKYAGTELKL-EGTDYLIMREDDILAIV 91


>gi|284992820|ref|YP_003411374.1| chaperonin Cpn10 [Geodermatophilus obscurus DSM 43160]
 gi|284066065|gb|ADB77003.1| chaperonin Cpn10 [Geodermatophilus obscurus DSM 43160]
          Length = 102

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   RVVV+  ++E  TA+G ++IPDT  EKP    G ++ VG G +D +
Sbjct: 1   MTTATKVNIKPLEDRVVVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRVDDN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G  +  +V+ GD+V++ K+ GTE+K   GEEYLV+   D++ +V
Sbjct: 58  GNRVPLDVNVGDVVIYSKYGGTEVKYA-GEEYLVLSARDLLAVV 100


>gi|330470085|ref|YP_004407828.1| chaperonin Cpn10 [Verrucosispora maris AB-18-032]
 gi|328813056|gb|AEB47228.1| chaperonin Cpn10 [Verrucosispora maris AB-18-032]
          Length = 102

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R++V+  ++E  TA+G I+IPDT  EKP    G ++ VG G  D  
Sbjct: 1   MTTATKVAIKPLEDRILVQANEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRFDDD 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G  I  +V  GD VL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 58  GDRIPMDVKVGDTVLYSKYGGTEVKYA-GEEYLVLSARDVLAII 100


>gi|154507804|ref|ZP_02043446.1| hypothetical protein ACTODO_00286 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190199|ref|ZP_06608695.1| chaperonin GroS [Actinomyces odontolyticus F0309]
 gi|153797438|gb|EDN79858.1| hypothetical protein ACTODO_00286 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821015|gb|EFF79968.1| chaperonin GroS [Actinomyces odontolyticus F0309]
          Length = 98

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+R++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  I  +V
Sbjct: 5   IKPLEDRIVIRQVEAEQTTASG-LVIPDTAKEKPQ--EGEVIAVGPGRVDDNGNRIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V++ ++ GTE+K  DG+E+ ++   D++ +V
Sbjct: 62  KVGDVVIYSRYGGTEVKY-DGQEFQILSSRDVLAVV 96


>gi|238927399|ref|ZP_04659159.1| chaperone GroES [Selenomonas flueggei ATCC 43531]
 gi|238884681|gb|EEQ48319.1| chaperone GroES [Selenomonas flueggei ATCC 43531]
          Length = 93

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+   +S++ TA+G I++PDT  EKP    G+++ VGAG +  +G+    EV
Sbjct: 2   IKPLGERVVIEVAESDVTTASG-IVLPDTAKEKPQ--KGKVVAVGAGKLLDNGQRAGLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SG+EIK++D ++YL+++ESDI+ I+
Sbjct: 59  KAGDNVVFSKYSGSEIKVDD-KDYLIVRESDILAIL 93


>gi|323706024|ref|ZP_08117594.1| Chaperonin Cpn10 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534638|gb|EGB24419.1| Chaperonin Cpn10 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 94

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   RVVV+  ++E +   G I++P T  EKP    GE++ VG+G  +D  GK +E E
Sbjct: 3   LKPLGDRVVVKVTEAE-EVTKGGIVLPGTAKEKPQ--QGEVLAVGSGEYID--GKRVELE 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V+F K++GTE+KL DGEEYL++++SDI+ +V
Sbjct: 58  VKVGDKVIFSKYAGTEVKL-DGEEYLLLRQSDILAVV 93


>gi|262199740|ref|YP_003270949.1| chaperonin Cpn10 [Haliangium ochraceum DSM 14365]
 gi|262083087|gb|ACY19056.1| chaperonin Cpn10 [Haliangium ochraceum DSM 14365]
          Length = 96

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + R++VRR++ E +T  G I+IPD+  E+P    GE++ VGAG     G +   +V
Sbjct: 3   VRPLQDRLLVRRVE-ENETTKGGIIIPDSAKERPL--EGEVIAVGAGKRLDDGTLAALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK++GTEIK+ +G ++L+++E +I+G+V
Sbjct: 60  KAGDRVMFGKYAGTEIKV-EGVDHLILREDEILGVV 94


>gi|83596012|gb|ABC25371.1| chaperonin, 10 kDa [uncultured marine bacterium Ant29B7]
          Length = 92

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           +RP   RV++    +E  TA+G I+IPDT  EKP       + V AG    +GKV EP  
Sbjct: 6   IRPLADRVIIEPAAAETTTASG-IIIPDTAQEKPQKG----IVVAAG----NGKVDEPMT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD VL+GK++GTE K  +GE+YL+++ESDI+ I+
Sbjct: 57  VAVGDTVLYGKYAGTEFKF-EGEDYLILRESDILAII 92


>gi|89256984|ref|YP_514346.1| co-chaperonin GroES [Francisella tularensis subsp. holarctica LVS]
 gi|115315342|ref|YP_764065.1| co-chaperonin GroES [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156503183|ref|YP_001429248.1| co-chaperonin GroES [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010964|ref|ZP_02275895.1| chaperonin GroS [Francisella tularensis subsp. holarctica FSC200]
 gi|254368240|ref|ZP_04984260.1| chaperonin protein groES [Francisella tularensis subsp. holarctica
           257]
 gi|254369836|ref|ZP_04985846.1| chaperonin protein [Francisella tularensis subsp. holarctica
           FSC022]
 gi|290952915|ref|ZP_06557536.1| co-chaperonin GroES [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313885|ref|ZP_06804452.1| co-chaperonin GroES [Francisella tularensis subsp. holarctica
           URFT1]
 gi|6831502|sp|P94797|CH10_FRATH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|122324667|sp|Q0BKF6|CH10_FRATO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198370|sp|A7NE89|CH10_FRATF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|1770286|emb|CAA67359.1| groES [Francisella tularensis]
 gi|89144815|emb|CAJ80154.1| Chaperonin protein, groES [Francisella tularensis subsp. holarctica
           LVS]
 gi|115130241|gb|ABI83428.1| chaperone GroES [Francisella tularensis subsp. holarctica OSU18]
 gi|134254050|gb|EBA53144.1| chaperonin protein groES [Francisella tularensis subsp. holarctica
           257]
 gi|156253786|gb|ABU62292.1| chaperonin GroS [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|157122795|gb|EDO66924.1| chaperonin protein [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 95

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+VRR + E K+A G I++     EKPS   GE++ VG G    +G  +  +V
Sbjct: 3   IRPLQDRVLVRRAEEEKKSA-GGIILTGNAQEKPS--QGEVVAVGNGKKLDNGTTLPMDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG+E+K+ D E  L+M+E DIMGI+
Sbjct: 60  KVGDKVLFGKYSGSEVKVGD-ETLLMMREEDIMGII 94


>gi|148242959|ref|YP_001228116.1| 10 kDa chaperonin [Synechococcus sp. RCC307]
 gi|147851269|emb|CAK28763.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Synechococcus
           sp. RCC307]
          Length = 122

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++   S+ KTA G IL+PDT  EKP    GE++ +GAG  +  G    PEV
Sbjct: 30  VKPLGDRIFIKVSASDEKTA-GGILLPDTAQEKPQV--GEVVQIGAGKRNDDGSRQAPEV 86

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 87  SVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 121


>gi|295135981|ref|YP_003586657.1| co-chaperonin GroES [Zunongwangia profunda SM-A87]
 gi|294983996|gb|ADF54461.1| co-chaperonin GroES [Zunongwangia profunda SM-A87]
          Length = 91

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G I IP+T  EKP    G+++ VG G  D      E  V
Sbjct: 5   IKPLSDRVLIEPVAAETKTASG-IYIPETAKEKPQ--RGKVVAVGKGTKDH-----EMTV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+GK++GTE+KL +G +YL+M+E DI+ IV
Sbjct: 57  SVGDTVLYGKYAGTELKL-EGTDYLIMREDDILAIV 91


>gi|145596353|ref|YP_001160650.1| chaperonin Cpn10 [Salinispora tropica CNB-440]
 gi|302869875|ref|YP_003838512.1| chaperonin Cpn10 [Micromonospora aurantiaca ATCC 27029]
 gi|315501337|ref|YP_004080224.1| chaperonin cpn10 [Micromonospora sp. L5]
 gi|145305690|gb|ABP56272.1| chaperonin Cpn10 [Salinispora tropica CNB-440]
 gi|302572734|gb|ADL48936.1| Chaperonin Cpn10 [Micromonospora aurantiaca ATCC 27029]
 gi|315407956|gb|ADU06073.1| Chaperonin Cpn10 [Micromonospora sp. L5]
          Length = 102

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 4/104 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+  ++E  TA+G I+IPDT  EKP    G ++ VG G +D  
Sbjct: 1   MTTATKVAIKPLEDRIVVQANEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRIDDK 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G  +  +V  GD VL+ K+ GTE+K   GEEYLV+   D++ ++
Sbjct: 58  GNRVPIDVKVGDTVLYSKYGGTEVKYA-GEEYLVLSARDVLAVI 100


>gi|33865049|ref|NP_896608.1| co-chaperonin GroES [Synechococcus sp. WH 8102]
 gi|81711977|sp|Q7TTX2|CH10_SYNPX RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|33638733|emb|CAE07028.1| GroES chaperonin [Synechococcus sp. WH 8102]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV ++  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFIKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+E++++ E DI+ IV
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-GDEFVLLTEKDILAIV 102


>gi|124022213|ref|YP_001016520.1| hypothetical protein P9303_05031 [Prochlorococcus marinus str. MIT
           9303]
 gi|123962499|gb|ABM77255.1| Hypothetical protein P9303_05031 [Prochlorococcus marinus str. MIT
           9303]
          Length = 166

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 74  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 130

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL+  +EY+++ E DI+ +V
Sbjct: 131 GVGDKVLYSKYAGTDIKLST-DEYVLLSEKDILAVV 165


>gi|23813782|sp|Q8RU01|CH10_BRECH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|18700290|dbj|BAB85115.1| GroES [Brevibacillus choshinensis]
          Length = 94

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+  +  +  TA+G I++PD+  EKP    G ++ VG+G +  +G+ I  EV
Sbjct: 2   LKPLGDRVVIEAISKDEMTASG-IVLPDSAKEKPQ--EGRVIAVGSGRVADNGERIALEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE+K+ D +EYLV++ESDI+ I+
Sbjct: 59  KDGDKVIFSKYAGTEVKV-DNKEYLVLRESDILAII 93


>gi|120554948|ref|YP_959299.1| chaperonin Cpn10 [Marinobacter aquaeolei VT8]
 gi|166198381|sp|A1U293|CH10_MARAV RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|120324797|gb|ABM19112.1| chaperonin Cpn10 [Marinobacter aquaeolei VT8]
          Length = 95

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E KTA G I++P    EKPS   GE++ VG G +  +G+     V
Sbjct: 3   IRPLHDRVVVRRKEEEEKTA-GGIVLPGNAKEKPS--QGEVIAVGNGRILDNGETRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G  +K+ DGEE L+M E+DI G++
Sbjct: 60  KVGDTVVFGQYAGNTVKV-DGEELLIMSENDIYGVL 94


>gi|313205873|ref|YP_004045050.1| chaperonin cpn10 [Riemerella anatipestifer DSM 15868]
 gi|312445189|gb|ADQ81544.1| Chaperonin Cpn10 [Riemerella anatipestifer DSM 15868]
 gi|315022185|gb|EFT35213.1| Heat shock protein 60 family co-chaperone GroES [Riemerella
           anatipestifer RA-YM]
 gi|325336686|gb|ADZ12960.1| GroES [Riemerella anatipestifer RA-GD]
          Length = 92

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V    +E KTA+G I+IPDT  EKP    G ++ VGAG  D      EP  
Sbjct: 5   FKPLSDRVLVEPAAAETKTASG-IIIPDTAKEKPQ--EGVVVAVGAGKKD------EPMT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+SGTE+KL DG++YL+++E D++GI+
Sbjct: 56  VKVGDKVLYGKYSGTELKL-DGKDYLIVREGDLLGIL 91


>gi|329121321|ref|ZP_08249947.1| chaperone GroES [Dialister micraerophilus DSM 19965]
 gi|327469730|gb|EGF15196.1| chaperone GroES [Dialister micraerophilus DSM 19965]
          Length = 95

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+  + + KT +G IL+PDT  +K  +  G ++ VG+G +   GK I  EV
Sbjct: 2   LRPLADRVLVQVKEEDTKTKSG-ILLPDTAQKK--SQRGVVIAVGSGKLADDGKRIPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLF K+SG+EIK  DG++YL++ E DI+G+
Sbjct: 59  KVGDEVLFSKYSGSEIK-QDGKDYLLLDERDILGV 92


>gi|24215354|ref|NP_712835.1| co-chaperonin GroES [Leptospira interrogans serovar Lai str. 56601]
 gi|45657214|ref|YP_001300.1| co-chaperonin GroES [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|47606327|sp|P61436|CH10_LEPIC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock 10 kDa protein; AltName:
           Full=Protein Cpn10
 gi|47606328|sp|P61437|CH10_LEPIN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock 10 kDa protein; AltName:
           Full=Protein Cpn10
 gi|293070|gb|AAA71991.1| heat shock protein [Leptospira interrogans serovar copenhageni]
 gi|2642331|gb|AAB86964.1| heat shock protein 10 [Leptospira interrogans]
 gi|24196463|gb|AAN49853.1| co-chaperonin GroES [Leptospira interrogans serovar Lai str. 56601]
 gi|45600452|gb|AAS69937.1| GroES [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 96

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q E +   G+I +PDT  EKP    G+++ +G+G   + GK+I  EV
Sbjct: 4   IKPLGDRVLVEPRQ-EAEEKIGSIFVPDTAKEKPQ--EGKVVEIGSGKY-EDGKLIPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTEIK ++G+EYL+++ESDI+ +V
Sbjct: 60  KVGDTVLYGKYSGTEIK-SEGKEYLIIRESDILAVV 94


>gi|159904097|ref|YP_001551441.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9211]
 gi|226704023|sp|A9BCC5|CH10_PROM4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|159889273|gb|ABX09487.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. MIT
           9211]
          Length = 103

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE+  VG G  ++ G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVAQVGPGKRNEDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLGS-DEYVLLSEKDILAVV 102


>gi|298488558|ref|ZP_07006588.1| Heat shock protein 60 family co-chaperone GroES [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156899|gb|EFH97989.1| Heat shock protein 60 family co-chaperone GroES [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 97

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKGDGEDLLVMSENEILAVV 95


>gi|289606774|emb|CBI61021.1| unnamed protein product [Sordaria macrospora]
          Length = 76

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 51/77 (66%), Gaps = 3/77 (3%)

Query: 9  LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           RP   RV+VRR+++E KT  G I+IPDT  EKP    GE++  GAG  +  G+V   +V
Sbjct: 3  FRPLHDRVLVRRVEAEEKT-LGGIIIPDTAKEKPQ--EGEVVAAGAGAKNDKGEVAPLDV 59

Query: 69 SKGDIVLFGKWSGTEIK 85
            GD +LFGKWSGTE+K
Sbjct: 60 KAGDRILFGKWSGTEVK 76


>gi|169335827|ref|ZP_02863020.1| hypothetical protein ANASTE_02253 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258565|gb|EDS72531.1| hypothetical protein ANASTE_02253 [Anaerofustis stercorihominis DSM
           17244]
          Length = 94

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 70/97 (72%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   +VV++  + E  TATG I++PDT  EKP    GEI+ VG+G ++D  GK +  +
Sbjct: 3   LQPLGDKVVIKVKEEEKTTATG-IILPDTAKEKPVM--GEIVAVGSGEIVD--GKKVALD 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V +GD V++ K++G+E+KL +GEEYL++++SDI+ IV
Sbjct: 58  VKEGDTVIYSKYAGSEVKL-EGEEYLILRQSDILAIV 93


>gi|29839359|sp|Q8KM31|CH10_OLEAN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|22266160|emb|CAD43723.1| cochaperonin 10 [Oleispira antarctica]
 gi|50871370|emb|CAE54382.1| chaperonin 10 [Oleispira antarctica]
 gi|55468850|emb|CAE54385.1| chaperonin 10 [Oleispira antarctica]
 gi|55468854|emb|CAE54388.1| chaperonin 10 [Oleispira antarctica]
          Length = 97

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R+VVRR + E  TA G I++P   +EKP+   G ++ VG G +  +G V    V
Sbjct: 3   IRPLHDRIVVRRKEEETATA-GGIILPGAAAEKPN--QGVVISVGTGRILDNGSVQALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V+FGK+SG      DGEE L++ ESDI G++
Sbjct: 60  NEGDVVVFGKYSGQNTIDIDGEELLILNESDIYGVL 95


>gi|297621563|ref|YP_003709700.1| Co-chaperonin GroES [Waddlia chondrophila WSU 86-1044]
 gi|297376864|gb|ADI38694.1| Co-chaperonin GroES [Waddlia chondrophila WSU 86-1044]
          Length = 106

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 64/102 (62%), Gaps = 4/102 (3%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
            +HK  L+P   RV++RRL++E +T  G IL+PD+  +K      E++ VG G  D  G 
Sbjct: 7   ADHKTALKPLGNRVLLRRLEAE-ETLKGGILLPDSAKKK--QEQAEVIAVGPGKKDNKGN 63

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++   V +GDIVL  K+SG E+ L+D ++Y++ +  D++ I+
Sbjct: 64  LVPMPVKEGDIVLMEKYSGQEVTLDD-QDYVIARADDLIAII 104


>gi|271962700|ref|YP_003336896.1| co-chaperonin GroES [Streptosporangium roseum DSM 43021]
 gi|270505875|gb|ACZ84153.1| co-chaperonin GroES [Streptosporangium roseum DSM 43021]
          Length = 103

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 67/105 (63%), Gaps = 5/105 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+ L++E  TA+G ++IPDT  EKP    G+++ VG G  D+ 
Sbjct: 1   MTTATKVPVKPLGDRIVVQPLEAEQTTASG-LVIPDTAKEKPQ--EGKVLAVGPGNWDED 57

Query: 61  G-KVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G K I  +V +GDIVL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 58  GDKRIPLDVKEGDIVLYSKYGGTEVKYG-GEEYLVLSARDVLAII 101


>gi|187251333|ref|YP_001875815.1| chaperonin Cpn10 [Elusimicrobium minutum Pei191]
 gi|226701764|sp|B2KD82|CH10_ELUMP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|186971493|gb|ACC98478.1| Chaperonin Cpn10 [Elusimicrobium minutum Pei191]
          Length = 97

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           + P   R++V+ ++ E+  +   I+IPDT  EKP    GE++  G G + + G+    +V
Sbjct: 6   IAPLGDRIIVKPIEREVMKS--GIIIPDTAKEKPM--EGEVVAAGPGKLGEKGERAPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VL+GK+SGTE+K+ND + YL+M + D++GI+
Sbjct: 62  KKGDKVLYGKYSGTEVKIND-KNYLIMHQDDVLGII 96


>gi|33863717|ref|NP_895277.1| co-chaperonin GroES [Prochlorococcus marinus str. MIT 9313]
 gi|60389726|sp|Q7TUS3|CH10_PROMM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|33635300|emb|CAE21625.1| GroES protein (Chaperonin cpn10) [Prochlorococcus marinus str. MIT
           9313]
          Length = 103

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL+  +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLST-DEYVLLSEKDILAVV 102


>gi|299821512|ref|ZP_07053400.1| chaperone GroES [Listeria grayi DSM 20601]
 gi|299817177|gb|EFI84413.1| chaperone GroES [Listeria grayi DSM 20601]
          Length = 107

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+  L++E KTA+G I++PD+  EKP    G+++ VG G + ++G   E EV
Sbjct: 16  LRPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--EGKVIAVGNGKVLENGTKQELEV 72

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +  D ++F K+SGTE+   DG++YL+++E DI+ IV
Sbjct: 73  AVNDRIIFSKYSGTEVTY-DGKDYLIIREDDILAIV 107


>gi|189220188|ref|YP_001940828.1| Co-chaperonin GroES (HSP10) [Methylacidiphilum infernorum V4]
 gi|226704011|sp|B3DZP6|CH10_METI4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189187046|gb|ACD84231.1| Co-chaperonin GroES (HSP10) [Methylacidiphilum infernorum V4]
          Length = 99

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+ ++ + +   G I+IPDT  EKP  ++  ++ VG G +D++GK I  EV
Sbjct: 6   IRPLGERVLVKLIEEQ-EVRKGGIIIPDTAKEKPQEAT--VIAVGPGKLDENGKRIPIEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VL  K+ GTE+K+ DGE + +++E DI+ I+
Sbjct: 63  KKGDKVLISKYGGTEVKI-DGESFQILREDDILAII 97


>gi|2521993|dbj|BAA22746.1| chaperonin [Bacillus subtilis]
          Length = 90

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 66/90 (73%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           RVV+  ++SE KTA+G I++PD+  EKP    G+I+  G+G + +SG+ +  EV +GD +
Sbjct: 4   RVVIELVESEEKTASG-IVLPDSAKEKP--QEGKIVAAGSGRVLESGERVALEVKEGDRI 60

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +F K++GTE+K  +G EYL+++ESDI+ ++
Sbjct: 61  IFSKYAGTEVKY-EGTEYLILRESDILAVI 89


>gi|255658063|ref|ZP_05403472.1| chaperonin GroS [Mitsuokella multacida DSM 20544]
 gi|260849828|gb|EEX69835.1| chaperonin GroS [Mitsuokella multacida DSM 20544]
          Length = 93

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+   +S++KTA+G I++PDT  EKP    G ++ VGAG +  +G+    EV
Sbjct: 2   IKPLGERVVIEVAESDVKTASG-IVLPDTAKEKPQ--KGTVVAVGAGKLLDNGERAAMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SG+E+K+ +G++YL+++ESDI+ ++
Sbjct: 59  KVGDGVIFSKYSGSEVKV-EGKDYLIVRESDILAVI 93


>gi|298243451|ref|ZP_06967258.1| Chaperonin Cpn10 [Ktedonobacter racemifer DSM 44963]
 gi|297556505|gb|EFH90369.1| Chaperonin Cpn10 [Ktedonobacter racemifer DSM 44963]
          Length = 96

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+    E  T +G I+IPDT  EKP    G ++ VG+G +  +G+    ++
Sbjct: 4   IRPVGDRVVVKPAAKEEVTRSG-IVIPDTAKEKPQ--EGTVISVGSGRLLDNGERATIDI 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VLF K+ GTE KL +GEEYLV++ESDI+ I+
Sbjct: 61  KEGDRVLFAKYGGTEFKL-EGEEYLVLKESDILAII 95


>gi|292669710|ref|ZP_06603136.1| chaperone GroES [Selenomonas noxia ATCC 43541]
 gi|292648507|gb|EFF66479.1| chaperone GroES [Selenomonas noxia ATCC 43541]
          Length = 93

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+   +S++ TA+G I++PDT  EKP    G+++ VG G + +SG+    EV
Sbjct: 2   IKPLGERVVIEVAESDVTTASG-IVLPDTAKEKPQ--KGKVVAVGTGKLLESGQRAAMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SG+EIK++D ++YL+++ESDI+ I+
Sbjct: 59  KVGDGVVFSKYSGSEIKVDD-KDYLIVRESDILAIL 93


>gi|260435134|ref|ZP_05789104.1| chaperonin GroS [Synechococcus sp. WH 8109]
 gi|260413008|gb|EEX06304.1| chaperonin GroS [Synechococcus sp. WH 8109]
          Length = 103

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|320330108|gb|EFW86095.1| co-chaperonin GroES [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330874931|gb|EGH09080.1| co-chaperonin GroES [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 97

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPSSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95


>gi|304317535|ref|YP_003852680.1| chaperonin Cpn10 [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302779037|gb|ADL69596.1| Chaperonin Cpn10 [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 94

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   RVVV+  ++E +   G I++P T  EKP    GE++ VG+G  +D  GK +E E
Sbjct: 3   LKPLGDRVVVKVTEAE-EVTKGGIVLPGTAKEKPQ--QGEVLAVGSGEYID--GKRVELE 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V+F K++GTE+KL DGEEYL+++++DI+ IV
Sbjct: 58  VKVGDKVIFSKYAGTEVKL-DGEEYLLLRQNDILAIV 93


>gi|78213685|ref|YP_382464.1| co-chaperonin GroES [Synechococcus sp. CC9605]
 gi|123729663|sp|Q3AHM3|CH10_SYNSC RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78198144|gb|ABB35909.1| Co-chaperonin GroES [Synechococcus sp. CC9605]
          Length = 103

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDNVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|307545464|ref|YP_003897943.1| co-chaperonin GroES [Halomonas elongata DSM 2581]
 gi|307217488|emb|CBV42758.1| co-chaperonin GroES [Halomonas elongata DSM 2581]
 gi|316997261|dbj|BAJ52726.1| chaperonin GroES [Halomonas sp. 40]
          Length = 97

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E KTA G I++P +  EKP+   GE++ VG G + +SG V   +V
Sbjct: 3   IRPLHDRVVIRRVEEEQKTA-GGIVLPGSAQEKPT--RGEVLAVGNGRILESGDVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F +  G E +  DGEE L+M ESDI+ +V
Sbjct: 60  KVGDTVIFKEGFGVEKQKVDGEEVLIMSESDILAVV 95


>gi|313892350|ref|ZP_07825942.1| chaperonin GroS [Dialister microaerophilus UPII 345-E]
 gi|313119209|gb|EFR42409.1| chaperonin GroS [Dialister microaerophilus UPII 345-E]
          Length = 95

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+  +   KT +G IL+PDT  +K  +  G ++ VG+G +   GK I  EV
Sbjct: 2   LRPLADRVLVQVKEEATKTKSG-ILLPDTAQKK--SQRGVVIAVGSGKLADDGKRIPLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLF K+SG+EIK  DG++YL++ E DI+GI
Sbjct: 59  KVGDEVLFSKYSGSEIK-QDGKDYLLLDERDILGI 92


>gi|288554883|ref|YP_003426818.1| co-chaperonin GroES [Bacillus pseudofirmus OF4]
 gi|288546043|gb|ADC49926.1| co-chaperonin GroES [Bacillus pseudofirmus OF4]
          Length = 94

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+++  ++SE KTA+G I++PD+  EKP    G+++ VG G +  +G+ I  +V
Sbjct: 2   LKPLGDRIIIELVESEEKTASG-IVLPDSAKEKPQ--EGKVVAVGTGRVTDNGERIALDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD ++F K++GTE+K   G EYL+++ESD++ I+
Sbjct: 59  KEGDSIIFSKYAGTEVKYG-GVEYLILRESDVLAII 93


>gi|209526692|ref|ZP_03275216.1| chaperonin Cpn10 [Arthrospira maxima CS-328]
 gi|284053604|ref|ZP_06383814.1| co-chaperonin GroES [Arthrospira platensis str. Paraca]
 gi|209492928|gb|EDZ93259.1| chaperonin Cpn10 [Arthrospira maxima CS-328]
 gi|291565677|dbj|BAI87949.1| co-chaperonin GroES [Arthrospira platensis NIES-39]
          Length = 103

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GEI+  G G  +  G   E EV
Sbjct: 11  VKPLGERVFVKVSASEEKTA-GGILLPDTAKEKPQV--GEIVAAGPGRRNDDGSRCEMEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+EY+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GDEYVLLAEKDILAIV 102


>gi|304438493|ref|ZP_07398433.1| chaperone GroES [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304368576|gb|EFM22261.1| chaperone GroES [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 93

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 69/96 (71%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+   +S++ TA+G I++PDT  EKP    G+++ VG G + ++G+    EV
Sbjct: 2   IKPLGERVVIEVAESDVTTASG-IVLPDTAKEKPQ--KGKVVAVGTGKLLENGQRAGLEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+SG+EIK++D ++YL+++ESDI+ I+
Sbjct: 59  KEGDSVVFSKYSGSEIKVDD-KDYLIVRESDILAIL 93


>gi|116327830|ref|YP_797550.1| co-chaperonin GroES [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116331358|ref|YP_801076.1| co-chaperonin GroES [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|122280896|sp|Q04S02|CH10_LEPBJ RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|122284375|sp|Q052X8|CH10_LEPBL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|116120574|gb|ABJ78617.1| GroES chaperone [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125047|gb|ABJ76318.1| GroES chaperone [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 96

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q E +   G+I +PDT  EKP    G+++ +G+G   + GK++  EV
Sbjct: 4   IKPLGDRVLVEPRQ-EAEEKIGSIFVPDTAKEKPQ--EGKVVEIGSGKY-EDGKLVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTEIK ++G+EYL+++ESDI+ +V
Sbjct: 60  KVGDTVLYGKYSGTEIK-SEGKEYLIIRESDILAVV 94


>gi|83590956|ref|YP_430965.1| chaperonin Cpn10 [Moorella thermoacetica ATCC 39073]
 gi|83573870|gb|ABC20422.1| Chaperonin Cpn10 [Moorella thermoacetica ATCC 39073]
          Length = 95

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+++ L++E KTA G I++PDT  EKP    GE++ VG G +  +G+ ++ EV
Sbjct: 3   FQPLGDRVLIKPLEAEEKTAAG-IVLPDTAKEKPQ--QGEVIAVGPGRLLDNGERVKMEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ +++GTE+K  D  +YLV+ E DI+ +V
Sbjct: 60  KAGDRVLYARYAGTELKQGD-TKYLVLSERDILAVV 94


>gi|329945800|ref|ZP_08293487.1| chaperonin GroS [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528248|gb|EGF55226.1| chaperonin GroS [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 98

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPDT  EKP    G+++ VG G +D SG  +  +V
Sbjct: 5   IKPLEDRIVVQTVEAEQTTASG-LVIPDTAKEKPQ--EGKVVAVGPGRVDDSGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V++ K+ GTE+    GE+YL++   D++ +V
Sbjct: 62  AEGDVVIYSKYGGTEVSYA-GEDYLILSARDVLAVV 96


>gi|256831875|ref|YP_003160602.1| chaperonin Cpn10 [Jonesia denitrificans DSM 20603]
 gi|256685406|gb|ACV08299.1| chaperonin Cpn10 [Jonesia denitrificans DSM 20603]
          Length = 97

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L++E    +G ++IPDT  EKP    GE++ VG G +D  G  I  +V
Sbjct: 5   IKPLEDRIVVKALEAETTLPSG-LVIPDTAKEKPQ--EGEVLAVGPGRIDDKGNRIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTEIK   GEEYL++   D++ IV
Sbjct: 62  NVGDKVIYSKYGGTEIKYA-GEEYLILSARDVLAIV 96


>gi|149378295|ref|ZP_01896005.1| Co-chaperonin GroES (HSP10) [Marinobacter algicola DG893]
 gi|149357429|gb|EDM45941.1| Co-chaperonin GroES (HSP10) [Marinobacter algicola DG893]
          Length = 95

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E KTA G I++P    EKPS   GE++ VG G +  +G+     V
Sbjct: 3   IRPLHDRVVVRRKEEEEKTA-GGIVLPGNAKEKPS--QGEVIAVGNGRILDNGETRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G  +K+ DGE+ L+M E+DI G++
Sbjct: 60  KVGDTVVFGQYAGNTVKV-DGEDLLIMSENDIFGVL 94


>gi|163848431|ref|YP_001636475.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl]
 gi|222526357|ref|YP_002570828.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl]
 gi|163669720|gb|ABY36086.1| chaperonin Cpn10 [Chloroflexus aurantiacus J-10-fl]
 gi|222450236|gb|ACM54502.1| chaperonin Cpn10 [Chloroflexus sp. Y-400-fl]
          Length = 98

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +++P   RVVV+    E KT  G I +PDT S K     GE++ VG G     GK+I   
Sbjct: 2   HVKPLNDRVVVKPKPREEKT-KGGIFLPDTAS-KERPMEGEVIAVGPGRRADDGKLIPMS 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G  VL+ K++GTE K++D EEYL++QE DI+GI+
Sbjct: 60  VKVGQHVLYAKYAGTEFKIDD-EEYLILQEKDILGII 95


>gi|326333129|ref|ZP_08199378.1| chaperonin GroS [Nocardioidaceae bacterium Broad-1]
 gi|325949112|gb|EGD41203.1| chaperonin GroS [Nocardioidaceae bacterium Broad-1]
          Length = 97

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPDT  EKP    GE++ +G G +D  G  +  +V
Sbjct: 5   IKPLEDRIVVKAVEAEQTTASG-LVIPDTAKEKPQ--EGEVLALGPGRIDDKGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K   GEEYL++   DI+ ++
Sbjct: 62  AVGDKVIYSKYGGTEVKYA-GEEYLILSARDILAVI 96


>gi|297201803|ref|ZP_06919200.1| chaperonin GroS [Streptomyces sviceus ATCC 29083]
 gi|297147962|gb|EFH28803.1| chaperonin GroS [Streptomyces sviceus ATCC 29083]
          Length = 102

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GDIVL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 66  SVGDIVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|88807400|ref|ZP_01122912.1| co-chaperonin GroES [Synechococcus sp. WH 7805]
 gi|88788614|gb|EAR19769.1| co-chaperonin GroES [Synechococcus sp. WH 7805]
          Length = 103

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKVSESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKPNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|134300707|ref|YP_001114203.1| chaperonin Cpn10 [Desulfotomaculum reducens MI-1]
 gi|134053407|gb|ABO51378.1| chaperonin Cpn10 [Desulfotomaculum reducens MI-1]
          Length = 94

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ L  E KT +G I++PDT  EKP    GE++ VG G + ++G+    ++
Sbjct: 2   IKPLGDRVVVKALPQEEKTKSG-IVLPDTAKEKPQ--QGEVVAVGPGRLLENGQRAALDL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V F K++G E+KL D EEYL+++E DI+ ++
Sbjct: 59  KAGDKVFFSKYAGNEVKL-DEEEYLILREMDILAVI 93


>gi|304405157|ref|ZP_07386817.1| Chaperonin Cpn10 [Paenibacillus curdlanolyticus YK9]
 gi|304346036|gb|EFM11870.1| Chaperonin Cpn10 [Paenibacillus curdlanolyticus YK9]
          Length = 93

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  +  E  TA+G IL+PDT  EKP    G+I+ VG+G + + G  I  EV
Sbjct: 2   IKPLGERVLVEPIAKEETTASG-ILLPDTAKEKPQ--EGKIIAVGSGTL-KDGARIALEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K  +G+EYL+M+ESDI  I+
Sbjct: 58  QVGDRVLFSKYAGTEVKY-EGKEYLIMKESDIHAIL 92


>gi|113953833|ref|YP_731480.1| co-chaperonin GroES [Synechococcus sp. CC9311]
 gi|122945562|sp|Q0I7U2|CH10_SYNS3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|113881184|gb|ABI46142.1| chaperonin, 10 kDa [Synechococcus sp. CC9311]
          Length = 103

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFVKISESEEKTA-GGILLPDTAKEKPQV--GEVVQVGPGKSNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GIGDKVLYSKYAGTDIKLGS-DEYVLLSEKDILAVV 102


>gi|21223140|ref|NP_628919.1| co-chaperonin GroES [Streptomyces coelicolor A3(2)]
 gi|256785763|ref|ZP_05524194.1| co-chaperonin GroES [Streptomyces lividans TK24]
 gi|289769655|ref|ZP_06529033.1| chaperonin GroS [Streptomyces lividans TK24]
 gi|302553606|ref|ZP_07305948.1| chaperonin GroS [Streptomyces viridochromogenes DSM 40736]
 gi|61220913|sp|P0A345|CH10_STRCO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|61220915|sp|P0A346|CH10_STRLI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|809756|emb|CAA53018.1| GroES [Streptomyces coelicolor]
 gi|2558618|emb|CAA65224.1| GroES protein [Streptomyces lividans]
 gi|3449273|emb|CAA20417.1| 10 kD chaperonin cpn10 [Streptomyces coelicolor A3(2)]
 gi|289699854|gb|EFD67283.1| chaperonin GroS [Streptomyces lividans TK24]
 gi|302471224|gb|EFL34317.1| chaperonin GroS [Streptomyces viridochromogenes DSM 40736]
          Length = 102

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +VS GD+VL+ K+ GTE+K N GEEYLV+   D++ IV
Sbjct: 63  LDVSVGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAIV 100


>gi|84686154|ref|ZP_01014049.1| chaperonin, 10 kDa [Maritimibacter alkaliphilus HTCC2654]
 gi|84665681|gb|EAQ12156.1| chaperonin, 10 kDa [Rhodobacterales bacterium HTCC2654]
          Length = 86

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 4/90 (4%)

Query: 16  VVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVL 75
           ++V R++SE KTA G ++IPD+  EKP+        VGAG  D+ G  I  +V +GD +L
Sbjct: 1   MLVERVESEEKTA-GGLIIPDSAKEKPAEGVVVA--VGAGAKDEDGDRISMDVKEGDKIL 57

Query: 76  FGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           FGKWSGTEI L DG+E L+M+ESDIMGI+ 
Sbjct: 58  FGKWSGTEITL-DGKEMLIMKESDIMGIIA 86


>gi|308446330|ref|XP_003087153.1| hypothetical protein CRE_19644 [Caenorhabditis remanei]
 gi|308260736|gb|EFP04689.1| hypothetical protein CRE_19644 [Caenorhabditis remanei]
          Length = 96

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP    VV+RR++ E KTA G +++  + +E+P  + GEI+ VG G +  +G V   +V
Sbjct: 4   IRPLHDNVVIRRVEKETKTA-GGLILSTSAAEQP--AQGEILAVGNGKITDNG-VRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT++K+ DGEE LVM+ESDI+ ++
Sbjct: 60  KVGDNVLFGAYAGTKVKV-DGEELLVMKESDILAVL 94


>gi|87301227|ref|ZP_01084068.1| co-chaperonin GroES [Synechococcus sp. WH 5701]
 gi|87284195|gb|EAQ76148.1| co-chaperonin GroES [Synechococcus sp. WH 5701]
          Length = 103

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV ++   S+ KTA G IL+PDT  EKP    GE++ VG G     G    PEV
Sbjct: 11  VKPLGDRVFIKVSDSDEKTA-GGILLPDTAQEKPQV--GEVVQVGPGKRSDDGTRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL  G E++++ E DI+ IV
Sbjct: 68  SVGDKVLYSKYAGTDIKLG-GNEFVLLSEKDILAIV 102


>gi|269792841|ref|YP_003317745.1| chaperonin Cpn10 [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100476|gb|ACZ19463.1| chaperonin Cpn10 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 96

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R+VV+ ++ E +   G I++PDTV EKP    GE++ VG G +  +G+ +  EV
Sbjct: 3   LRPLGDRLVVKAVEKE-EMTKGGIVLPDTVKEKPV--EGEVVAVGTGRVLDNGQRLPMEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ V++ K+SGTE+K  DG+EYL++ E D++ IV
Sbjct: 60  KVGNRVIYSKYSGTEVKF-DGQEYLILSERDVLAIV 94


>gi|261855236|ref|YP_003262519.1| chaperonin Cpn10 [Halothiobacillus neapolitanus c2]
 gi|261835705|gb|ACX95472.1| chaperonin Cpn10 [Halothiobacillus neapolitanus c2]
          Length = 96

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++R++ E KTA G I++PD+ +EKP+   GE++  G G  +  G+V    V
Sbjct: 3   IRPLHDRVLIKRVEEERKTAFG-IVLPDSAAEKPN--RGEVVAAGPGKSNDKGEVRPMGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF +++GT++K+ DGEE L+M E D++ ++
Sbjct: 60  KTGDQVLFNQYAGTKVKV-DGEELLMMGEDDLLAVI 94


>gi|159039751|ref|YP_001539004.1| chaperonin Cpn10 [Salinispora arenicola CNS-205]
 gi|157918586|gb|ABW00014.1| chaperonin Cpn10 [Salinispora arenicola CNS-205]
          Length = 104

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+  ++E  TA+G I+IPDT  EKP    G ++ VG G +D  G  + 
Sbjct: 8   KVAIKPLEDRIVVQANEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRIDDKGNRVP 64

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VL+ K+ GTE+K   GEEYLV+   D++ ++
Sbjct: 65  IDVKIGDTVLYSKYGGTEVKYA-GEEYLVLSARDVLAVI 102


>gi|302189738|ref|ZP_07266411.1| co-chaperonin GroES [Pseudomonas syringae pv. syringae 642]
          Length = 97

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKLDGEDLLVMSENEILAVV 95


>gi|297625857|ref|YP_003687620.1| 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) (Heat shock
           10 1) [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921622|emb|CBL56176.1| 10 kDa chaperonin 1 (Protein Cpn10 1) (groES protein 1) (Heat shock
           10 1) [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 98

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  L++E  TA+G ++IP+T  EKP    G+++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDRVLVEPLEAETTTASG-LVIPETAKEKPQ--EGKVLAVGPGRVDDKGVRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD+V+F K+ GTE+K N+  +YL++   DI+ +VV+
Sbjct: 62  KEGDVVVFSKYGGTEVKYNN-TDYLLLNARDILAVVVK 98


>gi|242278246|ref|YP_002990375.1| chaperonin Cpn10 [Desulfovibrio salexigens DSM 2638]
 gi|242121140|gb|ACS78836.1| chaperonin Cpn10 [Desulfovibrio salexigens DSM 2638]
          Length = 90

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P + RV+++R+++E KTA+G I+IPD+  EKP    GE++  G G  +    V     
Sbjct: 3   LKPLQDRVLIKRVETEQKTASG-IIIPDSAKEKPM--KGEVVAAGPGKDNNPMTV----- 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VLF K++G E+K+ D EE+++M+E +I+ IV
Sbjct: 55  KAGDVVLFAKYAGNELKI-DAEEFIIMREDEILAIV 89


>gi|294508159|ref|YP_003572217.1| 10 kDa chaperonin [Salinibacter ruber M8]
 gi|294344487|emb|CBH25265.1| 10 kDa chaperonin [Salinibacter ruber M8]
          Length = 117

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+   +E KT +G + IPD+  EKP    G ++  G G + + G  IE  V
Sbjct: 25  IKPLGDRVVVQPKPAEEKTESG-LYIPDSAKEKPQ--EGTVVATGPGRV-EDGTRIEMTV 80

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+GK++GTE+ L DG+EYL+M+ESDI G+V
Sbjct: 81  EEGDDVLYGKYAGTEVTL-DGDEYLIMRESDIFGVV 115


>gi|28871513|ref|NP_794132.1| chaperonin, 10 kDa [Pseudomonas syringae pv. tomato str. DC3000]
 gi|66047300|ref|YP_237141.1| co-chaperonin GroES [Pseudomonas syringae pv. syringae B728a]
 gi|71734896|ref|YP_276204.1| co-chaperonin GroES [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213970327|ref|ZP_03398457.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato T1]
 gi|257486385|ref|ZP_05640426.1| co-chaperonin GroES [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625004|ref|ZP_06457958.1| co-chaperonin GroES [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647063|ref|ZP_06478406.1| co-chaperonin GroES [Pseudomonas syringae pv. aesculi str. 2250]
 gi|289677746|ref|ZP_06498636.1| co-chaperonin GroES [Pseudomonas syringae pv. syringae FF5]
 gi|301385479|ref|ZP_07233897.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato Max13]
 gi|302062991|ref|ZP_07254532.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato K40]
 gi|302132513|ref|ZP_07258503.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|60389775|sp|Q87X13|CH10_PSESM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|81307949|sp|Q4ZP19|CH10_PSEU2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123747554|sp|Q48EI4|CH10_PSE14 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|28854764|gb|AAO57827.1| chaperonin, 10 kDa [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63258007|gb|AAY39103.1| Chaperonin Cpn10 [Pseudomonas syringae pv. syringae B728a]
 gi|71555449|gb|AAZ34660.1| chaperonin, 10 kDa [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213924999|gb|EEB58564.1| co-chaperonin GroES [Pseudomonas syringae pv. tomato T1]
 gi|320322424|gb|EFW78517.1| co-chaperonin GroES [Pseudomonas syringae pv. glycinea str. B076]
 gi|330868736|gb|EGH03445.1| co-chaperonin GroES [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330877910|gb|EGH12059.1| co-chaperonin GroES [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330901830|gb|EGH33247.1| co-chaperonin GroES [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330943739|gb|EGH46025.1| co-chaperonin GroES [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330957942|gb|EGH58202.1| co-chaperonin GroES [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330966160|gb|EGH66420.1| co-chaperonin GroES [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330973356|gb|EGH73422.1| co-chaperonin GroES [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330981188|gb|EGH79291.1| co-chaperonin GroES [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330989411|gb|EGH87514.1| co-chaperonin GroES [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331009874|gb|EGH89930.1| co-chaperonin GroES [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331017961|gb|EGH98017.1| co-chaperonin GroES [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 97

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95


>gi|325068100|ref|ZP_08126773.1| co-chaperonin GroES [Actinomyces oris K20]
 gi|326774032|ref|ZP_08233314.1| chaperonin GroS [Actinomyces viscosus C505]
 gi|326636171|gb|EGE37075.1| chaperonin GroS [Actinomyces viscosus C505]
          Length = 98

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+  ++E  TA+G ++IPDT  EKP    G+++ VG G +D SG  +  +V
Sbjct: 5   IKPLEDRIVVQTAEAEQTTASG-LVIPDTAKEKPQ--EGKVVAVGPGRIDDSGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V++ K+ GTE+    GE+YL++   D++ +V
Sbjct: 62  AEGDVVIYSKYGGTEVSYA-GEDYLILSARDVLAVV 96


>gi|77460723|ref|YP_350230.1| co-chaperonin GroES [Pseudomonas fluorescens Pf0-1]
 gi|123603461|sp|Q3K7L5|CH10_PSEPF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|77384726|gb|ABA76239.1| 10 kDa chaperonin [Pseudomonas fluorescens Pf0-1]
          Length = 97

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EK  A+ GEI+ VG G   +SG+V    V
Sbjct: 3   LRPLHDRVVIRRSEEEKKTA-GGIVLPGSAAEK--ANHGEILAVGPGKALESGEVRALSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVI 95


>gi|150010352|ref|YP_001305095.1| co-chaperonin GroES [Parabacteroides distasonis ATCC 8503]
 gi|256839202|ref|ZP_05544712.1| chaperonin GroS [Parabacteroides sp. D13]
 gi|262382353|ref|ZP_06075490.1| chaperonin GroS [Bacteroides sp. 2_1_33B]
 gi|298374748|ref|ZP_06984706.1| chaperonin GroS [Bacteroides sp. 3_1_19]
 gi|301308431|ref|ZP_07214385.1| chaperonin GroS [Bacteroides sp. 20_3]
 gi|166198390|sp|A6LIF9|CH10_PARD8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|149938776|gb|ABR45473.1| chaperonin GroES, 10 kDa [Parabacteroides distasonis ATCC 8503]
 gi|256740121|gb|EEU53445.1| chaperonin GroS [Parabacteroides sp. D13]
 gi|262295231|gb|EEY83162.1| chaperonin GroS [Bacteroides sp. 2_1_33B]
 gi|298269116|gb|EFI10771.1| chaperonin GroS [Bacteroides sp. 3_1_19]
 gi|300833901|gb|EFK64517.1| chaperonin GroS [Bacteroides sp. 20_3]
          Length = 89

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++   +E KT  G I+IPD+  EKP    GEI+ VG G  D+     E  V
Sbjct: 3   IRPLADRVLIKPAAAEEKT-LGGIIIPDSAKEKPL--KGEIVAVGNGTKDE-----EMVV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTEI+L DGE+YL+M+++D++ I+
Sbjct: 55  KVGDNVLYGKYAGTEIEL-DGEKYLIMRQADVLAII 89


>gi|308067968|ref|YP_003869573.1| 10 kDa chaperonin (protein Cpn10) (groES protein) [Paenibacillus
           polymyxa E681]
 gi|310640731|ref|YP_003945489.1| chaperonin gros [Paenibacillus polymyxa SC2]
 gi|305857247|gb|ADM69035.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Paenibacillus
           polymyxa E681]
 gi|309245681|gb|ADO55248.1| Chaperonin GroS [Paenibacillus polymyxa SC2]
          Length = 93

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  ++ E  T+ G I++PD+  EKP    G+I+ VGAG + + G  I  EV
Sbjct: 2   IKPLGERVLVEAIEQETTTSFG-IVLPDSAKEKPQ--EGKIIAVGAGAL-KDGARIPLEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTEIK  +G+EYL+M+ESDI  I+
Sbjct: 58  KEGDRVIFSKYAGTEIKY-EGKEYLIMKESDIHAII 92


>gi|297159670|gb|ADI09382.1| co-chaperonin GroES [Streptomyces bingchenggensis BCW-1]
          Length = 102

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +VS GD+VL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 63  LDVSVGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|262340980|ref|YP_003283835.1| chaperone GroES [Blattabacterium sp. (Blattella germanica) str.
           Bge]
 gi|262272317|gb|ACY40225.1| chaperone GroES [Blattabacterium sp. (Blattella germanica) str.
           Bge]
          Length = 92

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E KTA+G I+IPDT  EKP    G I+ VG G  D      EP +
Sbjct: 6   IKPLADRVLVQPDPAETKTASG-IIIPDTAKEKPQ--KGTIIAVGKGKKD------EPMI 56

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+SGTE+K  +GEEYL+M+ESD++ I+
Sbjct: 57  LKEGDRVLYGKYSGTELKW-EGEEYLIMRESDVIAII 92


>gi|307331072|ref|ZP_07610201.1| Chaperonin Cpn10 [Streptomyces violaceusniger Tu 4113]
 gi|306883283|gb|EFN14340.1| Chaperonin Cpn10 [Streptomyces violaceusniger Tu 4113]
          Length = 102

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + GK + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGKRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +VS GD+VL+ K+ GTE+K + GEEYLV+   D++ IV
Sbjct: 63  LDVSVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAIV 100


>gi|261749504|ref|YP_003257190.1| co-chaperonin GroES [Blattabacterium sp. (Periplaneta americana)
           str. BPLAN]
 gi|261497597|gb|ACX84047.1| co-chaperonin GroES [Blattabacterium sp. (Periplaneta americana)
           str. BPLAN]
          Length = 92

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E KTA+G I+IPDT  EKP    G I+ VG G  D+S  + E   
Sbjct: 6   IKPLADRVLVQPDPAETKTASG-IIIPDTAKEKPQ--KGTIIAVGNGKKDESMILKE--- 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE+K  +GEEYL+M+ESD++ I+
Sbjct: 60  --GDRVLYGKYSGTELKW-EGEEYLIMRESDVIAII 92


>gi|227549899|ref|ZP_03979948.1| co-chaperonin GroES [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078045|gb|EEI16008.1| co-chaperonin GroES [Corynebacterium lipophiloflavum DSM 44291]
          Length = 99

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +V+V+  ++E  TA+G ++IPD+ +EKP  +   ++ VG G +D SG  +  +V
Sbjct: 6   IKPLEDKVLVQIAEAETTTASG-LVIPDSAAEKPQEAV--VIAVGPGRLDDSGNRVPVDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTE+K N GEEYL++   D++ +V
Sbjct: 63  KEGDTVVFSKYGGTELKYN-GEEYLLLSARDLLAVV 97


>gi|251795085|ref|YP_003009816.1| chaperonin Cpn10 [Paenibacillus sp. JDR-2]
 gi|247542711|gb|ACS99729.1| chaperonin Cpn10 [Paenibacillus sp. JDR-2]
          Length = 93

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 5/95 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV++  +  E  TA+G I++PDT  EKP    G+++ VGAG + + G  +  EV
Sbjct: 2   IRPLGERVLIEPIAKEETTASG-IVLPDTAKEKPQ--EGKVVAVGAGTL-KDGARVALEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLF K++GTEIK  +G+EYL+M+ESDI  I
Sbjct: 58  QVGDRVLFSKYAGTEIKY-EGKEYLIMKESDIHAI 91


>gi|49074882|gb|AAT49435.1| PA4386 [synthetic construct]
          Length = 98

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGEE LVM ES+I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVL 95


>gi|33241039|ref|NP_875981.1| co-chaperonin GroES [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|60389727|sp|Q7TV92|CH10_PROMA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|33238568|gb|AAQ00634.1| Co-chaperonin GroES [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 103

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV ++  +SE KTA G IL+PDT  EKP    GE+  VG G  +  G    PEV
Sbjct: 11  VKPLGDRVFIKVSESEEKTA-GGILLPDTAKEKPQV--GEVAQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-SDEYVLLSEKDILAVV 102


>gi|15599582|ref|NP_253076.1| co-chaperonin GroES [Pseudomonas aeruginosa PAO1]
 gi|107100029|ref|ZP_01363947.1| hypothetical protein PaerPA_01001050 [Pseudomonas aeruginosa PACS2]
 gi|116052421|ref|YP_792732.1| co-chaperonin GroES [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988628|ref|YP_001350293.1| co-chaperonin GroES [Pseudomonas aeruginosa PA7]
 gi|218893477|ref|YP_002442346.1| co-chaperonin GroES [Pseudomonas aeruginosa LESB58]
 gi|254238951|ref|ZP_04932274.1| GroES protein [Pseudomonas aeruginosa C3719]
 gi|254244803|ref|ZP_04938125.1| GroES protein [Pseudomonas aeruginosa 2192]
 gi|296391094|ref|ZP_06880569.1| co-chaperonin GroES [Pseudomonas aeruginosa PAb1]
 gi|313106917|ref|ZP_07793120.1| GroES protein [Pseudomonas aeruginosa 39016]
 gi|231747|sp|P30720|CH10_PSEAE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|122257574|sp|Q02H54|CH10_PSEAB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198397|sp|A6VB58|CH10_PSEA7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226704025|sp|B7UZG4|CH10_PSEA8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|9950616|gb|AAG07774.1|AE004854_10 GroES protein [Pseudomonas aeruginosa PAO1]
 gi|151242|gb|AAA25829.1| heat shock protein [Pseudomonas aeruginosa]
 gi|999193|gb|AAB34345.1| GroES [Pseudomonas aeruginosa]
 gi|115587642|gb|ABJ13657.1| Hsp10 protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170882|gb|EAZ56393.1| GroES protein [Pseudomonas aeruginosa C3719]
 gi|126198181|gb|EAZ62244.1| GroES protein [Pseudomonas aeruginosa 2192]
 gi|150963786|gb|ABR85811.1| GroES protein [Pseudomonas aeruginosa PA7]
 gi|218773705|emb|CAW29519.1| GroES protein [Pseudomonas aeruginosa LESB58]
 gi|310879622|gb|EFQ38216.1| GroES protein [Pseudomonas aeruginosa 39016]
          Length = 97

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGEE LVM ES+I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVL 95


>gi|254383116|ref|ZP_04998470.1| chaperonin [Streptomyces sp. Mg1]
 gi|194342015|gb|EDX22981.1| chaperonin [Streptomyces sp. Mg1]
          Length = 102

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G+ + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGQRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V+ GD+VL+ K+ GTE+K N GEEYLV+   D++ IV
Sbjct: 63  LDVTVGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAIV 100


>gi|182436563|ref|YP_001824282.1| co-chaperonin GroES [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|239943650|ref|ZP_04695587.1| co-chaperonin GroES [Streptomyces roseosporus NRRL 15998]
 gi|239990101|ref|ZP_04710765.1| co-chaperonin GroES [Streptomyces roseosporus NRRL 11379]
 gi|282860873|ref|ZP_06269939.1| chaperonin Cpn10 [Streptomyces sp. ACTE]
 gi|291447115|ref|ZP_06586505.1| heat shock protein 18 [Streptomyces roseosporus NRRL 15998]
 gi|326777186|ref|ZP_08236451.1| 10 kDa chaperonin [Streptomyces cf. griseus XylebKG-1]
 gi|226704046|sp|B1W3U3|CH10_STRGG RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|178465079|dbj|BAG19599.1| putative GroES [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|282564609|gb|EFB70145.1| chaperonin Cpn10 [Streptomyces sp. ACTE]
 gi|291350062|gb|EFE76966.1| heat shock protein 18 [Streptomyces roseosporus NRRL 15998]
 gi|320009042|gb|ADW03892.1| Chaperonin Cpn10 [Streptomyces flavogriseus ATCC 33331]
 gi|326657519|gb|EGE42365.1| 10 kDa chaperonin [Streptomyces cf. griseus XylebKG-1]
          Length = 102

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N GEEYLV+   D++ IV
Sbjct: 66  KTGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAIV 100


>gi|146299604|ref|YP_001194195.1| co-chaperonin GroES [Flavobacterium johnsoniae UW101]
 gi|146154022|gb|ABQ04876.1| chaperonin Cpn10 [Flavobacterium johnsoniae UW101]
          Length = 91

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G I IPDT  EKP    G ++ VG G  D +  V     
Sbjct: 5   IKPLSDRVLIEPVAAETKTASG-IFIPDTAKEKPQ--KGTVVAVGNGSKDHTMTV----- 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G +YL+M+E DI+ I+
Sbjct: 57  KVGDTVLYGKYAGTELKL-EGTDYLIMREDDILAII 91


>gi|328884487|emb|CCA57726.1| Heat shock protein 60 family co-chaperone GroES [Streptomyces
           venezuelae ATCC 10712]
          Length = 102

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N GEEYLV+   D++ IV
Sbjct: 66  KTGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAIV 100


>gi|160872034|ref|ZP_02062166.1| chaperonin GroS [Rickettsiella grylli]
 gi|159120833|gb|EDP46171.1| chaperonin GroS [Rickettsiella grylli]
          Length = 106

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   R++V+R   E K+  G I+IPDT  EKP    G ++ VG G   +SG++    +
Sbjct: 13  LVPMNDRILVKRDDEEEKS-VGGIVIPDTAKEKPV--RGLVVAVGNGKRLKSGQIQALTI 69

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD + FGK+SGTEIKL DG+EYL+M+E D++ ++
Sbjct: 70  KVGDKIYFGKYSGTEIKL-DGKEYLIMREDDVLALI 104


>gi|302524075|ref|ZP_07276417.1| chaperonin GroS [Streptomyces sp. AA4]
 gi|302432970|gb|EFL04786.1| chaperonin GroS [Streptomyces sp. AA4]
          Length = 97

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G ++IPDT  EKP    G+++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDKIVVQTSEAEETTASG-LVIPDTAKEKPQ--EGKVLAVGPGRIDDKGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+V++ K+ GTE+K N GE+YL++   D++ ++
Sbjct: 62  AVGDVVIYSKYGGTEVKYN-GEDYLILSARDVLAVI 96


>gi|306820910|ref|ZP_07454530.1| chaperone GroES [Eubacterium yurii subsp. margaretiae ATCC 43715]
 gi|304551024|gb|EFM38995.1| chaperone GroES [Eubacterium yurii subsp. margaretiae ATCC 43715]
          Length = 94

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           +RP   RVV+++L++E KT  G IL   T S K      E++ VG  G++D  GK ++ E
Sbjct: 3   IRPLADRVVIKKLEAEEKTKGGIIL---TGSAKEQPQEAEVVEVGPGGIVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V KGD VLF K++GTE+K+ DG+EY ++++SDI+ IV
Sbjct: 58  VKKGDKVLFSKYAGTEVKI-DGQEYTILRQSDILAIV 93


>gi|3913226|sp|O33499|CH10_PSEST RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock protein 10; AltName:
           Full=Protein Cpn10
 gi|2564287|emb|CAA74153.1| Hsp10 protein [Pseudomonas stutzeri]
          Length = 97

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95


>gi|194476696|ref|YP_002048875.1| co-chaperonin GroES [Paulinella chromatophora]
 gi|171191703|gb|ACB42665.1| co-chaperonin GroES [Paulinella chromatophora]
          Length = 103

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ V+  +SE KTA G I +PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRIFVKISESEEKTA-GGIFLPDTAQEKPQV--GEVVQVGPGKRNDDGSRQSPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++GT+IKL   ++Y+++ E DI+ +V
Sbjct: 68  SIGDKVLYSKYAGTDIKLG-SDDYVLLSEKDILAVV 102


>gi|332798400|ref|YP_004459899.1| 10 kDa chaperonin [Tepidanaerobacter sp. Re1]
 gi|332696135|gb|AEE90592.1| 10 kDa chaperonin [Tepidanaerobacter sp. Re1]
          Length = 94

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 68/97 (70%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           ++P   R+V++ L+ E +T  G I++PDT  EKP    GE++ VG+G ++D  GK +  E
Sbjct: 3   IKPLGDRIVIKVLEEEERT-KGGIVLPDTAKEKPQ--KGEVVAVGSGEIID--GKKVPLE 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD ++F K++GTE+KL D EEYL++++SD++ I+
Sbjct: 58  VKVGDKIIFSKYAGTEVKL-DSEEYLILRQSDVLAIL 93


>gi|302543274|ref|ZP_07295616.1| chaperonin GroS [Streptomyces hygroscopicus ATCC 53653]
 gi|302460892|gb|EFL23985.1| chaperonin GroS [Streptomyces himastatinicus ATCC 53653]
          Length = 102

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ +++E  TA+G ++IPDT  EKP    G ++ VG G   + GK + 
Sbjct: 7   KVAIKPLEDRIVVQAVEAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGKRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +VS GD+VL+ K+ GTE+K + GEEYLV+   D++ IV
Sbjct: 63  LDVSVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAIV 100


>gi|300782693|ref|YP_003762984.1| chaperonin GroES [Amycolatopsis mediterranei U32]
 gi|299792207|gb|ADJ42582.1| chaperonin GroES [Amycolatopsis mediterranei U32]
          Length = 97

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   ++VV+  ++E  TA+G ++IPDT  EKP    G+++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDKIVVQTSEAEETTASG-LVIPDTAKEKPQ--EGKVLAVGPGRIDDKGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD+V++ K+ GTE+K N GE+YL++   D++ ++
Sbjct: 62  NVGDVVIYSKYGGTEVKYN-GEDYLILSARDVLAVI 96


>gi|1345749|sp|P48226|CH10_PSEPU RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|468559|emb|CAA55198.1| GroES [Pseudomonas putida]
          Length = 97

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G + ++G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRILENGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95


>gi|126651449|ref|ZP_01723653.1| co-chaperonin GroES [Bacillus sp. B14905]
 gi|126591702|gb|EAZ85798.1| co-chaperonin GroES [Bacillus sp. B14905]
          Length = 94

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R+V+  ++ E K+A G I++PD+  EKP    G+++ VG G + ++G+ +E +V
Sbjct: 2   LRPLGDRIVIELIEVEEKSAFG-IVLPDSAKEKPQ--EGKVVAVGTGRVLENGQRVELDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D ++F K++GTE+K  +G EYL+++ESDI+ I+
Sbjct: 59  KVDDHIIFSKYAGTEVKF-EGNEYLILRESDILAII 93


>gi|311896512|dbj|BAJ28920.1| putative 10 kDa chaperonin [Kitasatospora setae KM-6054]
          Length = 101

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (61%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + 
Sbjct: 1   MTTSSKVAIKPLEDRIVVQPLDAETTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G+ +  +V+ GDIVL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 57  GQRLPLDVAVGDIVLYSKYGGTEVKYQ-GEEYLVLSARDVLAII 99


>gi|124004892|ref|ZP_01689735.1| chaperonin GroS [Microscilla marina ATCC 23134]
 gi|123989570|gb|EAY29116.1| chaperonin GroS [Microscilla marina ATCC 23134]
          Length = 89

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV+V   ++E KTA+G I+IPDT  EKP    G+I+ VG G  D      EP  
Sbjct: 3   IKPLADRVLVEPAEAEEKTASG-IIIPDTAKEKPQ--RGKIVAVGNGKKD------EPLT 53

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK++GTEI + +G+EYL+M+E+DI  IV
Sbjct: 54  VQAGDQVLYGKYAGTEITV-EGKEYLIMREADIFAIV 89


>gi|83815796|ref|YP_446227.1| chaperonin, 10 kDa [Salinibacter ruber DSM 13855]
 gi|83757190|gb|ABC45303.1| chaperonin, 10 kDa [Salinibacter ruber DSM 13855]
          Length = 96

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+   +E KT +G + IPD+  EKP    G ++  G G + + G  IE  V
Sbjct: 4   IKPLGDRVVVQPKPAEEKTESG-LYIPDSAKEKPQ--EGTVVATGPGRV-EDGTRIEMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+GK++GTE+ L DG+EYL+M+ESDI G+V
Sbjct: 60  EEGDDVLYGKYAGTEVTL-DGDEYLIMRESDIFGVV 94


>gi|332970162|gb|EGK09156.1| chaperone GroES [Desmospora sp. 8437]
          Length = 108

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 70/98 (71%), Gaps = 5/98 (5%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           + ++P   RVV++ ++ E KTA+G I++P+T  EKP    G+++ VG G   ++G+ ++ 
Sbjct: 15  DVIKPLGDRVVLQAIEQEEKTASG-IVLPETAKEKPQ--EGKVVAVGTGRY-ENGQKVDL 70

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           EV +GD V+F K++GTE+K+ D  EYL+++ESDI+ ++
Sbjct: 71  EVKEGDRVIFSKYAGTEVKVGD-TEYLILRESDILAVL 107


>gi|309810955|ref|ZP_07704755.1| chaperonin GroS [Dermacoccus sp. Ellin185]
 gi|308435109|gb|EFP58941.1| chaperonin GroS [Dermacoccus sp. Ellin185]
          Length = 97

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPDT  EKP    GE++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDRIVVKAVEAEQTTASG-LVIPDTAKEKPQ--EGEVIAVGPGRIDDHGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K   G EYL++   D++ +V
Sbjct: 62  AVGDKVIYSKYGGTEVKFA-GTEYLILSARDVLAVV 96


>gi|302558933|ref|ZP_07311275.1| chaperonin GroS [Streptomyces griseoflavus Tu4000]
 gi|302476551|gb|EFL39644.1| chaperonin GroS [Streptomyces griseoflavus Tu4000]
          Length = 102

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V+ GDIVL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 63  LDVAVGDIVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|120402503|ref|YP_952332.1| co-chaperonin GroES [Mycobacterium vanbaalenii PYR-1]
 gi|145225501|ref|YP_001136179.1| co-chaperonin GroES [Mycobacterium gilvum PYR-GCK]
 gi|315445854|ref|YP_004078733.1| Co-chaperonin GroES [Mycobacterium sp. Spyr1]
 gi|166198388|sp|A1T576|CH10_MYCVP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189044110|sp|A4TEN7|CH10_MYCGI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|119955321|gb|ABM12326.1| chaperonin Cpn10 [Mycobacterium vanbaalenii PYR-1]
 gi|145217987|gb|ABP47391.1| chaperonin Cpn10 [Mycobacterium gilvum PYR-GCK]
 gi|315264157|gb|ADU00899.1| Co-chaperonin GroES [Mycobacterium sp. Spyr1]
          Length = 100

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD+V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VSEGDVVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|221195407|ref|ZP_03568462.1| chaperonin GroS [Atopobium rimae ATCC 49626]
 gi|221184594|gb|EEE16986.1| chaperonin GroS [Atopobium rimae ATCC 49626]
          Length = 96

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+    E KT+TG + I     EKP    GE++ VGAG  DQ GK I  +V
Sbjct: 3   LKPLGDRVLVKPAPKEEKTSTG-LYIASAAQEKPQ--RGEVLAVGAGKYDQDGKRIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V +GK+ GTE+K+ DGEE L+++  DI  IV
Sbjct: 60  KVGDQVFYGKFGGTEVKV-DGEELLLLRADDIYAIV 94


>gi|29831534|ref|NP_826168.1| co-chaperonin GroES [Streptomyces avermitilis MA-4680]
 gi|60389757|sp|Q820G1|CH10_STRAW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|29608650|dbj|BAC72703.1| putative GroES [Streptomyces avermitilis MA-4680]
          Length = 102

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V+ GD+VL+ K+ GTE+K N GEEYLV+   D++ IV
Sbjct: 63  LDVTVGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAIV 100


>gi|315605959|ref|ZP_07880990.1| chaperone GroES [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315312241|gb|EFU60327.1| chaperone GroES [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 98

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+R++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIRQVEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ ++ GTE+K  DG+E+ ++   D++ +V
Sbjct: 62  KVGDTVIYSRYGGTEVKY-DGQEFQILSSRDVLAVV 96


>gi|255534423|ref|YP_003094794.1| Heat shock protein 60 family co-chaperone GroES [Flavobacteriaceae
           bacterium 3519-10]
 gi|255340619|gb|ACU06732.1| Heat shock protein 60 family co-chaperone GroES [Flavobacteriaceae
           bacterium 3519-10]
          Length = 113

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE- 67
            +P   RV+V    +E  TA+G I+IPDT  EKP    G ++ VG G  D      EP  
Sbjct: 26  FKPLADRVLVEPNAAETTTASG-IIIPDTAKEKPQ--EGTVIAVGPGKKD------EPTT 76

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD VL+GK+SG+E+KL DG++YL+++ESDI+GI+
Sbjct: 77  VAVGDKVLYGKYSGSELKL-DGKDYLIVKESDILGII 112


>gi|169832149|ref|YP_001718131.1| chaperonin Cpn10 [Candidatus Desulforudis audaxviator MP104C]
 gi|169638993|gb|ACA60499.1| chaperonin Cpn10 [Candidatus Desulforudis audaxviator MP104C]
          Length = 94

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++ L  E +   G I++PDT  EKP    GE++ VG G +  +G+ +  ++
Sbjct: 2   IRPLGERVVIKPLPLE-EVTKGGIVLPDTAKEKPQ--KGEVVAVGPGRLLDNGQRVAIDL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++G E+K+ DGEEYL+++E+D++G++
Sbjct: 59  KVGDQVLYSKYAGNEVKI-DGEEYLILRENDVLGVL 93


>gi|239979986|ref|ZP_04702510.1| co-chaperonin GroES [Streptomyces albus J1074]
 gi|291451843|ref|ZP_06591233.1| heat shock protein 18 [Streptomyces albus J1074]
 gi|231748|sp|Q00769|CH10_STRAL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|295176|gb|AAA26752.1| GROES protein [Streptomyces albus]
 gi|291354792|gb|EFE81694.1| heat shock protein 18 [Streptomyces albus J1074]
          Length = 102

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 66  KTGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|80688|pir||A41325 heat shock protein 18 - Streptomyces albus
          Length = 102

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N GEEYLV+   D++ I+
Sbjct: 66  KTGDVVLYSKYGGTEVKYN-GEEYLVLSARDVLAII 100


>gi|299534451|ref|ZP_07047784.1| co-chaperonin GroES [Lysinibacillus fusiformis ZC1]
 gi|298730079|gb|EFI70621.1| co-chaperonin GroES [Lysinibacillus fusiformis ZC1]
          Length = 94

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R+V+  ++ E K+A G I++PD+  EKP    G+++ VG G + ++G+ +E +V
Sbjct: 2   LRPLGDRIVIELIEVEEKSAFG-IVLPDSAKEKPQ--EGKVVAVGTGRVLENGQRVELDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D ++F K++GTE+K  +G EYL+++ESDI+ I+
Sbjct: 59  KVDDRIIFSKYAGTEVKF-EGNEYLILRESDILAII 93


>gi|169630811|ref|YP_001704460.1| co-chaperonin GroES [Mycobacterium abscessus ATCC 19977]
 gi|169242778|emb|CAM63806.1| 10 kDa chaperonin (GroES) [Mycobacterium abscessus]
          Length = 99

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 5   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 61

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD+V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 62  VSEGDVVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 97


>gi|289549214|ref|YP_003474202.1| chaperonin Cpn10 [Thermocrinis albus DSM 14484]
 gi|289182831|gb|ADC90075.1| chaperonin Cpn10 [Thermocrinis albus DSM 14484]
          Length = 98

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   ++VV+R + + +     I+IPDT  EKP    GE++ VG G +  +G+++  +V
Sbjct: 4   LVPLYDKIVVKRQEEQEQRTAAGIIIPDTAKEKPQI--GEVVAVGEGKLLNNGQIVPLKV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GTE++L DGE+YL+M + +++ I+
Sbjct: 62  KVGDKVVFNKYAGTEVEL-DGEKYLIMSQDEVLAIL 96


>gi|257068052|ref|YP_003154307.1| Co-chaperonin GroES [Brachybacterium faecium DSM 4810]
 gi|256558870|gb|ACU84717.1| Co-chaperonin GroES [Brachybacterium faecium DSM 4810]
          Length = 98

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ L++E  TA+G ++IPDT  EKP    GE++ VGAG  +  G+ +  +V
Sbjct: 5   IKPLEDRVVVKPLEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGAGRFNDKGERVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+ GTE+K  + EE+LV+   DI+ ++
Sbjct: 62  QVGDKVVFSKYGGTELKYGN-EEFLVLGTRDILAVI 96


>gi|183601924|ref|ZP_02963293.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis HN019]
 gi|219682838|ref|YP_002469221.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis AD011]
 gi|241190414|ref|YP_002967808.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241195820|ref|YP_002969375.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|254813827|sp|B8DVZ4|CH10_BIFA0 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|50956439|gb|AAT90747.1| HSP10 [Bifidobacterium animalis subsp. lactis]
 gi|183218809|gb|EDT89451.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis HN019]
 gi|219620488|gb|ACL28645.1| HSP10 [Bifidobacterium animalis subsp. lactis AD011]
 gi|240248806|gb|ACS45746.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240250374|gb|ACS47313.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|289178137|gb|ADC85383.1| 10 kDa chaperonin GROES [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295793401|gb|ADG32936.1| co-chaperonin GroES [Bifidobacterium animalis subsp. lactis V9]
          Length = 98

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ ++E +TA+G ++IPD   EKP    GE++ VG G  D  GK +  +V
Sbjct: 5   LTPLEDKIIVKQAEAETQTASG-LIIPDNAKEKPQ--QGEVLAVGPGRRDDEGKRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+    GEEYL++   D++ +V
Sbjct: 62  KVGDKVLYSKYGGTEVHFK-GEEYLIVSARDLLAVV 96


>gi|210630464|ref|ZP_03296467.1| hypothetical protein COLSTE_00352 [Collinsella stercoris DSM 13279]
 gi|210160466|gb|EEA91437.1| hypothetical protein COLSTE_00352 [Collinsella stercoris DSM 13279]
          Length = 126

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++   +E KTA+G + I     EKP    G ++ VGAG M+  G+ +  +V
Sbjct: 34  LKPLADRVLIKPDAAEQKTASG-LYIASNAQEKPQ--RGTVIAVGAGKMNDKGERMPLDV 90

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GDIV++GK+ G EIK+ DGE+YL+M+  DI  +V
Sbjct: 91  HEGDIVIYGKFGGNEIKV-DGEDYLLMRADDIYAVV 125


>gi|296130426|ref|YP_003637676.1| Chaperonin Cpn10 [Cellulomonas flavigena DSM 20109]
 gi|296022241|gb|ADG75477.1| Chaperonin Cpn10 [Cellulomonas flavigena DSM 20109]
          Length = 97

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ +++E  TA+G ++IPD+  +KP    GE++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDRIVVKAVEAETTTASG-LVIPDSAKDKPQ--EGEVLAVGPGRIDDKGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K + GEE+L++   D++ IV
Sbjct: 62  AVGDKVIYSKYGGTEVKYS-GEEFLILSARDVLAIV 96


>gi|89896707|ref|YP_520194.1| hypothetical protein DSY3961 [Desulfitobacterium hafniense Y51]
 gi|219667462|ref|YP_002457897.1| co-chaperonin GroES [Desulfitobacterium hafniense DCB-2]
 gi|123091651|sp|Q24QE2|CH10_DESHY RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813840|sp|B8FNT6|CH10_DESHD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|89336155|dbj|BAE85750.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219537722|gb|ACL19461.1| chaperonin Cpn10 [Desulfitobacterium hafniense DCB-2]
          Length = 94

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++ L  E KT +G I++PDT  EKP    GE++ VG G M++  +++  +V
Sbjct: 3   IKPLGDRVVIKALPMEEKTKSG-IIMPDTAKEKPQ--EGEVVAVGPGKMEKGERIVL-DV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K++GTE+K  DG+EYL+++E+DI+ ++
Sbjct: 59  KVGDRVIYSKYAGTEVKY-DGQEYLILKETDILAVI 93


>gi|167035480|ref|YP_001670711.1| co-chaperonin GroES [Pseudomonas putida GB-1]
 gi|189044115|sp|B0KFQ3|CH10_PSEPG RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166861968|gb|ABZ00376.1| chaperonin Cpn10 [Pseudomonas putida GB-1]
          Length = 97

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G + ++G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRILENGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95


>gi|290958088|ref|YP_003489270.1| 10 kD chaperonin cpn10 [Streptomyces scabiei 87.22]
 gi|260647614|emb|CBG70719.1| 10 kD chaperonin cpn10 [Streptomyces scabiei 87.22]
          Length = 102

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G I+ VG G   ++G+ +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVILAVGPGRF-ENGERLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVL+ K+ GTE+K N GEEYLV+   D++ ++
Sbjct: 66  KVGDIVLYSKYGGTEVKYN-GEEYLVLSSRDVLAVI 100


>gi|255012384|ref|ZP_05284510.1| co-chaperonin GroES [Bacteroides sp. 2_1_7]
          Length = 89

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+++   +E KT  G I+IPD+  EKP    GEI+ VG G  D+     E  V
Sbjct: 3   IRPLADRVLIKPAVAEEKT-LGGIIIPDSAKEKPL--KGEIVAVGNGTKDE-----EMVV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTEI+L DGE+YL+M+++D++ I+
Sbjct: 55  KVGDNVLYGKYAGTEIEL-DGEKYLIMRQADVLAII 89


>gi|284035905|ref|YP_003385835.1| chaperonin Cpn10 [Spirosoma linguale DSM 74]
 gi|283815198|gb|ADB37036.1| chaperonin Cpn10 [Spirosoma linguale DSM 74]
          Length = 98

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 14/108 (12%)

Query: 1   MVGEHKNY---LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVM 57
           MV E ++    ++P   RV+V    +E KT+ G I+IPDT  EKP    G ++ VGAG  
Sbjct: 1   MVAETESVKVNVKPLADRVLVEAAPAEEKTSFG-IIIPDTAKEKPQ--RGTVVAVGAGKK 57

Query: 58  DQSGKVIEP-EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           D      EP  V  GD VL+GK++GTEI + DG+EYL+M+ESDI  I+
Sbjct: 58  D------EPLTVQVGDTVLYGKYAGTEITV-DGKEYLIMRESDIFAIL 98


>gi|258651446|ref|YP_003200602.1| chaperonin Cpn10 [Nakamurella multipartita DSM 44233]
 gi|258554671|gb|ACV77613.1| chaperonin Cpn10 [Nakamurella multipartita DSM 44233]
          Length = 99

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V   ++E  TA+G I+IPDT  EKP    G ++ VG G  D SGK I  +V
Sbjct: 6   IQPLEDKILVEANEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRYDDSGKRIPIDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V++ K+ GTE+K + G+EYL++   D++  V
Sbjct: 63  AEGDVVIYSKYGGTEVKYS-GKEYLLLSARDVLAKV 97


>gi|146308702|ref|YP_001189167.1| co-chaperonin GroES [Pseudomonas mendocina ymp]
 gi|166198398|sp|A4XYL9|CH10_PSEMY RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|145576903|gb|ABP86435.1| chaperonin Cpn10 [Pseudomonas mendocina ymp]
          Length = 97

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G + ++G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--QGEVVAVGTGKVLENGEVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMGENEILAVI 95


>gi|116073663|ref|ZP_01470925.1| co-chaperonin GroES [Synechococcus sp. RS9916]
 gi|116068968|gb|EAU74720.1| co-chaperonin GroES [Synechococcus sp. RS9916]
          Length = 103

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++   SE +T  G IL+PDT  EKP    GE++ VG G  +  G    PEV
Sbjct: 11  VKPLGDRIFIKVSASE-ETTAGGILLPDTAKEKPQV--GEVVQVGPGKRNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+EY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-GDEYVLLSEKDILAVV 102


>gi|3057150|gb|AAC14026.1| chaperonin 10 [Arabidopsis thaliana]
          Length = 254

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV ++  ++E KTA G +L+ +T  EKPS   G ++ VG G +D+ GK+    V
Sbjct: 161 LKPLNDRVFIKVAEAEEKTA-GGLLLTETTKEKPSI--GTVIAVGPGSLDEEGKITPLPV 217

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G + K  DG  Y+ ++ SD+M I+
Sbjct: 218 STGSTVLYSKYAGNDFKGKDGSNYIALRASDVMAIL 253



 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      ++P   RV+V+  ++E KT  G +    T   KP    GE++ VG G     
Sbjct: 54  VVAPKYTSIKPLGDRVLVKIKEAEEKTLGGILTFHSTAQSKPQG--GEVVAVGEGRTIGK 111

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
            K I+  V  G  +++ K++GTE++ ND  ++L+++E DI+GI+  E
Sbjct: 112 NK-IDITVPTGAQIIYSKYAGTEVEFND-VKHLILKEDDIVGILETE 156


>gi|300776092|ref|ZP_07085951.1| chaperone GroES [Chryseobacterium gleum ATCC 35910]
 gi|300505225|gb|EFK36364.1| chaperone GroES [Chryseobacterium gleum ATCC 35910]
          Length = 92

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V  + +E KTA+G I+IPDT  EKP    G ++ VG G  D+   V     
Sbjct: 5   FKPLADRVLVEPIAAETKTASG-IIIPDTAKEKPQ--EGTVVAVGPGKKDEPTTV----- 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SG+E+KL +G++YL+++E+D++GI+
Sbjct: 57  QVGDKVLYGKYSGSELKL-EGKDYLIVREADLLGII 91


>gi|325274983|ref|ZP_08140983.1| co-chaperonin GroES [Pseudomonas sp. TJI-51]
 gi|324099890|gb|EGB97736.1| co-chaperonin GroES [Pseudomonas sp. TJI-51]
          Length = 97

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G + ++G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLENGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95


>gi|253681140|ref|ZP_04861943.1| chaperonin GroS [Clostridium botulinum D str. 1873]
 gi|253562989|gb|EES92435.1| chaperonin GroS [Clostridium botulinum D str. 1873]
          Length = 94

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 70/97 (72%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           ++P   RVV++RL++E KT +G I++P +  EKP  +  EI+ VG  G++D  GK ++ E
Sbjct: 3   IKPLGDRVVIKRLEAEEKTKSG-IVLPGSAKEKPQEA--EIVAVGPGGIVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLF +++G E+K+ DGEEY++++++DI+ IV
Sbjct: 58  VKVGDRVLFSQYAGNEVKI-DGEEYIILRQNDILAIV 93


>gi|15242045|ref|NP_197572.1| CPN20 (CHAPERONIN 20); calmodulin binding [Arabidopsis thaliana]
 gi|30687936|ref|NP_851045.1| CPN20 (CHAPERONIN 20); calmodulin binding [Arabidopsis thaliana]
 gi|297808145|ref|XP_002871956.1| hypothetical protein ARALYDRAFT_488978 [Arabidopsis lyrata subsp.
           lyrata]
 gi|12643263|sp|O65282|CH10C_ARATH RecName: Full=20 kDa chaperonin, chloroplastic; AltName:
           Full=Chaperonin 10; Short=Ch-CPN10; Short=Cpn10;
           AltName: Full=Chaperonin 20; AltName: Full=Protein
           Cpn21; Flags: Precursor
 gi|10179872|gb|AAG13931.1|AF268068_1 chaperonin 10 [Arabidopsis thaliana]
 gi|16226815|gb|AAL16269.1|AF428339_1 AT5g20720/T1M15_120 [Arabidopsis thaliana]
 gi|16226911|gb|AAL16296.1|AF428366_1 AT5g20720/T1M15_120 [Arabidopsis thaliana]
 gi|4127456|emb|CAA09368.1| Cpn21 protein [Arabidopsis thaliana]
 gi|14334612|gb|AAK59484.1| putative chloroplast Cpn21 protein [Arabidopsis thaliana]
 gi|14587373|dbj|BAB61619.1| chaperonin 20 [Arabidopsis thaliana]
 gi|17065646|gb|AAL33817.1| putative chloroplast Cpn21 protein [Arabidopsis thaliana]
 gi|297317793|gb|EFH48215.1| hypothetical protein ARALYDRAFT_488978 [Arabidopsis lyrata subsp.
           lyrata]
 gi|332005498|gb|AED92881.1| chaperonin 20 [Arabidopsis thaliana]
 gi|332005499|gb|AED92882.1| chaperonin 20 [Arabidopsis thaliana]
 gi|332005500|gb|AED92883.1| chaperonin 20 [Arabidopsis thaliana]
          Length = 253

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV ++  ++E KTA G +L+ +T  EKPS   G ++ VG G +D+ GK+    V
Sbjct: 160 LKPLNDRVFIKVAEAEEKTA-GGLLLTETTKEKPSI--GTVIAVGPGSLDEEGKITPLPV 216

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G + K  DG  Y+ ++ SD+M I+
Sbjct: 217 STGSTVLYSKYAGNDFKGKDGSNYIALRASDVMAIL 252



 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 5/107 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      ++P   RV+V+  ++E KT  G IL+P T   KP    GE++ VG G     
Sbjct: 54  VVAPKYTSIKPLGDRVLVKIKEAEEKT-LGGILLPSTAQSKPQG--GEVVAVGEGRTIGK 110

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
            K I+  V  G  +++ K++GTE++ ND  ++L+++E DI+GI+  E
Sbjct: 111 NK-IDITVPTGAQIIYSKYAGTEVEFND-VKHLILKEDDIVGILETE 155


>gi|291612658|ref|YP_003522815.1| Chaperonin Cpn10 [Sideroxydans lithotrophicus ES-1]
 gi|291582770|gb|ADE10428.1| Chaperonin Cpn10 [Sideroxydans lithotrophicus ES-1]
          Length = 96

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R+++E KTA+G I+IPD  +EKP    G ++ VG G M   GK+    V
Sbjct: 3   IRPLGDRVIVKRMEAETKTASG-IIIPDAATEKPD--QGVVVAVGNGKMGDDGKLRPMNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K  G + K+ DG E L M+E DI+G++
Sbjct: 60  KVGDKVMFAKTYGQDFKM-DGVELLQMREEDIIGVI 94


>gi|170720153|ref|YP_001747841.1| co-chaperonin GroES [Pseudomonas putida W619]
 gi|226704026|sp|B1J3K4|CH10_PSEPW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|169758156|gb|ACA71472.1| chaperonin Cpn10 [Pseudomonas putida W619]
          Length = 97

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRILDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVV 95


>gi|320094506|ref|ZP_08026279.1| chaperone GroES [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319978569|gb|EFW10139.1| chaperone GroES [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 98

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+R++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIRQVEAEQTTASG-LVIPDTAKEKPQ--EGEVIAVGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ ++ GTE+K  +G+EY ++   D++ +V
Sbjct: 62  KVGDTVIYSRYGGTEVKY-EGQEYQILSSRDVLAVV 96


>gi|328851878|gb|EGG01028.1| hypothetical protein MELLADRAFT_111284 [Melampsora larici-populina
           98AG31]
          Length = 104

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 61/94 (64%), Gaps = 3/94 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRPT  RV+V+RL+ E KTA+G I +P +V+EK S     ++ VG G  D+ GK+I  EV
Sbjct: 11  LRPTLDRVLVQRLKPETKTASG-IFLPSSVTEK-STPEATVLAVGPGNRDRDGKLIPMEV 68

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
            +GD VL   + G  IK+ + EEY + ++S+IM 
Sbjct: 69  KEGDKVLLPSYGGQSIKVGE-EEYHLFRDSEIMA 101


>gi|284033901|ref|YP_003383832.1| chaperonin Cpn10 [Kribbella flavida DSM 17836]
 gi|283813194|gb|ADB35033.1| chaperonin Cpn10 [Kribbella flavida DSM 17836]
          Length = 98

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V  L++E  T +G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRILVAPLEAEQTTKSG-LVIPDTAKEKPQ--EGEVLAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K  DG++YL++   DI+ IV
Sbjct: 62  AVGDKVIYSKYGGTEVKY-DGQDYLILGARDILAIV 96


>gi|331270380|ref|YP_004396872.1| chaperonin Cpn10 [Clostridium botulinum BKT015925]
 gi|329126930|gb|AEB76875.1| chaperonin Cpn10 [Clostridium botulinum BKT015925]
          Length = 94

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 69/97 (71%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           ++P   RVV++RL++E KT +G I++P +  EKP  +  EI+ VG  G++D  GK +  E
Sbjct: 3   IKPLGDRVVIKRLEAEEKTKSG-IVLPGSAKEKPQEA--EIVAVGPGGIVD--GKEVNME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLF +++G E+K+ DGEEY++++++DI+ IV
Sbjct: 58  VKVGDKVLFSQYAGNEVKI-DGEEYIILRQNDILAIV 93


>gi|300742007|ref|ZP_07072028.1| chaperonin GroS [Rothia dentocariosa M567]
 gi|311111918|ref|YP_003983140.1| chaperone GroES [Rothia dentocariosa ATCC 17931]
 gi|300381192|gb|EFJ77754.1| chaperonin GroS [Rothia dentocariosa M567]
 gi|310943412|gb|ADP39706.1| chaperone GroES [Rothia dentocariosa ATCC 17931]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+  Q+E  TA+G ++IP+T  EKP      ++ VG G +D  G  +  ++
Sbjct: 3   IKPLEDRVVVKLEQAEQTTASG-LVIPETAKEKPQ--EARVVAVGPGRVDDKGNRVPVDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD+V+F ++ GTE+K   GEEYL++   D++ IV
Sbjct: 60  AEGDVVVFSRYGGTEVKYQ-GEEYLILSARDVLAIV 94


>gi|220913340|ref|YP_002488649.1| co-chaperonin GroES [Arthrobacter chlorophenolicus A6]
 gi|254813822|sp|B8HCE4|CH10_ARTCA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219860218|gb|ACL40560.1| chaperonin Cpn10 [Arthrobacter chlorophenolicus A6]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 64/98 (65%), Gaps = 5/98 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VVR L++E  TA+G +LIPD+  EKP    GE++ VG G   + G  +  +V
Sbjct: 5   IKPLEDRIVVRPLEAEQTTASG-LLIPDSAQEKPQ--EGEVVAVGPGRF-EDGNRVPVDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD+V++ K+ GTE+K   G EYLV+   D++ IVV+
Sbjct: 61  AVGDVVIYSKYGGTEVK-TGGTEYLVLSARDVLAIVVK 97


>gi|295396169|ref|ZP_06806351.1| chaperone GroES [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970957|gb|EFG46850.1| chaperone GroES [Brevibacterium mcbrellneri ATCC 49030]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+R+L++E  TA+G ++IPDT  EKP    GE++ VG G +  +G  +  +V
Sbjct: 5   IKPLEDRIVIRQLEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRVADNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K   G EYLV+   D++ ++
Sbjct: 62  NVGDKVIYSKYGGTEVKYQ-GTEYLVLSARDVLAVI 96


>gi|284047247|ref|YP_003397587.1| chaperonin Cpn10 [Conexibacter woesei DSM 14684]
 gi|283951468|gb|ADB54212.1| chaperonin Cpn10 [Conexibacter woesei DSM 14684]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           L+P   R++VR ++ E  TA+G +++PDT  EKP    G+++ VG G  D+ G K I  +
Sbjct: 3   LKPLGDRLIVRAVEEEETTASG-LVLPDTAKEKPQ--KGKVIAVGDGKWDEDGEKRIPLD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD VL+ K+ GTEIK+ DGE+ LV++ESD++  V
Sbjct: 60  VSEGDEVLYSKYGGTEIKV-DGEDLLVLRESDVLAKV 95


>gi|311744732|ref|ZP_07718529.1| chaperone GroES [Aeromicrobium marinum DSM 15272]
 gi|311312041|gb|EFQ81961.1| chaperone GroES [Aeromicrobium marinum DSM 15272]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++ +++E  TA+G ++IPDT  EKP    G ++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRLVIQAVEAEQTTASG-LVIPDTAKEKPQ--EGNVVAVGPGRVDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V+F K+ GTE+K   GEEYL++   D++ +V
Sbjct: 62  AVGDKVIFSKYGGTEVKYA-GEEYLILSARDVLAVV 96


>gi|254468632|ref|ZP_05082038.1| chaperonin GroS [beta proteobacterium KB13]
 gi|207087442|gb|EDZ64725.1| chaperonin GroS [beta proteobacterium KB13]
          Length = 96

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           +RP   RV+V+R++ E  TA+G I+IP++ S EKP    G I  VG G + + G     +
Sbjct: 3   IRPLHDRVIVKRVEEERTTASG-IVIPESASAEKP--DQGVIEAVGNGKILEDGNTKALD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGK++G  +K+ DGEE LVM+E DIM I+
Sbjct: 60  VKVGDKVLFGKYAGQSVKV-DGEELLVMREDDIMAII 95


>gi|150026024|ref|YP_001296850.1| co-chaperonin GroES [Flavobacterium psychrophilum JIP02/86]
 gi|149772565|emb|CAL44048.1| 10 kDa chaperonin GroES [Flavobacterium psychrophilum JIP02/86]
          Length = 91

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G I IPDT  EKP    G ++ +G G  D      EP  
Sbjct: 5   IKPLADRVLIEPVAAETKTASG-IFIPDTAKEKPQ--KGTVVAIGNGKKD------EPLT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK++GTE+KL +G++YL+M+E DI+ IV
Sbjct: 56  VKVGDSVLYGKYAGTELKL-EGKDYLIMREEDILAIV 91


>gi|254424636|ref|ZP_05038354.1| chaperonin GroS [Synechococcus sp. PCC 7335]
 gi|196192125|gb|EDX87089.1| chaperonin GroS [Synechococcus sp. PCC 7335]
          Length = 104

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (62%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  L+P   RV V+  +S  +TA G I++PD   EKP    GEI  VG G +D+SG    
Sbjct: 8   KATLKPLGDRVFVKVSESAEQTA-GGIILPDAAKEKPQV--GEITAVGPGKVDESGSRQS 64

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +VS GD VL+ K++GTEIK+ +G EY+++ E DI+  V
Sbjct: 65  MDVSVGDKVLYSKYAGTEIKM-EGGEYILLSEKDILATV 102


>gi|70732164|ref|YP_261920.1| co-chaperonin GroES [Pseudomonas fluorescens Pf-5]
 gi|123775847|sp|Q4K763|CH10_PSEF5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|68346463|gb|AAY94069.1| chaperonin, 10 kDa [Pseudomonas fluorescens Pf-5]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95


>gi|26988094|ref|NP_743519.1| co-chaperonin GroES [Pseudomonas putida KT2440]
 gi|148549569|ref|YP_001269671.1| co-chaperonin GroES [Pseudomonas putida F1]
 gi|60389776|sp|Q88N56|CH10_PSEPK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198399|sp|A5W8M7|CH10_PSEP1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|24982820|gb|AAN66983.1|AE016326_9 chaperonin, 10 kDa [Pseudomonas putida KT2440]
 gi|148513627|gb|ABQ80487.1| chaperonin Cpn10 [Pseudomonas putida F1]
 gi|313500414|gb|ADR61780.1| GroES [Pseudomonas putida BIRD-1]
          Length = 97

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ +V
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVV 95


>gi|256852242|ref|ZP_05557628.1| chaperonin GroS [Lactobacillus jensenii 27-2-CHN]
 gi|260661726|ref|ZP_05862637.1| chaperonin GroS [Lactobacillus jensenii 115-3-CHN]
 gi|297205592|ref|ZP_06922988.1| chaperone GroES [Lactobacillus jensenii JV-V16]
 gi|256615288|gb|EEU20479.1| chaperonin GroS [Lactobacillus jensenii 27-2-CHN]
 gi|260547473|gb|EEX23452.1| chaperonin GroS [Lactobacillus jensenii 115-3-CHN]
 gi|297150170|gb|EFH30467.1| chaperone GroES [Lactobacillus jensenii JV-V16]
          Length = 108

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           N L+P   RV+V+  + E +T  G I++     EKP+   GE++ VG+G++   GKV+  
Sbjct: 14  NVLQPIGDRVIVKVKKEEEETV-GGIVLASNAKEKPT--EGEVVAVGSGLVTSEGKVLPM 70

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD V++ K+SGT +K  DGEEYLV+ E DI+ IV
Sbjct: 71  TVKEGDRVVYDKYSGTNVKY-DGEEYLVLHEKDILAIV 107


>gi|254436141|ref|ZP_05049648.1| chaperonin GroS [Nitrosococcus oceani AFC27]
 gi|207089252|gb|EDZ66524.1| chaperonin GroS [Nitrosococcus oceani AFC27]
          Length = 82

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 59/81 (72%), Gaps = 3/81 (3%)

Query: 24  EIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTE 83
           E KT++G I+IPDT +EKP    GE++ VG G + +SG+V   +V  GD VLFGK+SGT+
Sbjct: 3   EEKTSSGGIVIPDTAAEKPI--RGEVVAVGNGKILESGEVRALDVKVGDKVLFGKYSGTD 60

Query: 84  IKLNDGEEYLVMQESDIMGIV 104
           +K+ + EE LVM+E DIM ++
Sbjct: 61  VKV-ESEELLVMREDDIMAVL 80


>gi|269218915|ref|ZP_06162769.1| chaperonin groES [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212026|gb|EEZ78366.1| chaperonin groES [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 142

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+++L++E  TA+G +++PDT  EKP    G+++ VG G +D  G  +  +V
Sbjct: 49  IKPLEDRIVIQQLEAETTTASG-LVLPDTAKEKPQ--EGKVLAVGPGRVDDQGNRVPVDV 105

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V++ K+ GTEIK    +EY+++   D++ +V
Sbjct: 106 KVGDVVIYSKYGGTEIKYG-ADEYIILSSRDVLAVV 140


>gi|213963576|ref|ZP_03391829.1| chaperonin GroS [Capnocytophaga sputigena Capno]
 gi|256819161|ref|YP_003140440.1| chaperonin Cpn10 [Capnocytophaga ochracea DSM 7271]
 gi|315224596|ref|ZP_07866422.1| chaperone GroES [Capnocytophaga ochracea F0287]
 gi|332878181|ref|ZP_08445910.1| chaperonin GroS [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|213953856|gb|EEB65185.1| chaperonin GroS [Capnocytophaga sputigena Capno]
 gi|256580744|gb|ACU91879.1| chaperonin Cpn10 [Capnocytophaga ochracea DSM 7271]
 gi|314945462|gb|EFS97485.1| chaperone GroES [Capnocytophaga ochracea F0287]
 gi|332683919|gb|EGJ56787.1| chaperonin GroS [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 92

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+    +E  TA+G I+IPDT  EKP    G ++ VGAG  D       P  
Sbjct: 6   IKPLADRVVIEPAVAETTTASG-IIIPDTAKEKPQ--KGTVVAVGAGTKDN------PVT 56

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK++GTE+KL +G++YL+M+E+D++ ++
Sbjct: 57  LKVGDTVLYGKYAGTELKL-EGKDYLIMRENDVLAVI 92


>gi|238061028|ref|ZP_04605737.1| hypothetical protein MCAG_01994 [Micromonospora sp. ATCC 39149]
 gi|237882839|gb|EEP71667.1| hypothetical protein MCAG_01994 [Micromonospora sp. ATCC 39149]
          Length = 145

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+  ++E  TA+G I+IPDT  EKP    G ++ VG G +D  G  + 
Sbjct: 49  KVAIKPLEDRIVVQANEAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRIDDKGNRVP 105

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD VL+ K+ GTE+K   GEEYLV+   D++ ++
Sbjct: 106 IDVKVGDTVLYSKYGGTEVKYA-GEEYLVLSARDVLAVI 143


>gi|227538850|ref|ZP_03968899.1| co-chaperonin GroES [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770378|ref|ZP_07080257.1| chaperone GroES [Sphingobacterium spiritivorum ATCC 33861]
 gi|227241359|gb|EEI91374.1| co-chaperonin GroES [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762854|gb|EFK59671.1| chaperone GroES [Sphingobacterium spiritivorum ATCC 33861]
          Length = 91

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RVV+    +E KTA+G I IPDT  EKP   SG ++ VG      SGKV EP  
Sbjct: 5   IKPIGDRVVIEAAPAEEKTASG-IYIPDTAKEKPQ--SGTVVAVG------SGKVDEPLT 55

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK++GTEI   +G+EYL+M+E+DI  ++
Sbjct: 56  VKVGDKVLYGKYAGTEITY-EGKEYLIMREADIYAVL 91


>gi|312199958|ref|YP_004020019.1| Chaperonin Cpn10 [Frankia sp. EuI1c]
 gi|311231294|gb|ADP84149.1| Chaperonin Cpn10 [Frankia sp. EuI1c]
          Length = 101

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G+++ VG G   + 
Sbjct: 1   MTTATKVAIKPLEDRIVVQPSDAETTTASG-IVIPDTAKEKPQ--EGKVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK +  +V  GD+VL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 57  GKRVPLDVKVGDVVLYSKYGGTEVKYA-GEEYLVLSARDVLAII 99


>gi|296138628|ref|YP_003645871.1| chaperonin Cpn10 [Tsukamurella paurometabola DSM 20162]
 gi|296026762|gb|ADG77532.1| chaperonin Cpn10 [Tsukamurella paurometabola DSM 20162]
          Length = 99

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+  ++E  TA+G ++IPDT  EKP   +G ++ VG G + ++G  +   +
Sbjct: 6   IKPLDDKILVKATEAETTTASG-LVIPDTAKEKPQ--TGTVVAVGEGRVTEAGNRVPTGI 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD VLF K+ GTE   N GEEYLV+   D++ ++
Sbjct: 63  NEGDTVLFSKYGGTEFNYN-GEEYLVLSSRDVLAVI 97


>gi|229816727|ref|ZP_04447013.1| hypothetical protein COLINT_03773 [Collinsella intestinalis DSM
           13280]
 gi|229807703|gb|EEP43519.1| hypothetical protein COLINT_03773 [Collinsella intestinalis DSM
           13280]
          Length = 95

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++    E KTA+G + I  +  EKP    G ++ VGAG M+  G+ I  +V
Sbjct: 3   LKPLADRVLIKPDAVEQKTASG-LYIASSAQEKPQ--RGTVVAVGAGKMNDRGERIPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V++GK+ G EIK+ DGEEYL+M+  DI  +V
Sbjct: 60  HEGDVVIYGKFGGNEIKV-DGEEYLLMRADDIYAVV 94


>gi|4730935|gb|AAD28327.1| GroES [Oscillatoria sp. NKBG091600]
          Length = 103

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (61%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT   KP    GEI  VG G  +  G   E EV
Sbjct: 11  VKPLGDRVFVKVNASEEKTA-GGILLPDTAKXKPQV--GEIAAVGPGRRNDDGSRQEVEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VL+ K++GT+IKL+ GEEY+++   DI+ +VV
Sbjct: 68  KVGDKVLYSKYAGTDIKLS-GEEYVLLSXXDILAVVV 103


>gi|312130034|ref|YP_003997374.1| chaperonin cpn10 [Leadbetterella byssophila DSM 17132]
 gi|311906580|gb|ADQ17021.1| Chaperonin Cpn10 [Leadbetterella byssophila DSM 17132]
          Length = 91

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (62%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV+V    +E KTA G I+IPDT  EKP    G ++ VG G  D      EP  
Sbjct: 5   VKPLADRVLVEAAPAEEKTAFG-IIIPDTAKEKPQ--KGTVVAVGPGKKD------EPLT 55

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK+SGTE+ + DG+EYL+M+ESDI  I+
Sbjct: 56  VKVGDTVLYGKYSGTELTV-DGKEYLIMRESDIYAII 91


>gi|29839358|sp|Q8KJ25|CH10_CLOBO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|22036119|dbj|BAC06586.1| GroES homolog [Clostridium botulinum]
          Length = 94

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++RL++E KT +G I++P +  EKP  +  EI+ VG G +   GK +  EV
Sbjct: 3   IKPLGDRVVIKRLEAEEKTKSG-IVLPGSAKEKPQEA--EIVAVGPGGL-VDGKEVNMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF +++G E+K+ DGEEY++++++DI+ IV
Sbjct: 59  KVGDRVLFSQYAGNEVKI-DGEEYIILRQNDILAIV 93


>gi|104783430|ref|YP_609928.1| co-chaperonin GroES [Pseudomonas entomophila L48]
 gi|123255323|sp|Q1I5E1|CH10_PSEE4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|95112417|emb|CAK17144.1| chaperone Hsp10, affects cell division [Pseudomonas entomophila
           L48]
          Length = 97

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEESKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRILDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVI 95


>gi|255326895|ref|ZP_05367971.1| chaperonin GroS [Rothia mucilaginosa ATCC 25296]
 gi|283457602|ref|YP_003362186.1| co-chaperonin GroES [Rothia mucilaginosa DY-18]
 gi|255296112|gb|EET75453.1| chaperonin GroS [Rothia mucilaginosa ATCC 25296]
 gi|283133601|dbj|BAI64366.1| co-chaperonin GroES [Rothia mucilaginosa DY-18]
          Length = 95

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++  Q+E  TA+G ++IP+T  EKP  +   ++ VG G +D+ G  I  ++
Sbjct: 3   IKPLEDRVVIKIEQAEQTTASG-LVIPETAKEKPQEAR--VVAVGPGRVDEKGNRIPVDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V+F ++ GTE+K   GEEYL++   D++ IV
Sbjct: 60  KEGDVVVFSRYGGTEVKYQ-GEEYLILSARDVLAIV 94


>gi|113477731|ref|YP_723792.1| co-chaperonin GroES [Trichodesmium erythraeum IMS101]
 gi|123160205|sp|Q10WQ5|CH10_TRIEI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|110168779|gb|ABG53319.1| chaperonin Cpn10 [Trichodesmium erythraeum IMS101]
          Length = 103

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+PD+  EKP    GE++  G G  +  G   E EV
Sbjct: 11  VKPLGERVFVKVSESEEKTA-GGILLPDSAKEKPQV--GEVVSAGPGKRNDDGTRAEMEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+EY+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GDEYVLLAEKDILAIV 102


>gi|312892370|ref|ZP_07751865.1| Chaperonin Cpn10 [Mucilaginibacter paludis DSM 18603]
 gi|311295154|gb|EFQ72328.1| Chaperonin Cpn10 [Mucilaginibacter paludis DSM 18603]
          Length = 96

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV    +E KTA+G I+IPDT  EKP    G I+ VG G    +G VI P V
Sbjct: 5   IKPLGDRVVVEAAAAEEKTASG-IIIPDTAKEKPQV--GTIVAVGPGRAADTGTVIAPTV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE    +G+EYL+M+ESDI  ++
Sbjct: 62  KVGDKVLYGKYAGTETSY-EGKEYLIMRESDIYAVL 96


>gi|283780794|ref|YP_003371549.1| chaperonin Cpn10 [Pirellula staleyi DSM 6068]
 gi|283439247|gb|ADB17689.1| chaperonin Cpn10 [Pirellula staleyi DSM 6068]
          Length = 99

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+ ++SE +TA G I++PD+  EKP    G ++ VG G + ++G+  E  V
Sbjct: 6   IRPLDDRVVVQPVESEDRTA-GGIVLPDSAKEKPQ--RGTVLAVGPGKLLENGQRGELSV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           S GD V++GK+ GT+I++N G++  +++ESDI+  VVE
Sbjct: 63  SVGDQVIYGKYGGTDIEVN-GDDVKILRESDILAKVVE 99


>gi|168704213|ref|ZP_02736490.1| 10 kDa chaperonin [Gemmata obscuriglobus UQM 2246]
          Length = 102

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 65/100 (65%), Gaps = 4/100 (4%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
           G+ +  L+P   RVV+   ++E KTA G IL+PDT  +KP    G+++ VG G +   G 
Sbjct: 4   GDKQLVLKPLDDRVVLEPTEAEEKTA-GGILLPDTAKQKPQ--QGKVIAVGPGKLTDKGT 60

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
                V  GD VLFGK+SG+++++N G+EY +++ES+I+G
Sbjct: 61  RTVLAVKVGDTVLFGKYSGSDVEVN-GKEYKIVRESEILG 99


>gi|254823100|ref|ZP_05228101.1| co-chaperonin GroES [Mycobacterium intracellulare ATCC 13950]
 gi|296168775|ref|ZP_06850461.1| chaperone GroES [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295896536|gb|EFG76181.1| chaperone GroES [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 100

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VSEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|330504903|ref|YP_004381772.1| co-chaperonin GroES [Pseudomonas mendocina NK-01]
 gi|328919189|gb|AEB60020.1| co-chaperonin GroES [Pseudomonas mendocina NK-01]
          Length = 97

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--QGEVVAVGTGKVLDNGEVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMGENEILAVI 95


>gi|188589840|ref|YP_001919806.1| chaperonin GroS [Clostridium botulinum E3 str. Alaska E43]
 gi|251780014|ref|ZP_04822934.1| chaperonin GroS [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|226701745|sp|B2UZ01|CH10_CLOBA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|188500121|gb|ACD53257.1| chaperonin GroS [Clostridium botulinum E3 str. Alaska E43]
 gi|243084329|gb|EES50219.1| chaperonin GroS [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 94

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           ++P   RVV++RL++E KT +G +L   T S K      E++ VG G ++D  G  IE E
Sbjct: 3   IKPLGNRVVIKRLEAEEKTKSGIVL---TGSAKEVPQEAEVVAVGPGSIVD--GTKIEME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+ K+SGTE+KL DGEEY+++++ DI+ IV
Sbjct: 58  VKVGDKVLYSKYSGTEVKL-DGEEYMILKQDDILAIV 93


>gi|119493452|ref|ZP_01624121.1| co-chaperonin GroES [Lyngbya sp. PCC 8106]
 gi|119452696|gb|EAW33875.1| co-chaperonin GroES [Lyngbya sp. PCC 8106]
          Length = 103

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+  +SE KTA G IL+P+T  EKP    GEI+  G G  +  G   E EV
Sbjct: 11  VKPLGERVFVKVSESEEKTA-GGILLPETAKEKPQI--GEIVATGPGKRNDDGSRAEMEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  G+EY+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GDEYVLLAEKDILAIV 102


>gi|48474481|sp|Q8KTR9|CH10_TREPR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|21702582|gb|AAM75979.1|AF481102_15 chaperone Hsp10 [Candidatus Tremblaya princeps]
          Length = 96

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+R + E KT  G I+IPD+ +EK     G ++ +G G  D  G  +  EV
Sbjct: 4   IRPLGDRVVVKRSEDETKTPCG-IVIPDSAAEK--QDQGTVVALGPGKKDSEGARVPMEV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK++G  IK++D E+ +VM+E DI+ ++
Sbjct: 61  RLGDRVLFGKYAGQSIKVDD-EDLMVMREEDIVAVI 95


>gi|149369940|ref|ZP_01889791.1| co-chaperonin GroES [unidentified eubacterium SCB49]
 gi|149356431|gb|EDM44987.1| co-chaperonin GroES [unidentified eubacterium SCB49]
          Length = 98

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV    +E KTA+G I IPD+  EKP    G++  VG G  DQ     +  V
Sbjct: 12  IQPLSDRVVVEPQPAETKTASG-IYIPDSAKEKPQ--QGKVAAVGKGKDDQ-----KMTV 63

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G +YL+M+E DI+ I+
Sbjct: 64  KVGDTVLYGKYAGTELKL-EGNDYLIMREDDILAII 98


>gi|297192640|ref|ZP_06910038.1| heat shock protein 18 [Streptomyces pristinaespiralis ATCC 25486]
 gi|197723136|gb|EDY67044.1| heat shock protein 18 [Streptomyces pristinaespiralis ATCC 25486]
          Length = 102

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GDIVL+ K+ GTE+K + GEEYLV+   D++ IV
Sbjct: 63  LDVKTGDIVLYSKYGGTEVKYS-GEEYLVLSARDVLAIV 100


>gi|255530160|ref|YP_003090532.1| chaperonin Cpn10 [Pedobacter heparinus DSM 2366]
 gi|255343144|gb|ACU02470.1| chaperonin Cpn10 [Pedobacter heparinus DSM 2366]
          Length = 96

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (63%), Gaps = 11/99 (11%)

Query: 9   LRPTRG---RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           L+P  G   RV+V    +E KTA+G I IPDT  EKPS   G ++ V     D  GK  +
Sbjct: 5   LKPISGTANRVIVEPAAAEEKTASG-IYIPDTAKEKPS--KGTVVSVSE--EDSEGK--K 57

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           P V  GD+VL+GK+ GTE+ + DG++YL+M+ESDI  IV
Sbjct: 58  PAVKVGDVVLYGKYGGTELPI-DGKDYLIMRESDIYAIV 95


>gi|148284511|ref|YP_001248601.1| heat shock chaperonin protein, 10 kD [Orientia tsutsugamushi str.
           Boryong]
 gi|146739950|emb|CAM79982.1| heat shock chaperonin protein, 10 kD [Orientia tsutsugamushi str.
           Boryong]
          Length = 98

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 5/92 (5%)

Query: 10  RPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVS 69
           +P   RV+V  +Q++   A G ILIPDT  EKP+   G ++ VG G  +  G +   +V 
Sbjct: 8   QPLYDRVLVEPIQND--EAHGKILIPDTAKEKPT--EGIVVMVGGGYRNDKGDITPLKVK 63

Query: 70  KGDIVLFGKWSGTEIKLNDGEEYLVMQESDIM 101
           KGD +++ KW+GTEIKL + ++Y+V++ESDI+
Sbjct: 64  KGDTIVYTKWAGTEIKL-ESKDYVVIKESDIL 94


>gi|116203|sp|P16626|CH10_ORITS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Heat shock protein 11; AltName:
           Full=Protein Cpn10
 gi|152502|gb|AAA26392.1| heat shock protein 11 [Orientia tsutsugamushi]
          Length = 94

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 5/92 (5%)

Query: 10  RPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVS 69
           +P   RV+V  +Q++   A G ILIPDT  EKP+   G ++ VG G  +  G +   +V 
Sbjct: 4   QPLYDRVLVEPIQND--EAHGKILIPDTAKEKPT--EGIVVMVGGGYRNDKGDITPLKVK 59

Query: 70  KGDIVLFGKWSGTEIKLNDGEEYLVMQESDIM 101
           KGD +++ KW+GTEIKL + ++Y+V++ESDI+
Sbjct: 60  KGDTIVYTKWAGTEIKL-ESKDYVVIKESDIL 90


>gi|323703385|ref|ZP_08115034.1| Chaperonin Cpn10 [Desulfotomaculum nigrificans DSM 574]
 gi|323531654|gb|EGB21544.1| Chaperonin Cpn10 [Desulfotomaculum nigrificans DSM 574]
          Length = 94

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+ L  E KT +G I++PDT  EKP    GE++ VG G + ++G+    ++
Sbjct: 2   IKPLGDRVVVKALPQEEKTKSG-IVLPDTAKEKPQ--QGEVIAVGPGRLLENGQRATIDL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V F K++G E+K+ D EEYL+++E DI+ ++
Sbjct: 59  KVGDKVFFSKYAGNEVKI-DEEEYLILREMDILAVI 93


>gi|302536310|ref|ZP_07288652.1| heat shock protein 18 [Streptomyces sp. C]
 gi|302445205|gb|EFL17021.1| heat shock protein 18 [Streptomyces sp. C]
          Length = 102

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G+ + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGQRLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V+ GDIVL+ K+ GTE+K + GEEYLV+   D++ IV
Sbjct: 63  LDVNVGDIVLYSKYGGTEVKYS-GEEYLVLSARDVLAIV 100


>gi|296394428|ref|YP_003659312.1| chaperonin Cpn10 [Segniliparus rotundus DSM 44985]
 gi|296181575|gb|ADG98481.1| Chaperonin Cpn10 [Segniliparus rotundus DSM 44985]
          Length = 98

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+  ++E KTA+G ++IPDT  EKP    G ++ VG G + + G  I  +V
Sbjct: 5   IKPLEDKILVQANEAETKTASG-LVIPDTAKEKPQ--EGTVVAVGEGRVTEKGNRIPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K+ GTEIK  DG EYL++   DI+ +V
Sbjct: 62  KAGDTVIYSKYGGTEIKY-DGTEYLILSARDILAVV 96


>gi|158317744|ref|YP_001510252.1| co-chaperonin GroES [Frankia sp. EAN1pec]
 gi|158113149|gb|ABW15346.1| chaperonin Cpn10 [Frankia sp. EAN1pec]
          Length = 101

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G ++ VG G   + 
Sbjct: 1   MTTATKVAIKPLEDRIVVQPSDAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK +  +V  GD+VL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 57  GKRVPLDVKVGDVVLYSKYGGTEVKYA-GEEYLVLSARDVLAII 99


>gi|117927571|ref|YP_872122.1| chaperonin Cpn10 [Acidothermus cellulolyticus 11B]
 gi|117648034|gb|ABK52136.1| chaperonin Cpn10 [Acidothermus cellulolyticus 11B]
          Length = 102

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   R++V+ +++E  TA+G ++IPDT  EKP    G ++ VG G   + GK I  +V
Sbjct: 11  IRPLEDRILVKPVEAETTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRY-EDGKRIPLDV 66

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+ K+ GTE+K N+ EEYLV+   D++ ++
Sbjct: 67  KEGDRVLYSKYGGTEVKYNN-EEYLVLSARDVLAVI 101


>gi|304312441|ref|YP_003812039.1| Chaperonin Cpn10 (10 kDa subunit) [gamma proteobacterium HdN1]
 gi|301798174|emb|CBL46396.1| Chaperonin Cpn10 (10 kDa subunit) [gamma proteobacterium HdN1]
          Length = 96

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR++ E K+A G I++P   +EKPS   GE++ VG G   ++G V    V
Sbjct: 3   IRPLHDRVVIRRVEEETKSA-GGIVLPGAAAEKPS--RGEVVAVGPGKALENGDVRAMGV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+ +K+ D +E L+M E++I G++
Sbjct: 60  KVGDKVIFGQYAGSTVKI-DSQELLIMAETEIFGVL 94


>gi|91202876|emb|CAJ72515.1| strongly similar to chaperonin-10 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 95

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++++RL++E KTA G IL+P+T  EKP    G ++ +G G + ++G+    +V
Sbjct: 3   VKPLGEKILLKRLEAEGKTA-GGILLPETAKEKPK--QGTVIALGDGKLLENGERARFQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF  +  TE+K+ DG+EYL+M E DI+ ++
Sbjct: 60  KNGDKVLFNSYGSTEVKI-DGDEYLLMSEDDILAVI 94


>gi|288919712|ref|ZP_06414039.1| chaperonin Cpn10 [Frankia sp. EUN1f]
 gi|288348901|gb|EFC83151.1| chaperonin Cpn10 [Frankia sp. EUN1f]
          Length = 102

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (62%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G ++ VG G   + GK + 
Sbjct: 7   KVAIKPLEDRIVVQPSDAETTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRF-EDGKRVP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD+VL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 63  LDVKVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 100


>gi|226943475|ref|YP_002798548.1| co-chaperonin GroES [Azotobacter vinelandii DJ]
 gi|259585872|sp|C1DQC1|CH10_AZOVD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226718402|gb|ACO77573.1| Co-chaperonin GroES/Cpn10 [Azotobacter vinelandii DJ]
          Length = 97

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EKP+   GE++ VG G +  +G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEVVAVGTGRVLDNGEVRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I  +V
Sbjct: 60  KVGDKVVFGPYSGSNTIKVDGEDLLVMGENEIFAVV 95


>gi|170780965|ref|YP_001709297.1| co-chaperonin GroES [Clavibacter michiganensis subsp. sepedonicus]
 gi|169155533|emb|CAQ00645.1| 10 kD chaperonin cpn10 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 109

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 16  IKPLEDRIVIQQVEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRIDDNGNRVPLDV 72

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K  DG++ LV+   D++ ++
Sbjct: 73  AVGDKVIYSKYGGTEVKY-DGQDLLVLSARDVLAVI 107


>gi|148273752|ref|YP_001223313.1| co-chaperonin GroES [Clavibacter michiganensis subsp. michiganensis
           NCPPB 382]
 gi|166233994|sp|A5CU64|CH10_CLAM3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|147831682|emb|CAN02651.1| GroES chaperonin (HSP10) [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 98

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIQQVEAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K  DG++ LV+   D++ ++
Sbjct: 62  AVGDKVIYSKYGGTEVKY-DGQDLLVLSARDVLAVI 96


>gi|256371260|ref|YP_003109084.1| chaperonin Cpn10 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007844|gb|ACU53411.1| chaperonin Cpn10 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 97

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (66%), Gaps = 5/99 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   R+VVR  +SE +TA+G ++IPDT  EKP    G ++ VG G   +QSG++I  +
Sbjct: 3   LQPMEDRIVVRPAESEERTASG-LVIPDTAKEKPQ--QGTVLAVGPGKRAEQSGELIPLD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           ++ GD V++ K+ GTEI + DGE+ L++   D++  VV+
Sbjct: 60  IAVGDTVVYSKYGGTEITV-DGEDLLILSSRDVLAKVVK 97


>gi|171911501|ref|ZP_02926971.1| chaperonin Cpn10 [Verrucomicrobium spinosum DSM 4136]
          Length = 96

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           + P   RV+V+R+ SE KTA G I +PDT  EKP  +  E++ +G G  D  GK +   V
Sbjct: 5   ITPLGRRVLVKRVTSEEKTA-GGIFLPDTAKEKPQEA--EVLALGTG-KDDEGKDVTFTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ VL  K+ GTE+KL DG++ L++ E+DI+GI+
Sbjct: 61  AVGNKVLISKYGGTEVKL-DGDDVLIINETDILGII 95


>gi|41410362|ref|NP_963198.1| co-chaperonin GroES [Mycobacterium avium subsp. paratuberculosis
           K-10]
 gi|118465749|ref|YP_883501.1| co-chaperonin GroES [Mycobacterium avium 104]
 gi|254776796|ref|ZP_05218312.1| co-chaperonin GroES [Mycobacterium avium subsp. avium ATCC 25291]
 gi|45593153|sp|P60532|CH10_MYCAV RecName: Full=10 kDa chaperonin; AltName: Full=10 kDa antigen;
           AltName: Full=GroES protein; AltName: Full=Protein Cpn10
 gi|45593154|sp|P60533|CH10_MYCPA RecName: Full=10 kDa chaperonin; AltName: Full=10 kDa antigen;
           AltName: Full=GroES protein; AltName: Full=Protein Cpn10
 gi|166198383|sp|A0QKR3|CH10_MYCA1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|4566238|gb|AAD23276.1|AF071828_1 10 kD heat shock protein [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|4566240|gb|AAD23277.1|AF071829_1 10 kD heat shock protein [Mycobacterium avium subsp.
           paratuberculosis]
 gi|3420755|gb|AAC31921.1| chaperonin [Mycobacterium avium]
 gi|41399196|gb|AAS06814.1| GroES [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118167036|gb|ABK67933.1| chaperonin GroS [Mycobacterium avium 104]
          Length = 100

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D  G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDDDGAKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VSEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|111220597|ref|YP_711391.1| co-chaperonin GroES [Frankia alni ACN14a]
 gi|111148129|emb|CAJ59797.1| chaperone Hsp10 (GroES), part of GroE chaperone system [Frankia
           alni ACN14a]
          Length = 101

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G ++ VG G   + 
Sbjct: 1   MTTATKVAIKPLEDRIVVQPSDAEQTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK +  +V  GD+VL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 57  GKRVPLDVKVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 99


>gi|22297730|ref|NP_680977.1| co-chaperonin GroES [Thermosynechococcus elongatus BP-1]
 gi|61220917|sp|P0A347|CH10_THEEB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|61220919|sp|P0A348|CH10_THEVL RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|2696700|dbj|BAA23816.1| GroES [Thermosynechococcus vulcanus]
 gi|22293907|dbj|BAC07739.1| 10kD chaperonin [Thermosynechococcus elongatus BP-1]
          Length = 103

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ V+  +SE +TA G IL+PD   EKP    GE+  VG G + + GK    +V
Sbjct: 11  VKPLGDRIFVKVAESEERTA-GGILLPDNAREKPQV--GEVTAVGPGKLTEDGKRQPMDV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GTE+KL  GE+Y+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTEVKLA-GEDYVLLSEKDILAIV 102


>gi|212550645|ref|YP_002308962.1| co-chaperonin GroES [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
 gi|212548883|dbj|BAG83551.1| chaperonin GroES [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
          Length = 91

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E KT  G I+IPD+  EKP    GE++ VG G  D+     +  +
Sbjct: 5   IKPLADRVLVKPAAAEEKT-VGGIIIPDSAKEKPL--KGEVIAVGNGSKDE-----QMVL 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD +L+GK+SGTEI+L DG +YL+M++SD++ I+
Sbjct: 57  KKGDEILYGKYSGTEIEL-DGMQYLIMRQSDVLAII 91


>gi|227891192|ref|ZP_04008997.1| chaperonin GROES [Lactobacillus salivarius ATCC 11741]
 gi|227867066|gb|EEJ74487.1| chaperonin GROES [Lactobacillus salivarius ATCC 11741]
          Length = 99

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 68/101 (67%), Gaps = 4/101 (3%)

Query: 4   EHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV 63
           E  + L+P   RVV++ +Q E + + G I+I     EKP+  +GE++ VG G +  +G+ 
Sbjct: 2   EGLDVLKPLGDRVVLK-VQKEEEQSIGGIVIASNAKEKPT--TGEVIAVGNGRILDNGQR 58

Query: 64  IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +EPEV  G  V+F K++G+E+K  +GEEYLV++E+DI+ +V
Sbjct: 59  VEPEVKVGQSVVFDKYAGSEVKY-EGEEYLVIRENDIIAVV 98


>gi|257063284|ref|YP_003142956.1| Co-chaperonin GroES [Slackia heliotrinireducens DSM 20476]
 gi|256790937|gb|ACV21607.1| Co-chaperonin GroES [Slackia heliotrinireducens DSM 20476]
          Length = 96

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+R ++E  TA+G +LI  +  EKP   +G I+ VG G +D+ GK+I   V
Sbjct: 3   LKPLGDRVIVKRDEAETATASG-LLIASSAKEKPQ--TGIILAVGEGKLDKDGKLIPVPV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD VL+GK+ G+EI + DGEE L+++  D+  +  +
Sbjct: 60  KEGDRVLYGKFGGSEITV-DGEEVLILRADDLYAVYTD 96


>gi|295838461|ref|ZP_06825394.1| chaperonin GroS [Streptomyces sp. SPB74]
 gi|302519595|ref|ZP_07271937.1| chaperonin GroS [Streptomyces sp. SPB78]
 gi|197695738|gb|EDY42671.1| chaperonin GroS [Streptomyces sp. SPB74]
 gi|302428490|gb|EFL00306.1| chaperonin GroS [Streptomyces sp. SPB78]
          Length = 102

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GDIVL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 63  LDVKTGDIVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 100


>gi|47497405|dbj|BAD19442.1| putative 20 kDa chaperonin, chloroplast [Oryza sativa Japonica
           Group]
 gi|215767355|dbj|BAG99583.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 195

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +L+ +T  EKPS   G ++ VG G +D+ GK I   V
Sbjct: 102 MKPLSDRVLIKVAEAEDKTP-GGLLLTETTKEKPSI--GTVVAVGPGPLDEEGKRIPLSV 158

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K +DG  Y+V++ SD+M ++
Sbjct: 159 SAGSTVLYSKYAGSEFKGSDGTSYIVLRVSDLMAVL 194



 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 27/34 (79%), Gaps = 1/34 (2%)

Query: 71  GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           G  V++ K++GTE++LND   +L+++E DI+GI+
Sbjct: 62  GSQVVYSKYAGTEVELND-SNHLILKEDDIIGIL 94


>gi|330888544|gb|EGH21205.1| co-chaperonin GroES [Pseudomonas syringae pv. mori str. 301020]
          Length = 97

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP    VV+RR + E KTA G I++P + +EKP+   GEI+ VG G +  +G+V    V
Sbjct: 3   LRPLHDHVVIRRSEEETKTA-GGIVLPGSAAEKPN--RGEIVAVGTGRVLDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVI 95


>gi|125541365|gb|EAY87760.1| hypothetical protein OsI_09178 [Oryza sativa Indica Group]
          Length = 255

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +L+ +T  EKPS   G ++ VG G +D+ GK I   V
Sbjct: 162 MKPLSDRVLIKVAEAEDKTP-GGLLLTETTKEKPSI--GTVVAVGPGPLDEEGKRIPLSV 218

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K +DG  Y+V++ SD+M ++
Sbjct: 219 SAGSTVLYSKYAGSEFKGSDGTSYIVLRVSDLMAVL 254



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT TG IL+P     KP    GE++ +G G      KV E  +
Sbjct: 64  LKPLADRVLVKIKSAEQKT-TGGILLPSAAQSKPQG--GEVVAIGEGRTVGDNKV-EVSI 119

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++LND   +L+++E DI+GI+
Sbjct: 120 QVGSQVVYSKYAGTEVELND-SNHLILKEDDIIGIL 154


>gi|115449059|ref|NP_001048309.1| Os02g0781400 [Oryza sativa Japonica Group]
 gi|47497404|dbj|BAD19441.1| putative 20 kDa chaperonin, chloroplast [Oryza sativa Japonica
           Group]
 gi|113537840|dbj|BAF10223.1| Os02g0781400 [Oryza sativa Japonica Group]
 gi|215707167|dbj|BAG93627.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765760|dbj|BAG87457.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 255

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +L+ +T  EKPS   G ++ VG G +D+ GK I   V
Sbjct: 162 MKPLSDRVLIKVAEAEDKTP-GGLLLTETTKEKPSI--GTVVAVGPGPLDEEGKRIPLSV 218

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K +DG  Y+V++ SD+M ++
Sbjct: 219 SAGSTVLYSKYAGSEFKGSDGTSYIVLRVSDLMAVL 254



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT TG IL+P     KP    GE++ +G G      KV E  +
Sbjct: 64  LKPLADRVLVKIKSAEQKT-TGGILLPSAAQSKPQG--GEVVAIGEGRTVGDNKV-EVSI 119

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++LND   +L+++E DI+GI+
Sbjct: 120 QVGSQVVYSKYAGTEVELND-SNHLILKEDDIIGIL 154


>gi|282855896|ref|ZP_06265195.1| chaperonin GroS [Pyramidobacter piscolens W5455]
 gi|282586297|gb|EFB91566.1| chaperonin GroS [Pyramidobacter piscolens W5455]
          Length = 95

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ +  E KT +G + +PDT  EKP    GE++ VG G +  +G+ +  EV
Sbjct: 3   LKPLADRIVVKVVSGEEKTKSG-LYLPDTAQEKPQ--EGEVIAVGTGRILDNGQKLPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD ++F K+SGTEIKL DGE+ ++  E D++ ++
Sbjct: 60  KVGDHIVFSKYSGTEIKL-DGEKLVIFSERDVLAVI 94


>gi|312880437|ref|ZP_07740237.1| Chaperonin Cpn10 [Aminomonas paucivorans DSM 12260]
 gi|310783728|gb|EFQ24126.1| Chaperonin Cpn10 [Aminomonas paucivorans DSM 12260]
          Length = 96

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R+VV+ +  E +   G I++PDTV EKP    GE++ VG G +  +G+ +  EV
Sbjct: 3   LKPLGDRLVVKAVDKE-EMTKGGIVLPDTVKEKPV--EGEVVAVGTGKVLDNGQKLPMEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ V++ K+SGTE+K  DGE+YL++ E D++ +V
Sbjct: 60  KVGNRVIYSKYSGTEVKF-DGEDYLILSERDVLAVV 94


>gi|269216323|ref|ZP_06160177.1| chaperonin GroS [Slackia exigua ATCC 700122]
 gi|269130582|gb|EEZ61660.1| chaperonin GroS [Slackia exigua ATCC 700122]
          Length = 103

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
           G+    L+P   RV+V+R ++E  T+ G +LI  T  EKP   +G ++ VG G +D+ GK
Sbjct: 4   GQSIMNLKPLGDRVIVKRDEAESATSAG-LLIASTSKEKPQ--TGIVVAVGEGKLDKDGK 60

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
           ++   V  GD VL+GK+ GT+I L DGEE L+++  DI+ +
Sbjct: 61  LVPVPVKAGDRVLYGKYGGTDITL-DGEEVLILRADDILAV 100


>gi|295425866|ref|ZP_06818546.1| chaperone GroES [Lactobacillus amylolyticus DSM 11664]
 gi|295064469|gb|EFG55397.1| chaperone GroES [Lactobacillus amylolyticus DSM 11664]
          Length = 109

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           N L P   RV+V+  + E KT  G I++     EKP+   GE++ VG G   ++G+ +  
Sbjct: 15  NVLEPIGDRVIVKVKEEEEKT-VGGIVLASNAKEKPT--EGEVVAVGNGAYAENGEKLPM 71

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V KGD+VL+ K+SGT +K  +GE+YLV+ E DI+ IV
Sbjct: 72  TVKKGDVVLYDKYSGTNVKY-EGEKYLVLHERDILAIV 108


>gi|256425200|ref|YP_003125853.1| chaperonin Cpn10 [Chitinophaga pinensis DSM 2588]
 gi|256040108|gb|ACU63652.1| chaperonin Cpn10 [Chitinophaga pinensis DSM 2588]
          Length = 93

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (62%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV+V+   +E KTA G I+IPDT  EKP    G ++  G G  D      EP  
Sbjct: 7   IKPLADRVIVKPAAAEEKTA-GGIIIPDTAKEKPQ--RGTVVAAGPGKKD------EPVT 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK+SGTEI + +G +YL+M+ESDI+ IV
Sbjct: 58  VKVGDTVLYGKYSGTEISI-EGGDYLIMRESDILAIV 93


>gi|330811326|ref|YP_004355788.1| 10 kDa chaperonin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379434|gb|AEA70784.1| 10 kDa chaperonin [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 97

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+RR + E KTA G I++P + +EK  A+ GE++ VG G   ++G+V    V
Sbjct: 3   LRPLHDRVVIRRSEEEKKTA-GGIVLPGSAAEK--ANHGEVLAVGPGKALENGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG +SG+     DGE+ LVM E++I+ ++
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVL 95


>gi|253576826|ref|ZP_04854152.1| chaperonin GroS [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843857|gb|EES71879.1| chaperonin GroS [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 114

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ ++ E  TA G I++PDT  EKP    G+++ VG+G + + G  +  EV
Sbjct: 23  IKPLGERVLVQPIEQEETTAFG-IVLPDTAKEKPQ--EGKVIAVGSGTL-KDGVRVPLEV 78

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+K  +G+EYL+M+ESDI  I+
Sbjct: 79  KEGDRVIFSKYAGTEVKY-EGKEYLIMKESDIHAII 113


>gi|125583901|gb|EAZ24832.1| hypothetical protein OsJ_08612 [Oryza sativa Japonica Group]
          Length = 235

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +L+ +T  EKPS   G ++ VG G +D+ GK I   V
Sbjct: 142 MKPLSDRVLIKVAEAEDKTP-GGLLLTETTKEKPSI--GTVVAVGPGPLDEEGKRIPLSV 198

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K +DG  Y+V++ SD+M ++
Sbjct: 199 SAGSTVLYSKYAGSEFKGSDGTSYIVLRVSDLMAVL 234



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT TG IL+P     KP    GE++ +G G      KV E  +
Sbjct: 44  LKPLADRVLVKIKSAEQKT-TGGILLPSAAQSKPQG--GEVVAIGEGRTVGDNKV-EVSI 99

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++LND   +L+++E DI+GI+
Sbjct: 100 QVGSQVVYSKYAGTEVELND-SNHLILKEDDIIGIL 134


>gi|258516504|ref|YP_003192726.1| chaperonin Cpn10 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780209|gb|ACV64103.1| chaperonin Cpn10 [Desulfotomaculum acetoxidans DSM 771]
          Length = 94

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+    E  T +G I++PDT  EKP    GE++ VG+G + ++G+ +  ++
Sbjct: 2   IRPLGDRVVVKPAAKEEVTKSG-IVLPDTAKEKPQ--KGEVVAVGSGRLLETGQRVPMDL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD +LF K++G EIK++D  EYL+++E DI+G++
Sbjct: 59  KVGDEILFSKYAGNEIKIDD-VEYLILREMDILGVI 93


>gi|116671433|ref|YP_832366.1| co-chaperonin GroES [Arthrobacter sp. FB24]
 gi|325964076|ref|YP_004241982.1| Co-chaperonin GroES [Arthrobacter phenanthrenivorans Sphe3]
 gi|166233980|sp|A0JYZ6|CH10_ARTS2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|116611542|gb|ABK04266.1| chaperonin Cpn10 [Arthrobacter sp. FB24]
 gi|323470163|gb|ADX73848.1| Co-chaperonin GroES [Arthrobacter phenanthrenivorans Sphe3]
          Length = 97

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 5/98 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VVR L++E  TA+G ++IPD+  EKP    GE++ VG G   + G  +  +V
Sbjct: 5   IKPLEDRIVVRPLEAEQTTASG-LVIPDSAQEKPQ--EGEVVAVGPGRF-EDGNRVPVDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD+V++ K+ GTE+K   G EYLV+   D++ IVV+
Sbjct: 61  AVGDVVIYSKYGGTEVK-TGGTEYLVLSARDVLAIVVK 97


>gi|15825763|pdb|1HX5|A Chain A, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825764|pdb|1HX5|B Chain B, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825765|pdb|1HX5|C Chain C, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825766|pdb|1HX5|D Chain D, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825767|pdb|1HX5|E Chain E, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825768|pdb|1HX5|F Chain F, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|15825769|pdb|1HX5|G Chain G, Crystal Structure Of M. Tuberculosis Chaperonin-10
 gi|34811499|pdb|1P3H|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811500|pdb|1P3H|B Chain B, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811501|pdb|1P3H|C Chain C, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811502|pdb|1P3H|D Chain D, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811503|pdb|1P3H|E Chain E, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811504|pdb|1P3H|F Chain F, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811505|pdb|1P3H|G Chain G, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811506|pdb|1P3H|H Chain H, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811507|pdb|1P3H|I Chain I, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811508|pdb|1P3H|J Chain J, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811509|pdb|1P3H|K Chain K, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811510|pdb|1P3H|L Chain L, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811511|pdb|1P3H|M Chain M, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
 gi|34811512|pdb|1P3H|N Chain N, Crystal Structure Of The Mycobacterium Tuberculosis
           Chaperonin 10 Tetradecamer
          Length = 99

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 5   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 61

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 62  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 97


>gi|298206725|ref|YP_003714904.1| co-chaperonin GroES [Croceibacter atlanticus HTCC2559]
 gi|83849356|gb|EAP87224.1| co-chaperonin GroES [Croceibacter atlanticus HTCC2559]
          Length = 91

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V    +E +TA+G I IP+T  EKP    G+++ VG G  D      +  V
Sbjct: 5   IKPLSDRVLVEPQAAETQTASG-IYIPETAKEKPQ--KGKVVAVGGGKKDH-----DMTV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVL+GK+SGTE+KL +G +YL+M+E DI+ ++
Sbjct: 57  KVGDIVLYGKYSGTELKL-EGNDYLMMREDDILAVI 91


>gi|15610554|ref|NP_217935.1| co-chaperonin GroES [Mycobacterium tuberculosis H37Rv]
 gi|15843014|ref|NP_338051.1| co-chaperonin GroES [Mycobacterium tuberculosis CDC1551]
 gi|31794599|ref|NP_857092.1| co-chaperonin GroES [Mycobacterium bovis AF2122/97]
 gi|121639343|ref|YP_979567.1| co-chaperonin GroES [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148663282|ref|YP_001284805.1| co-chaperonin GroES [Mycobacterium tuberculosis H37Ra]
 gi|148824625|ref|YP_001289379.1| co-chaperonin GroES [Mycobacterium tuberculosis F11]
 gi|215405454|ref|ZP_03417635.1| co-chaperonin GroES [Mycobacterium tuberculosis 02_1987]
 gi|215413326|ref|ZP_03422011.1| co-chaperonin GroES [Mycobacterium tuberculosis 94_M4241A]
 gi|215428920|ref|ZP_03426839.1| co-chaperonin GroES [Mycobacterium tuberculosis T92]
 gi|215432385|ref|ZP_03430304.1| co-chaperonin GroES [Mycobacterium tuberculosis EAS054]
 gi|218755200|ref|ZP_03533996.1| co-chaperonin GroES [Mycobacterium tuberculosis GM 1503]
 gi|224991839|ref|YP_002646528.1| chaperonin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|240167817|ref|ZP_04746476.1| co-chaperonin GroES [Mycobacterium kansasii ATCC 12478]
 gi|253800465|ref|YP_003033466.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis KZN 1435]
 gi|254234019|ref|ZP_04927344.1| 10 kda chaperonin groES [Mycobacterium tuberculosis C]
 gi|254366027|ref|ZP_04982072.1| 10 kda chaperonin groES [Mycobacterium tuberculosis str. Haarlem]
 gi|260188472|ref|ZP_05765946.1| co-chaperonin GroES [Mycobacterium tuberculosis CPHL_A]
 gi|260202504|ref|ZP_05769995.1| co-chaperonin GroES [Mycobacterium tuberculosis T46]
 gi|260206785|ref|ZP_05774276.1| co-chaperonin GroES [Mycobacterium tuberculosis K85]
 gi|289444924|ref|ZP_06434668.1| chaperonin GroS [Mycobacterium tuberculosis T46]
 gi|289449117|ref|ZP_06438861.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis CPHL_A]
 gi|289555694|ref|ZP_06444904.1| 10 kda chaperonin groES [Mycobacterium tuberculosis KZN 605]
 gi|289576151|ref|ZP_06456378.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis K85]
 gi|289747247|ref|ZP_06506625.1| hsp10-like protein [Mycobacterium tuberculosis 02_1987]
 gi|289752137|ref|ZP_06511515.1| 10 kda chaperonin groES [Mycobacterium tuberculosis T92]
 gi|289755548|ref|ZP_06514926.1| hsp10-like protein [Mycobacterium tuberculosis EAS054]
 gi|289763601|ref|ZP_06522979.1| 10 kda chaperonin groES [Mycobacterium tuberculosis GM 1503]
 gi|294995808|ref|ZP_06801499.1| co-chaperonin GroES [Mycobacterium tuberculosis 210]
 gi|297636080|ref|ZP_06953860.1| co-chaperonin GroES [Mycobacterium tuberculosis KZN 4207]
 gi|297733080|ref|ZP_06962198.1| co-chaperonin GroES [Mycobacterium tuberculosis KZN R506]
 gi|298526901|ref|ZP_07014310.1| chaperonin [Mycobacterium tuberculosis 94_M4241A]
 gi|306777757|ref|ZP_07416094.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu001]
 gi|306782486|ref|ZP_07420823.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu002]
 gi|306786306|ref|ZP_07424628.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu003]
 gi|306790677|ref|ZP_07428999.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu004]
 gi|306795203|ref|ZP_07433505.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu005]
 gi|306799393|ref|ZP_07437695.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu006]
 gi|306805239|ref|ZP_07441907.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu008]
 gi|306809426|ref|ZP_07446094.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu007]
 gi|306973877|ref|ZP_07486538.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu010]
 gi|307081589|ref|ZP_07490759.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu011]
 gi|307086195|ref|ZP_07495308.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu012]
 gi|308378319|ref|ZP_07482194.2| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu009]
 gi|313660411|ref|ZP_07817291.1| co-chaperonin GroES [Mycobacterium tuberculosis KZN V2475]
 gi|116200|sp|P09621|CH10_MYCTU RecName: Full=10 kDa chaperonin; AltName: Full=10 kDa antigen;
           AltName: Full=BCG-A heat shock protein; AltName:
           Full=GroES protein; AltName: Full=Protein Cpn10
 gi|38605709|sp|P15020|CH10_MYCBO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Immunogenic protein MPB57; AltName:
           Full=Protein Cpn10
 gi|166198384|sp|A1KPA9|CH10_MYCBP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166198386|sp|A5U893|CH10_MYCTA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813850|sp|C1AHN1|CH10_MYCBT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|149888|gb|AAA25340.1| 10k antigen [Mycobacterium tuberculosis]
 gi|581360|emb|CAA32003.1| unnamed protein product [Mycobacterium tuberculosis str. Erdman]
 gi|581363|emb|CAA42908.1| 10-kDa antigen homologue [Mycobacterium tuberculosis str. Erdman]
 gi|1449369|emb|CAB01005.1| 10 KDA CHAPERONIN GROES (PROTEIN CPN10) (PROTEIN GROES) (BCG-A HEAT
           SHOCK PROTEIN) (10 KDA ANTIGEN) [Mycobacterium
           tuberculosis H37Rv]
 gi|13883356|gb|AAK47865.1| chaperonin, 10 kDa [Mycobacterium tuberculosis CDC1551]
 gi|31620196|emb|CAD95639.1| 10 KDA CHAPERONIN GROES (PROTEIN CPN10) (PROTEIN GROES) (BCG-A HEAT
           SHOCK PROTEIN) (10 KDA ANTIGEN) [Mycobacterium bovis
           AF2122/97]
 gi|121494991|emb|CAL73477.1| 10 kDa chaperonin groES [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|124599548|gb|EAY58652.1| 10 kda chaperonin groES [Mycobacterium tuberculosis C]
 gi|134151540|gb|EBA43585.1| 10 kda chaperonin groES [Mycobacterium tuberculosis str. Haarlem]
 gi|148507434|gb|ABQ75243.1| co-chaperonin GroES [Mycobacterium tuberculosis H37Ra]
 gi|148723152|gb|ABR07777.1| 10 kda chaperonin groES [Mycobacterium tuberculosis F11]
 gi|224774954|dbj|BAH27760.1| chaperonin [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253321968|gb|ACT26571.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis KZN 1435]
 gi|289417843|gb|EFD15083.1| chaperonin GroS [Mycobacterium tuberculosis T46]
 gi|289422075|gb|EFD19276.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis CPHL_A]
 gi|289440326|gb|EFD22819.1| 10 kda chaperonin groES [Mycobacterium tuberculosis KZN 605]
 gi|289540582|gb|EFD45160.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis K85]
 gi|289687775|gb|EFD55263.1| hsp10-like protein [Mycobacterium tuberculosis 02_1987]
 gi|289692724|gb|EFD60153.1| 10 kda chaperonin groES [Mycobacterium tuberculosis T92]
 gi|289696135|gb|EFD63564.1| hsp10-like protein [Mycobacterium tuberculosis EAS054]
 gi|289711107|gb|EFD75123.1| 10 kda chaperonin groES [Mycobacterium tuberculosis GM 1503]
 gi|298496695|gb|EFI31989.1| chaperonin [Mycobacterium tuberculosis 94_M4241A]
 gi|308213933|gb|EFO73332.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu001]
 gi|308324879|gb|EFP13730.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu002]
 gi|308329060|gb|EFP17911.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu003]
 gi|308332921|gb|EFP21772.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu004]
 gi|308336531|gb|EFP25382.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu005]
 gi|308340407|gb|EFP29258.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu006]
 gi|308344267|gb|EFP33118.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu007]
 gi|308348217|gb|EFP37068.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu008]
 gi|308352941|gb|EFP41792.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu009]
 gi|308356805|gb|EFP45656.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu010]
 gi|308360753|gb|EFP49604.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu011]
 gi|308364362|gb|EFP53213.1| 10 kda chaperonin groES [Mycobacterium tuberculosis SUMu012]
 gi|323717905|gb|EGB27094.1| chaperonin groES [Mycobacterium tuberculosis CDC1551A]
 gi|326905261|gb|EGE52194.1| 10 kDa chaperonin groES [Mycobacterium tuberculosis W-148]
 gi|328460197|gb|AEB05620.1| 10 kda chaperonin groES [Mycobacterium tuberculosis KZN 4207]
          Length = 100

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|118470431|ref|YP_885961.1| co-chaperonin GroES [Mycobacterium smegmatis str. MC2 155]
 gi|166198385|sp|A0QSS3|CH10_MYCS2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118171718|gb|ABK72614.1| chaperonin GroS [Mycobacterium smegmatis str. MC2 155]
          Length = 100

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|11467285|ref|NP_043142.1| GroES [Cyanophora paradoxa]
 gi|11467405|ref|NP_043262.1| GroES [Cyanophora paradoxa]
 gi|2493661|sp|Q37761|CH10_CYAPA RecName: Full=10 kDa chaperonin, cyanelle; AltName: Full=Protein
           Cpn10; AltName: Full=groES protein
 gi|1016086|gb|AAA81173.1| GroES [Cyanophora paradoxa]
 gi|1016206|gb|AAA81293.1| GroES [Cyanophora paradoxa]
          Length = 103

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+  QSE KTA G IL+PDTV EKP    GEI+  G G  +  G     EV
Sbjct: 11  VRPLGERVLVKVSQSEEKTA-GGILLPDTVKEKPQI--GEIIAEGPGRRNDDGSFQPLEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +    VL+ K++GT+IKL + EEY+++ E DI+ I+
Sbjct: 68  TVNSKVLYSKYAGTDIKL-ENEEYVLLSEKDILAII 102


>gi|319952452|ref|YP_004163719.1| 10 kda chaperonin [Cellulophaga algicola DSM 14237]
 gi|319421112|gb|ADV48221.1| 10 kDa chaperonin [Cellulophaga algicola DSM 14237]
          Length = 92

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  + +E KTA+G + IPDT  EKP    G+++ VG G  D         V
Sbjct: 6   IKPLADRVLIEPMAAETKTASG-LYIPDTAKEKPQ--KGKVVAVGPGTKDDL-----VTV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE+KL +G ++L+M+ESDI+ I+
Sbjct: 58  KIGDTVLYGKYAGTELKL-EGTDFLMMRESDILAII 92


>gi|326335786|ref|ZP_08201966.1| chaperone GroES [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692025|gb|EGD33984.1| chaperone GroES [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 91

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++    +E  TA+G I+IPDT  EKP    G+++ VGAG  +       P  
Sbjct: 5   LKPLADRVLIEPAPAETTTASG-IIIPDTAQEKPQ--RGKVVAVGAGTKEN------PVT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK++GTE+KL +G+ YL+M+ESD++ IV
Sbjct: 56  LKVGDEVLYGKYAGTELKL-EGKTYLIMRESDVLAIV 91


>gi|307069520|ref|YP_003877997.1| putative chaperonin GroES [Candidatus Zinderia insecticola CARI]
 gi|306482780|gb|ADM89651.1| putative chaperonin GroES [Candidatus Zinderia insecticola CARI]
          Length = 99

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 57/79 (72%), Gaps = 4/79 (5%)

Query: 26  KTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIK 85
           KT++G I++P+  S K   + G+++ VG G++++SGK+I   V K D VLFGK+SG +IK
Sbjct: 24  KTSSG-IVLPENSSNK--TNKGKVIAVGNGILNKSGKLIPLTVKKNDFVLFGKYSGQKIK 80

Query: 86  LNDGEEYLVMQESDIMGIV 104
           LN  ++YLVM+E DI  I+
Sbjct: 81  LNK-KKYLVMREEDIYAII 98


>gi|256370748|ref|YP_003108573.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri SMDSEM]
 gi|256009540|gb|ACU52900.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri SMDSEM]
          Length = 93

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV++    +E KT++G I+IPDT  EKP     E + V  GV    GK  EP  
Sbjct: 6   IKPLSDRVLIEPSPTEKKTSSG-IIIPDTAKEKPQ----EGIVVAVGV----GKKNEPLT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V KG+ VL+GK+SGTE++LN G++YL+M+ESDI+ I+
Sbjct: 57  VKKGNKVLYGKYSGTELRLN-GKDYLIMRESDILAIM 92


>gi|215447747|ref|ZP_03434499.1| co-chaperonin GroES [Mycobacterium tuberculosis T85]
 gi|289759578|ref|ZP_06518956.1| hsp10-like protein [Mycobacterium tuberculosis T85]
 gi|289715142|gb|EFD79154.1| hsp10-like protein [Mycobacterium tuberculosis T85]
          Length = 100

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|94502300|ref|ZP_01308778.1| 10 kDa chaperonin [Candidatus Sulcia muelleri str. Hc (Homalodisca
           coagulata)]
 gi|94451139|gb|EAT14086.1| 10 kDa chaperonin [Candidatus Sulcia muelleri str. Hc (Homalodisca
           coagulata)]
          Length = 94

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RVV+    +E KT++G I+IPDT  EKP    G ++ VG G      K  EP  
Sbjct: 8   IKPLSDRVVIEPSPAETKTSSG-IIIPDTAKEKPQ--EGIVVAVGLG------KKNEPLT 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G+ VL+GK+SGTE++LN G++YL+M+ESDI+ I+
Sbjct: 59  VKTGNKVLYGKYSGTELRLN-GKDYLIMRESDILAII 94


>gi|254495100|ref|ZP_05108024.1| chaperonin 10 Kd subunit [Polaribacter sp. MED152]
 gi|85819450|gb|EAQ40607.1| chaperonin 10 Kd subunit [Polaribacter sp. MED152]
          Length = 91

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V    +E KTA+G ++IPD   EKP    G ++ VG      +GKV EP  
Sbjct: 5   IKPLADRVLVEPAPAETKTASG-LIIPDNAKEKPQ--KGTVVAVG------NGKVDEPLT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+ GT++KL +G++YL+M+ESDI+ I+
Sbjct: 56  VKVGDTVLYGKYGGTDLKL-EGKDYLMMRESDILAII 91


>gi|311115184|ref|YP_003986405.1| chaperone GroES [Gardnerella vaginalis ATCC 14019]
 gi|310946678|gb|ADP39382.1| chaperone GroES [Gardnerella vaginalis ATCC 14019]
          Length = 126

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ Q+E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 34  LTPLEDKIIVKQAQAETQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDV 90

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   D++ I+
Sbjct: 91  KVGDKVLYSKYGGTEVHY-EGEDYLIVSSRDVLAIL 125


>gi|50955520|ref|YP_062808.1| co-chaperonin GroES [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|60389554|sp|Q6AD41|CH10_LEIXX RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|50952002|gb|AAT89703.1| 10kDa chaperonin [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 98

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 64/97 (65%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++E  TA+G ++IPDT  EKP    G +  VG G +D +G  +  +V
Sbjct: 5   IKPLEDRIVIKQVEAEQTTASG-LVIPDTAKEKPQ--EGVVEAVGPGRIDDNGNRVPLDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + GD V++ K+ GTE+K   G++YLV+   D++ +VV
Sbjct: 62  AVGDKVIYSKYGGTEVKFG-GQDYLVLSARDVLAVVV 97


>gi|298346651|ref|YP_003719338.1| chaperone GroES [Mobiluncus curtisii ATCC 43063]
 gi|315655199|ref|ZP_07908100.1| chaperone GroES [Mobiluncus curtisii ATCC 51333]
 gi|298236712|gb|ADI67844.1| chaperone GroES [Mobiluncus curtisii ATCC 43063]
 gi|315490454|gb|EFU80078.1| chaperone GroES [Mobiluncus curtisii ATCC 51333]
          Length = 111

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+++L++E  TA+G ++IPD   EKP    G ++ VG G +D  G  +  +V
Sbjct: 19  IKPLEDRVVIKQLEAETVTASG-LVIPDMAKEKPQ--EGTVVAVGPGRVDDKGVRVPMDV 75

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTE+K   GEEY+++   D++ +V
Sbjct: 76  KEGDKVIYAKYGGTEVKYQ-GEEYVILSARDLLAVV 110


>gi|297242986|ref|ZP_06926924.1| co-chaperonin GroES (HSP10) [Gardnerella vaginalis AMD]
 gi|296889197|gb|EFH27931.1| co-chaperonin GroES (HSP10) [Gardnerella vaginalis AMD]
          Length = 100

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ Q+E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 8   LTPLEDKIIVKQAQAETQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDV 64

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   D++ I+
Sbjct: 65  KVGDKVLYSKYGGTEVHY-EGEDYLIVSSRDVLAIL 99


>gi|34540337|ref|NP_904816.1| co-chaperonin GroES [Porphyromonas gingivalis W83]
 gi|188995315|ref|YP_001929567.1| co-chaperonin GroES [Porphyromonas gingivalis ATCC 33277]
 gi|1168911|sp|P42376|CH10_PORGI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226704021|sp|B2RKS5|CH10_PORG3 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|537364|dbj|BAA04221.1| heat shock protein 60 (GroEL) like protein [Porphyromonas
           gingivalis]
 gi|1181587|dbj|BAA04160.1| GroES [Porphyromonas gingivalis]
 gi|34396649|gb|AAQ65715.1| chaperonin, 10 kDa [Porphyromonas gingivalis W83]
 gi|188594995|dbj|BAG33970.1| chaperonin GroES [Porphyromonas gingivalis ATCC 33277]
 gi|744232|prf||2014258A heat shock protein 60
          Length = 89

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E KT +G I+IPD+  EKP    GE++ VG G  D+     E  +
Sbjct: 3   IKPLADRVLVKPAAAEEKTVSG-IIIPDSAKEKPL--KGEVIAVGNGTKDE-----EMVL 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTEI+L +GE+Y++M+++D++ I+
Sbjct: 55  KAGDTVLYGKYAGTEIEL-EGEKYIIMRQNDVLAII 89


>gi|283782741|ref|YP_003373495.1| chaperonin GroS [Gardnerella vaginalis 409-05]
 gi|308235639|ref|ZP_07666376.1| co-chaperonin GroES [Gardnerella vaginalis ATCC 14018]
 gi|283441721|gb|ADB14187.1| chaperonin GroS [Gardnerella vaginalis 409-05]
          Length = 97

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ Q+E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAQAETQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   D++ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHY-EGEDYLIVSSRDVLAIL 96


>gi|167968695|ref|ZP_02550972.1| chaperonin Cpn10 [Mycobacterium tuberculosis H37Ra]
          Length = 97

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 3   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 60  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 95


>gi|304389640|ref|ZP_07371602.1| chaperone GroES [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315656888|ref|ZP_07909775.1| chaperone GroES [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|304327193|gb|EFL94429.1| chaperone GroES [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315492843|gb|EFU82447.1| chaperone GroES [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 110

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+++L++E  TA+G ++IPD   EKP    G ++ VG G +D  G  +  +V
Sbjct: 18  IKPLEDRVVIKQLEAETVTASG-LVIPDMAKEKPQ--EGTVVAVGPGRVDDKGVRVPMDV 74

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTE+K   GEEY+++   D++ +V
Sbjct: 75  KEGDKVIYAKYGGTEVKYQ-GEEYVILSARDLLAVV 109


>gi|262368756|ref|ZP_06062085.1| chaperonin GroS [Acinetobacter johnsonii SH046]
 gi|262316434|gb|EEY97472.1| chaperonin GroS [Acinetobacter johnsonii SH046]
          Length = 96

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP    VV+RR++ E KTA G +++  + +E+P  + GEI+ VG G +  +G +   +V
Sbjct: 4   IRPLHDNVVIRRVEKETKTA-GGLILSTSAAEQP--AQGEIIAVGNGKITDNG-IRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG ++GT++K+ +GEE LVM+ESDI+ ++
Sbjct: 60  KVGDNVLFGAYAGTKVKV-EGEELLVMKESDILAVL 94


>gi|228471598|ref|ZP_04056372.1| chaperonin GroS [Capnocytophaga gingivalis ATCC 33624]
 gi|228277017|gb|EEK15703.1| chaperonin GroS [Capnocytophaga gingivalis ATCC 33624]
          Length = 92

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++    +E  TA+G I+IPDT  EKP    G+++ VGAG  +         V
Sbjct: 5   LKPLADRVLIEPAPAETTTASG-IIIPDTAQEKPQ--KGKVVAVGAGTKENP-----ITV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VL+GK++GTE+KL +G+ YL+M+E+D++GI+
Sbjct: 57  KVGNTVLYGKYAGTELKL-EGKTYLIMRENDLLGIL 91


>gi|255323982|ref|ZP_05365108.1| chaperonin GroS [Corynebacterium tuberculostearicum SK141]
 gi|311739992|ref|ZP_07713826.1| chaperone GroES [Corynebacterium pseudogenitalium ATCC 33035]
 gi|255299162|gb|EET78453.1| chaperonin GroS [Corynebacterium tuberculostearicum SK141]
 gi|311305065|gb|EFQ81134.1| chaperone GroES [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 97

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  +  G+V    V
Sbjct: 4   IKPLEDRVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VVAVGPGRTNDKGEVTPVGV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F K+ GTE+K N GEEYL++   D++ ++
Sbjct: 61  NEGDTVVFSKYGGTELKYN-GEEYLLLSSRDLLAVI 95


>gi|333026575|ref|ZP_08454639.1| putative chaperonin GroS [Streptomyces sp. Tu6071]
 gi|332746427|gb|EGJ76868.1| putative chaperonin GroS [Streptomyces sp. Tu6071]
          Length = 111

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 5/100 (5%)

Query: 5   HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVI 64
            K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ +
Sbjct: 15  SKVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERL 70

Query: 65  EPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             +V  GDIVL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 71  PLDVKTGDIVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 109


>gi|260576473|ref|ZP_05844463.1| chaperonin Cpn10 [Rhodobacter sp. SW2]
 gi|259021356|gb|EEW24662.1| chaperonin Cpn10 [Rhodobacter sp. SW2]
          Length = 95

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
             P   RV+VRR++ E KT  G ++IPDT  EKP    GE++ VG G  + +G  +   V
Sbjct: 3   FTPLHDRVLVRRIEGEEKT-KGGLIIPDTAKEKPI--EGEVVAVGPGGFNSTGSRLPMSV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF KW GTEI    GEE L +++++I+ IV
Sbjct: 60  KVGDRVLFAKWGGTEIPYG-GEELLCIKDAEIIAIV 94


>gi|161833792|ref|YP_001597988.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri GWSS]
 gi|152206282|gb|ABS30592.1| 10 kDa chaperonin GroES [Candidatus Sulcia muelleri GWSS]
          Length = 92

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RVV+    +E KT++G I+IPDT  EKP    G ++ VG G      K  EP  
Sbjct: 6   IKPLSDRVVIEPSPAETKTSSG-IIIPDTAKEKPQ--EGIVVAVGLG------KKNEPLT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G+ VL+GK+SGTE++LN G++YL+M+ESDI+ I+
Sbjct: 57  VKTGNKVLYGKYSGTELRLN-GKDYLIMRESDILAII 92


>gi|62484815|emb|CAI78832.1| co-chaperonin [uncultured bacterium]
          Length = 98

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   +V+++RL+++ +T +G I++PD+  EKP    G ++  G G +  SG+    +V
Sbjct: 6   IRPLGEKVLIKRLEADEQT-SGGIVLPDSAKEKPK--QGTVLKAGDGKLLDSGERQALQV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VLF  ++GTEIK+ +GEE L+M ESD++ ++
Sbjct: 63  KKGDKVLFTSYAGTEIKV-EGEEMLIMDESDVLAVL 97


>gi|227541801|ref|ZP_03971850.1| co-chaperonin GroES [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227182244|gb|EEI63216.1| co-chaperonin GroES [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 120

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+  ++E  TA+G ++IPD+  EKP  ++  +  VG G   + GK +  ++
Sbjct: 28  IKPLEDRILVQINEAETTTASG-LVIPDSAKEKPQQAT--VKAVGPGRF-EDGKRVPLDI 83

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD+V+F K+ GTEIK  DGEEYL++   DI+ ++
Sbjct: 84  SEGDVVVFSKYGGTEIKF-DGEEYLILSARDILAVI 118


>gi|282933644|ref|ZP_06339008.1| chaperonin GroS [Lactobacillus jensenii 208-1]
 gi|281302232|gb|EFA94470.1| chaperonin GroS [Lactobacillus jensenii 208-1]
          Length = 94

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+ ++ E +   G I++     EKP+   GE++ VG+G++   GKV+   V
Sbjct: 2   LQPIGDRVIVK-VKKEEEETVGGIVLASNAKEKPT--EGEVVAVGSGLVTSEGKVLPMTV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+SGT +K  DGEEYLV+ E DI+ IV
Sbjct: 59  KEGDRVVYDKYSGTNVKY-DGEEYLVLHEKDILAIV 93


>gi|164687037|ref|ZP_02211065.1| hypothetical protein CLOBAR_00663 [Clostridium bartlettii DSM
           16795]
 gi|164603922|gb|EDQ97387.1| hypothetical protein CLOBAR_00663 [Clostridium bartlettii DSM
           16795]
          Length = 95

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+++ ++E KTA+G I++P    E+P  +  E++ VG G M   G  ++ EV
Sbjct: 3   IRPLADRVVIKKFEAEEKTASG-IVLPTAAKEQPQMA--EVIEVGPGGM-VDGNEVKMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++G EIK  DGE Y+++++SDI+ IV
Sbjct: 59  KVGDKVIFSKYAGNEIK-ADGENYIILRQSDILAIV 93


>gi|119476965|ref|ZP_01617246.1| Co-chaperonin GroES (HSP10) [marine gamma proteobacterium HTCC2143]
 gi|119449772|gb|EAW31009.1| Co-chaperonin GroES (HSP10) [marine gamma proteobacterium HTCC2143]
          Length = 96

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E +T+TG I++  +  EKP+   GE++ VG G +  SG++    V
Sbjct: 3   IRPLYDRVVVRRKEEE-ETSTGGIILSGSAKEKPN--QGEVLAVGEGKVLDSGEIRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+     DGEE ++M ES+I GIV
Sbjct: 60  KVGDQVVFGQYAGSNTITVDGEELIIMGESEIFGIV 95


>gi|90962187|ref|YP_536103.1| 10 kDa chaperonin GROES [Lactobacillus salivarius UCC118]
 gi|123086772|sp|Q1WSV9|CH10_LACS1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|90821381|gb|ABE00020.1| 10 kDa chaperonin GROES [Lactobacillus salivarius UCC118]
          Length = 94

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV++ +Q E + + G I+I     EKP+  +GE++ VG G +  +G+ +EPEV
Sbjct: 2   LKPLGDRVVLK-VQKEEEQSIGGIVIASNAKEKPT--TGEVIAVGNGRILDNGQRVEPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V+F K++G+E+K  +GEEYLV++E+DI+ ++
Sbjct: 59  KVGQSVVFDKYAGSEVKY-EGEEYLVIRENDIIAVI 93


>gi|23098110|ref|NP_691576.1| co-chaperonin GroES [Oceanobacillus iheyensis HTE831]
 gi|29839306|sp|Q8CXL4|CH10_OCEIH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|22776335|dbj|BAC12611.1| class I heat shock protein (chaperonin) [Oceanobacillus iheyensis
           HTE831]
          Length = 93

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 69/96 (71%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+  ++ E  TA+G I++PD+  EKP    G+++ VG+G + ++G+ I  EV
Sbjct: 2   IKPLGDRVVIELVEQEETTASG-IVLPDSAKEKPQ--EGKVVAVGSGRV-ENGEKIALEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD ++F K++GTE+K  +G EYL+++E+DI+ I+
Sbjct: 58  SEGDRIIFSKFAGTEVKY-EGTEYLILRENDILAII 92


>gi|289641119|ref|ZP_06473287.1| chaperonin Cpn10 [Frankia symbiont of Datisca glomerata]
 gi|289509060|gb|EFD29991.1| chaperonin Cpn10 [Frankia symbiont of Datisca glomerata]
          Length = 101

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G ++ VG G   + 
Sbjct: 1   MTTATKVAIKPLEDRIVVQPSDAEQTTASG-IVIPDTAKEKPQ--EGTVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK +  +V  GD+VL+ K+ GTE+K   GEEYLV+   D++ I+
Sbjct: 57  GKRVPLDVKVGDVVLYSKYGGTEVKYA-GEEYLVLSARDVLAII 99


>gi|227487036|ref|ZP_03917352.1| co-chaperonin GroES [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227093110|gb|EEI28422.1| co-chaperonin GroES [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 96

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+  ++E  TA+G ++IPD+  EKP  ++  +  VG G   + GK +  ++
Sbjct: 4   IKPLEDRILVQINEAETTTASG-LVIPDSAKEKPQQAT--VKAVGPGRF-EDGKRVPLDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD+V+F K+ GTEIK  DGEEYL++   DI+ ++
Sbjct: 60  SEGDVVVFSKYGGTEIKF-DGEEYLILSARDILAVI 94


>gi|29840400|ref|NP_829506.1| co-chaperonin GroES [Chlamydophila caviae GPIC]
 gi|116191|sp|P15598|CH10_CHLCV RecName: Full=10 kDa chaperonin; AltName: Full=11.2 kDa stress
           response protein; AltName: Full=GroES protein; AltName:
           Full=Protein Cpn10
 gi|40578|emb|CAA35765.1| hypA protein [Chlamydophila caviae]
 gi|29834749|gb|AAP05384.1| 10 kDa chaperonin [Chlamydophila caviae GPIC]
          Length = 102

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+R + E  TA G I++PDT  +K   +  E++ +G G  D+ G V+  EV
Sbjct: 10  IKPLGDRILVKR-EEEDSTARGGIILPDTAKKKQDRA--EVLVLGTGKRDKDGNVLPFEV 66

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD VL  K++G E+ + DGEEY+++QES++M ++
Sbjct: 67  TVGDTVLIDKYAGQELTV-DGEEYVIVQESEVMAVL 101


>gi|302334988|ref|YP_003800195.1| Chaperonin Cpn10 [Olsenella uli DSM 7084]
 gi|301318828|gb|ADK67315.1| Chaperonin Cpn10 [Olsenella uli DSM 7084]
          Length = 96

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+    E KTA+G + I     EKP    GE++ VGAG ++  G+ I P+V
Sbjct: 3   LKPLGDRVLVKPAPKEEKTASG-LYISSGAQEKPQ--RGEVIAVGAGKLNDKGERIVPDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD V +GK+ G EIK+ DGE++L+++  DI  IV E
Sbjct: 60  KVGDQVYYGKFGGNEIKV-DGEDFLLLRADDIYAIVTE 96


>gi|261409072|ref|YP_003245313.1| chaperonin Cpn10 [Paenibacillus sp. Y412MC10]
 gi|315649233|ref|ZP_07902322.1| chaperonin Cpn10 [Paenibacillus vortex V453]
 gi|329928445|ref|ZP_08282314.1| chaperonin GroS [Paenibacillus sp. HGF5]
 gi|261285535|gb|ACX67506.1| chaperonin Cpn10 [Paenibacillus sp. Y412MC10]
 gi|315275221|gb|EFU38590.1| chaperonin Cpn10 [Paenibacillus vortex V453]
 gi|328937781|gb|EGG34188.1| chaperonin GroS [Paenibacillus sp. HGF5]
          Length = 93

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V  ++ E  TA G I++PD+  EKP    G+++ VG+G + + G  +  EV
Sbjct: 2   IRPLGERVLVEPIEQEETTAFG-IVLPDSAKEKPQ--EGKVIAVGSGSL-KDGARVPLEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTEIK  +G+EYL+M+ESDI  I+
Sbjct: 58  KEGDRVIFSKYAGTEIKY-EGKEYLIMKESDIHAIL 92


>gi|293977903|ref|YP_003543333.1| co-chaperonin GroES [Candidatus Sulcia muelleri DMIN]
 gi|292667834|gb|ADE35469.1| Co-chaperonin GroES (HSP10) [Candidatus Sulcia muelleri DMIN]
          Length = 91

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (65%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RVV+    +E KT++G I+IPDT  EKP    G ++ VG G      K  EP  
Sbjct: 5   IKPLSDRVVIEPSPAETKTSSG-IIIPDTAKEKPQ--EGIVVAVGLG------KKNEPLT 55

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G+ VL+GK+SGTE++LN G++YL+M+ESDI+ I+
Sbjct: 56  VKTGNKVLYGKYSGTELRLN-GKDYLIMRESDILAII 91


>gi|254517153|ref|ZP_05129211.1| chaperonin GroS [gamma proteobacterium NOR5-3]
 gi|219674658|gb|EED31026.1| chaperonin GroS [gamma proteobacterium NOR5-3]
          Length = 96

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR + E +T  G IL+P +  EKP+   GE++ VG G    SG++    V
Sbjct: 3   IRPLYDRVVIRRKEEE-ETTAGGILLPGSAKEKPN--QGEVVAVGNGKALDSGEIRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GDIV+FG+++G+     DGEE ++M ES+I  +V
Sbjct: 60  NVGDIVVFGQYAGSNTIEVDGEELIIMGESEIYAVV 95


>gi|258545457|ref|ZP_05705691.1| chaperonin GroES [Cardiobacterium hominis ATCC 15826]
 gi|258519290|gb|EEV88149.1| chaperonin GroES [Cardiobacterium hominis ATCC 15826]
          Length = 94

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+V+R + E  TA G I++  + +EKPS   G ++ VG G   + G+V   +V
Sbjct: 3   LRPLHDRVIVKRQEKETTTA-GGIVLASSAAEKPS--EGVVVAVGPG-KSKHGEVRPLDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFGK+SG+E+K+ DGE+Y++M+E +I  ++
Sbjct: 59  KVGDRVLFGKFSGSEVKV-DGEDYVIMREEEIFAVI 93


>gi|187933436|ref|YP_001884620.1| chaperonin GroS [Clostridium botulinum B str. Eklund 17B]
 gi|226701746|sp|B2TIX6|CH10_CLOBB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|187721589|gb|ACD22810.1| chaperonin GroS [Clostridium botulinum B str. Eklund 17B]
          Length = 94

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           ++P   RVV+++L++E KT +G +L   T S K      E++ VG G ++D  G  IE E
Sbjct: 3   IKPLGNRVVIKKLEAEEKTKSGIVL---TGSAKEVPQEAEVVAVGPGSIVD--GTKIEME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+ K+SGTE+KL DGEEY+++++ DI+ IV
Sbjct: 58  VKVGDKVLYSKYSGTEVKL-DGEEYMILKQDDILAIV 93


>gi|322384758|ref|ZP_08058426.1| co-chaperonin GroES-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150457|gb|EFX43950.1| co-chaperonin GroES-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 93

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 65/96 (67%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+  +  E  TA+G I++P+T  EKP    G+++ VG+G + + G+ I  EV
Sbjct: 2   IKPLGDRVVIEAIAKEETTASG-IVLPETAKEKPQ--EGKVVAVGSGTL-KDGERIALEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+K  DG E L+M+ESDI+ ++
Sbjct: 58  KEGDRVIFSKYAGTEVKY-DGRELLIMRESDILAVL 92


>gi|323488878|ref|ZP_08094117.1| co-chaperonin GroES [Planococcus donghaensis MPA1U2]
 gi|323397441|gb|EGA90248.1| co-chaperonin GroES [Planococcus donghaensis MPA1U2]
          Length = 94

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV++  +++E KT++G I++P +  EKP    G ++ VG G++ ++G+    +V
Sbjct: 2   LRPLGDRVIIELIEAEEKTSSG-IVLPGSAQEKPQ--EGHVIAVGNGLIRENGQRTALDV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++G+E+K  +G+EYL+++E+DI+ ++
Sbjct: 59  QAGDRVIFSKYAGSELKY-EGKEYLILRENDILAVL 93


>gi|21780187|gb|AAM77651.1|AF522274_1 cp10-like protein [Gossypium hirsutum]
          Length = 256

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV ++  ++E KTA G +L+ +   EKPS   G ++ VG G +D+ G +    V
Sbjct: 163 LKPLNDRVFIKVSEAEEKTA-GGLLLTEASKEKPSI--GTVIAVGPGTLDEEGNLKPLSV 219

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G+ VL+ K++G + K NDG  Y+ ++ SD+M ++
Sbjct: 220 SPGNTVLYSKYAGNDFKGNDGSNYIALRASDVMAVL 255



 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+  ++E KT  G IL+P T   KP    GE++ VG G    + K  E  V
Sbjct: 65  VKPLGDRVLVKIKETEEKTE-GGILLPTTAQSKPQG--GEVVAVGEGKTIGNTKS-ESSV 120

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ N G  +L+++E DI+G++
Sbjct: 121 KTGAQVIYSKYAGTEVEFN-GANHLLLKEDDIVGLL 155


>gi|17231153|ref|NP_487701.1| co-chaperonin GroES [Nostoc sp. PCC 7120]
 gi|75909832|ref|YP_324128.1| co-chaperonin GroES [Anabaena variabilis ATCC 29413]
 gi|23813788|sp|Q8YQZ9|CH10_NOSS1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|17132794|dbj|BAB75360.1| chaperonin GroES [Nostoc sp. PCC 7120]
 gi|75703557|gb|ABA23233.1| Chaperonin Cpn10 [Anabaena variabilis ATCC 29413]
 gi|222354887|gb|ACM48254.1| GroES [Nostoc sp. PCC 7120]
          Length = 103

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G + +PDT  EKP    GE++ +GAG  +  G   E EV
Sbjct: 11  VKPLGDRVFVKVSASEEKTA-GGLYLPDTAKEKPQV--GEVVALGAGKRNDDGSRQELEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT++KL   EEY+++ E DI+ +V
Sbjct: 68  KVGDKVLYSKYAGTDVKLGT-EEYVLLSEKDILAVV 102


>gi|311747604|ref|ZP_07721389.1| chaperonin GroS [Algoriphagus sp. PR1]
 gi|126575586|gb|EAZ79896.1| chaperonin GroS [Algoriphagus sp. PR1]
          Length = 92

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (62%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV+V+   +E KTA+G + IPDT  EKP    G ++ VG G  D      EP  
Sbjct: 6   IKPLADRVLVQPAAAEEKTASG-LYIPDTAKEKPQ--KGTVVAVGNGKKD------EPLT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK+SGTE+ + DG +YL+M+ESDI  I+
Sbjct: 57  VQVGDTVLYGKYSGTELNV-DGGDYLIMRESDIFAIL 92


>gi|220931049|ref|YP_002507957.1| Chaperonin GroES (HSP10) [Halothermothrix orenii H 168]
 gi|259585885|sp|B8D0Z3|CH10_HALOH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219992359|gb|ACL68962.1| Chaperonin GroES (HSP10) [Halothermothrix orenii H 168]
          Length = 94

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 6/96 (6%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+ L+ E KT +G I++PDT  E+     GEI+ VG G   + G   +PEV
Sbjct: 3   IKPLNDRVAVKYLEEEEKTRSG-IVLPDTAKEE-KPQQGEIVAVGKGCTPEDG---DPEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V+F K+SGT++ + DGE+Y+++   D++ ++
Sbjct: 58  KVGDLVVFDKYSGTKVTI-DGEDYIILNLEDVLAVI 92


>gi|307243691|ref|ZP_07525831.1| chaperonin GroS [Peptostreptococcus stomatis DSM 17678]
 gi|306492900|gb|EFM64913.1| chaperonin GroS [Peptostreptococcus stomatis DSM 17678]
          Length = 93

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 70/97 (72%), Gaps = 6/97 (6%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++R+++E KTA+G I++     EKP  +  E++ VG+G++D  GK IE EV
Sbjct: 3   IKPLGDRVVLKRVEAEEKTASG-IILTGAAKEKPQFA--EVVAVGSGIVD--GKEIEMEV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD V++ K++GTE+K+ D +E++V++  DI+GI+V
Sbjct: 58  EVGDKVIYNKFAGTEVKI-DKDEFIVLKIEDIVGILV 93


>gi|320104362|ref|YP_004179953.1| Chaperonin Cpn10 [Isosphaera pallida ATCC 43644]
 gi|319751644|gb|ADV63404.1| Chaperonin Cpn10 [Isosphaera pallida ATCC 43644]
          Length = 97

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV R +++  TA G I++PDT  +KP    G+++ VG G + + GK  E +V
Sbjct: 3   IQPLGDRVVVEREEAQATTA-GGIVLPDTAKDKPQ--HGKVLAVGTGRLTKDGKRRELQV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF  ++G E KLN   + L+M+E DI  +V
Sbjct: 60  KVGDRVLFSSYAGDEFKLNGTTKVLLMREDDIYAVV 95


>gi|294630951|ref|ZP_06709511.1| chaperonin GroS [Streptomyces sp. e14]
 gi|292834284|gb|EFF92633.1| chaperonin GroS [Streptomyces sp. e14]
          Length = 102

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 61/96 (63%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   + G  +  +V
Sbjct: 10  IKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-EDGNRLPLDV 65

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+ K+ GTE+K N+ EEYLV+   D++ I+
Sbjct: 66  KVGDVVLYSKYGGTEVKYNN-EEYLVLSARDVLAII 100


>gi|163787653|ref|ZP_02182100.1| hypothetical protein FBALC1_03902 [Flavobacteriales bacterium
           ALC-1]
 gi|159877541|gb|EDP71598.1| hypothetical protein FBALC1_03902 [Flavobacteriales bacterium
           ALC-1]
          Length = 91

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  +++E  TA+G I+IPD   EKP    G ++ +G G  D      EP  
Sbjct: 5   IKPLADRVLVEPMEAETTTASG-IIIPDNAKEKPQ--KGTVVAIGNGKKD------EPLT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+ GTE+KL +G++YL+M+ESDI+ I+
Sbjct: 56  VKVGDTVLYGKYGGTELKL-EGKDYLMMRESDILAII 91


>gi|189183165|ref|YP_001936950.1| chaperonin, 10 kDa [Orientia tsutsugamushi str. Ikeda]
 gi|226704018|sp|B3CQ25|CH10_ORITI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|189179936|dbj|BAG39716.1| chaperonin, 10 kDa [Orientia tsutsugamushi str. Ikeda]
          Length = 94

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 60/92 (65%), Gaps = 5/92 (5%)

Query: 10  RPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVS 69
           +P   RV+V  + ++   A G ILIPDT  EKP+   G ++ VG G  +  G +   +V 
Sbjct: 4   QPLYDRVLVEPIHND--EAHGKILIPDTAKEKPT--EGIVVMVGGGYRNDKGDITPLKVK 59

Query: 70  KGDIVLFGKWSGTEIKLNDGEEYLVMQESDIM 101
           KGD +++ KW+GTEIKL + ++Y+V++ESDI+
Sbjct: 60  KGDTIVYTKWAGTEIKL-ESKDYVVIKESDIL 90


>gi|219847973|ref|YP_002462406.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485]
 gi|219542232|gb|ACL23970.1| chaperonin Cpn10 [Chloroflexus aggregans DSM 9485]
          Length = 97

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVV+    E +   G I +PDT S K     GE++ VG G     GK+I   V
Sbjct: 3   VRPLHDRVVVKPKPKE-EKTKGGIFLPDTAS-KERPMEGEVIAVGPGRRADDGKIIPMTV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             G  VL+ K++GTE K++D EEYL++QE DI+GI+ E
Sbjct: 61  KVGQHVLYAKYAGTEFKIDD-EEYLILQEKDILGIIEE 97


>gi|186681315|ref|YP_001864511.1| co-chaperonin GroES [Nostoc punctiforme PCC 73102]
 gi|226704016|sp|B2IT70|CH10_NOSP7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|186463767|gb|ACC79568.1| chaperonin Cpn10 [Nostoc punctiforme PCC 73102]
          Length = 103

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G + +PDT  EKP    GE++ +G G  ++ G   E E+
Sbjct: 11  VKPLSDRVFVKVNASEEKTA-GGLYLPDTAKEKPQV--GEVVALGPGKRNEDGSRQELEI 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VL+ K++GT+IKL   EEY+++ E DI+ +V+
Sbjct: 68  KVGDKVLYSKYAGTDIKLGT-EEYVLLSEKDILAVVI 103


>gi|297616762|ref|YP_003701921.1| chaperonin Cpn10 [Syntrophothermus lipocalidus DSM 12680]
 gi|297144599|gb|ADI01356.1| Chaperonin Cpn10 [Syntrophothermus lipocalidus DSM 12680]
          Length = 97

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQ-SEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           L+P   R+V++ ++ +E KTA+G I++PDT  EKP    GE++ VG G +  +G+ I  E
Sbjct: 3   LKPLGDRIVLKVIETAEEKTASG-IVLPDTAKEKPQ--QGEVLAVGPGRILDNGERIPME 59

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD V++ K++GTE+K+ DG+E LV+ E DI+  V
Sbjct: 60  VAVGDKVIYSKYAGTEVKI-DGQELLVISERDILAKV 95


>gi|284048767|ref|YP_003399106.1| Chaperonin Cpn10 [Acidaminococcus fermentans DSM 20731]
 gi|283952988|gb|ADB47791.1| Chaperonin Cpn10 [Acidaminococcus fermentans DSM 20731]
          Length = 96

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 65/96 (67%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P    VVV  +  E KT++G I +PDT + K    +G+++ VG G + ++G  +  EV
Sbjct: 2   LKPLDDHVVVEPIVQEEKTSSG-IYLPDT-AHKDKPQTGKVVAVGTGRLMENGTRVPSEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V+F K+SG+++ L DG++Y+++++SDI+ +V
Sbjct: 60  KAGDVVVFAKYSGSDVTL-DGKDYIILRDSDILAVV 94


>gi|114567371|ref|YP_754525.1| groes [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|122317683|sp|Q0AVV0|CH10_SYNWW RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|114338306|gb|ABI69154.1| groes [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 96

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV+  +   +     + +PDT  EKP    GE++ VG G  +  G+ +  +V
Sbjct: 3   IQPLGDRLVVKVAEVAAEKTKSGLYVPDTAKEKPQ--EGEVLAVGPGAFNDKGERMPMDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
           + GD ++F K+ GTEIK+ DGEEYLVM + DI+ 
Sbjct: 61  AVGDKIIFSKYGGTEIKI-DGEEYLVMSQRDILA 93


>gi|86739345|ref|YP_479745.1| co-chaperonin GroES [Frankia sp. CcI3]
 gi|86566207|gb|ABD10016.1| chaperonin Cpn10 [Frankia sp. CcI3]
          Length = 101

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  ++P   R+VV+   +E  TA+G I+IPDT  EKP    G ++ VG G   + 
Sbjct: 1   MTTATKVAIKPLEDRIVVQPSDAEQTTASG-IVIPDTAKEKPQ--EGIVLAVGPGRF-ED 56

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK +  +V  GD+VL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 57  GKRVPLDVKVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 99


>gi|227494835|ref|ZP_03925151.1| chaperone GroES [Actinomyces coleocanis DSM 15436]
 gi|226831287|gb|EEH63670.1| chaperone GroES [Actinomyces coleocanis DSM 15436]
          Length = 98

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+VV++L++E  TA+G ++IP    EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   IKPLADRIVVKQLEAEQTTASG-LVIPGAAKEKPQ--EGEVVAVGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+ GTE+K   GEE+L+++  D++ ++
Sbjct: 62  KVGDTVIFSKFGGTEVKYL-GEEFLILETRDVLAVI 96


>gi|139438486|ref|ZP_01772002.1| Hypothetical protein COLAER_00992 [Collinsella aerofaciens ATCC
           25986]
 gi|133776025|gb|EBA39845.1| Hypothetical protein COLAER_00992 [Collinsella aerofaciens ATCC
           25986]
          Length = 108

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+  ++E KTA+G + I     EKP    G I+ VGAG ++  G+ I  +V
Sbjct: 15  LKPLADRVLVKPDEAEQKTASG-LYIASNAQEKPQ--RGTIVAVGAGKVNDKGERIPMDV 71

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V++GK+ G E+K+ DGE+YL+M+  DI  +V
Sbjct: 72  QVGDVVIYGKFGGNEVKV-DGEKYLLMRADDIYAVV 106


>gi|313903527|ref|ZP_07836917.1| Chaperonin Cpn10 [Thermaerobacter subterraneus DSM 13965]
 gi|313466080|gb|EFR61604.1| Chaperonin Cpn10 [Thermaerobacter subterraneus DSM 13965]
          Length = 108

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+ L+ E +T  G I++PDT  EKP    GE++ VG G + ++G+ +  EV
Sbjct: 16  LRPLGDRVVVKVLEEEERTK-GGIILPDTAKEKPQ--QGEVLAVGTGRILENGQKVPLEV 72

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+KL+D EE L++ E DI+ IV
Sbjct: 73  KEGDRVIFSKYAGTEVKLDD-EELLILSERDILAIV 107


>gi|108798125|ref|YP_638322.1| chaperonin Cpn10 [Mycobacterium sp. MCS]
 gi|119867221|ref|YP_937173.1| chaperonin Cpn10 [Mycobacterium sp. KMS]
 gi|126433783|ref|YP_001069474.1| chaperonin Cpn10 [Mycobacterium sp. JLS]
 gi|108768544|gb|ABG07266.1| chaperonin Cpn10 [Mycobacterium sp. MCS]
 gi|119693310|gb|ABL90383.1| chaperonin Cpn10 [Mycobacterium sp. KMS]
 gi|126233583|gb|ABN96983.1| chaperonin Cpn10 [Mycobacterium sp. JLS]
          Length = 127

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D  G K I  +
Sbjct: 33  IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDDEGEKRIPLD 89

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GD V++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 90  VSEGDTVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 125


>gi|88855858|ref|ZP_01130521.1| co-chaperonin GroES [marine actinobacterium PHSC20C1]
 gi|88815182|gb|EAR25041.1| co-chaperonin GroES [marine actinobacterium PHSC20C1]
          Length = 96

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 64/97 (65%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++ +E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  ++
Sbjct: 3   IKPLEDRIVIKQVDAEQTTASG-LVIPDTAKEKPQ--EGEVVAVGPGRIDDNGNRVPLDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + GD V++ K+ GTE+K   G++ LV+   D++ +VV
Sbjct: 60  AVGDKVIYSKYGGTEVKYG-GDDLLVLSARDVLAVVV 95


>gi|323141681|ref|ZP_08076559.1| chaperonin GroS [Phascolarctobacterium sp. YIT 12067]
 gi|322413837|gb|EFY04678.1| chaperonin GroS [Phascolarctobacterium sp. YIT 12067]
          Length = 96

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDT-VSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           L+P    V+V  ++ E KTA+G I +PDT V EKP    G+++ VG G    +G +I+PE
Sbjct: 2   LKPLADHVIVEVVEVEEKTASG-IFLPDTAVKEKPQ--QGKVLAVGRGKYSDNGTLIKPE 58

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD V+F K+SGT +K + G++YL++ E DI+  +
Sbjct: 59  VNVGDEVIFAKYSGTPVK-HQGKDYLILSERDILATI 94


>gi|261880823|ref|ZP_06007250.1| chaperone GroES [Prevotella bergensis DSM 17361]
 gi|270332439|gb|EFA43225.1| chaperone GroES [Prevotella bergensis DSM 17361]
          Length = 90

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E K   G I+IPDT  EKP    G+I+ VG G  D+     E  +
Sbjct: 3   VKPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKIVAVGQGTKDE-----EMIL 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+GK++GTE++  DGE+YL+M++SDI+ IV
Sbjct: 54  KEGDEVLYGKYAGTELE-TDGEKYLMMRQSDILAIV 88


>gi|291457161|ref|ZP_06596551.1| chaperonin GroS [Bifidobacterium breve DSM 20213]
 gi|51094324|gb|AAT95333.1| Hsp10 [Bifidobacterium breve UCC2003]
 gi|291380996|gb|EFE88514.1| chaperonin GroS [Bifidobacterium breve DSM 20213]
          Length = 97

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ ++E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAEAETQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   DI+ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHY-EGEDYLIVSSRDILAIL 96


>gi|254392000|ref|ZP_05007191.1| 10 kDa chaperonin [Streptomyces clavuligerus ATCC 27064]
 gi|294814522|ref|ZP_06773165.1| 10 kDa chaperonin [Streptomyces clavuligerus ATCC 27064]
 gi|326442912|ref|ZP_08217646.1| co-chaperonin GroES [Streptomyces clavuligerus ATCC 27064]
 gi|197705678|gb|EDY51490.1| 10 kDa chaperonin [Streptomyces clavuligerus ATCC 27064]
 gi|294327121|gb|EFG08764.1| 10 kDa chaperonin [Streptomyces clavuligerus ATCC 27064]
          Length = 102

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  ++P   R+VV+ L +E  TA+G ++IPDT  EKP    G ++ VG G   ++G+ + 
Sbjct: 7   KVAIKPLEDRIVVQPLDAEQTTASG-LVIPDTAKEKPQ--EGVVLAVGPGRF-ENGERLP 62

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +V  GD+VL+ K+ GTE+K + GEEYLV+   D++ I+
Sbjct: 63  LDVQVGDVVLYSKYGGTEVKYS-GEEYLVLSARDVLAII 100


>gi|332519835|ref|ZP_08396299.1| Chaperonin Cpn10 [Lacinutrix algicola 5H-3-7-4]
 gi|332044394|gb|EGI80588.1| Chaperonin Cpn10 [Lacinutrix algicola 5H-3-7-4]
          Length = 92

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (63%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V  L +E +TA+G + IPD+  EK     G ++ VG G  D      EP  
Sbjct: 6   IKPLADRVLVEALPAETQTASG-LYIPDSAQEK--QHKGTVVAVGNGKKD------EPLT 56

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+SG+EIKL DG+++L+M+E DIM I+
Sbjct: 57  VKVGDTVLYGKYSGSEIKL-DGQDFLMMREEDIMAII 92


>gi|227529536|ref|ZP_03959585.1| chaperone GroES [Lactobacillus vaginalis ATCC 49540]
 gi|227350621|gb|EEJ40912.1| chaperone GroES [Lactobacillus vaginalis ATCC 49540]
          Length = 112

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           N L+P   RVV++    E KT  G I++   V EKP+  +G+++ VGAG    +G+ + P
Sbjct: 18  NVLKPLGDRVVLKAETEEEKT-VGGIVLASNVKEKPT--TGKVIAVGAGRTLDNGEKLAP 74

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD VLF K++G E++ N GE+YLV+ E D++ ++
Sbjct: 75  AVKEGDRVLFDKYAGNEVEYN-GEKYLVVHEKDLVAVI 111


>gi|296122770|ref|YP_003630548.1| chaperonin Cpn10 [Planctomyces limnophilus DSM 3776]
 gi|296015110|gb|ADG68349.1| chaperonin Cpn10 [Planctomyces limnophilus DSM 3776]
          Length = 104

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (63%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   R+V++R ++E KTA G I++PD+ ++KP    GE++ VG G +  +G  I   V
Sbjct: 12  LTPLGDRLVLKRAEAEKKTA-GGIVLPDSATDKPQ--RGEVLSVGEGHVKNNGNRIPLTV 68

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD V+F  ++G E K+ D E YL+++ESD++ I+ 
Sbjct: 69  KVGDEVIFSSYAGDEFKVGD-ETYLLLRESDVLAIIA 104


>gi|307150333|ref|YP_003885717.1| Chaperonin Cpn10 [Cyanothece sp. PCC 7822]
 gi|306980561|gb|ADN12442.1| Chaperonin Cpn10 [Cyanothece sp. PCC 7822]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GE++ VG G  +  G     EV
Sbjct: 11  VKPLGDRVFVKVSPSEEKTA-GGILLPDTAKEKPQV--GEVVAVGPGKRNDDGSRSPIEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  GE+Y+++ E DI+  V
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GEDYVLLSEKDILAAV 102


>gi|15672375|ref|NP_266549.1| co-chaperonin GroES [Lactococcus lactis subsp. lactis Il1403]
 gi|281490935|ref|YP_003352915.1| 10 kDa chaperonin GroES [Lactococcus lactis subsp. lactis KF147]
 gi|584918|sp|P37283|CH10_LACLA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|12723266|gb|AAK04491.1|AE006276_6 10 KD chaperonin [Lactococcus lactis subsp. lactis Il1403]
 gi|287870|emb|CAA50445.1| groES [Lactococcus lactis]
 gi|281374693|gb|ADA64213.1| 10 kDa chaperonin GroES [Lactococcus lactis subsp. lactis KF147]
 gi|326405969|gb|ADZ63040.1| chaperonin GroES [Lactococcus lactis subsp. lactis CV56]
          Length = 94

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+R ++ E + + G I++     EKP   + E++ VG G  +  G +I P V
Sbjct: 2   LKPLENRVVLR-VKEEEEKSMGGIVLTSASQEKPQ--TAEVVAVGEGKTNHHGTLISPLV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GT +K+ DGEE+L++++SD++ IV
Sbjct: 59  KVGDTVIFEKFAGTTVKM-DGEEFLILKDSDLLAIV 93


>gi|28493041|ref|NP_787202.1| co-chaperonin GroES [Tropheryma whipplei str. Twist]
 gi|28476081|gb|AAO44171.1| 10 kDa chaperone [Tropheryma whipplei str. Twist]
          Length = 120

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+R   +E  TA+G ++IPDT  E+P    GE++ VG G ++  G  +  +V
Sbjct: 27  IKPLGDRVVIRPADAEQVTASG-LVIPDTAQERPQ--EGEVVAVGPGSLNDDGNRVPLDV 83

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD V++ ++ GTE+KL D +EY ++   D++ +V
Sbjct: 84  SVGDRVIYARYGGTEVKLGD-DEYTILASRDVLAVV 118


>gi|56751797|ref|YP_172498.1| co-chaperonin GroES [Synechococcus elongatus PCC 6301]
 gi|81301123|ref|YP_401331.1| co-chaperonin GroES [Synechococcus elongatus PCC 7942]
 gi|116204|sp|P07889|CH10_SYNP6 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|93141238|sp|P22880|CH10_SYNE7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|48023|emb|CAA29361.1| unnamed protein product [Synechococcus elongatus PCC 6301]
 gi|56686756|dbj|BAD79978.1| GroES protein [Synechococcus elongatus PCC 6301]
 gi|81170004|gb|ABB58344.1| GroES protein, 10 kD chaperonin [Synechococcus elongatus PCC 7942]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 59/94 (62%), Gaps = 4/94 (4%)

Query: 11  PTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSK 70
           P   RV V+  ++E KTA G I++PD   EKP    GEI+ VG G  +  G    PEV  
Sbjct: 13  PLGDRVFVKVAEAEEKTA-GGIILPDNAKEKPQV--GEIVAVGPGKRNDDGSRQAPEVKI 69

Query: 71  GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GD VL+ K++GT+IKL + ++Y+++ E DI+ +V
Sbjct: 70  GDKVLYSKYAGTDIKLGN-DDYVLLSEKDILAVV 102


>gi|154520|gb|AAA27313.1| chaperonin [Synechococcus sp.]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           + P   RV V+  ++E KTA G I++PD   EKP    GEI+ VG G  +  G    PEV
Sbjct: 11  VTPLGDRVFVKVAEAEEKTA-GGIILPDNAKEKPQV--GEIVAVGPGKSNDDGSRQAPEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL + ++Y+++ E DI+ +V
Sbjct: 68  KIGDKVLYSKYAGTDIKLGN-DDYVLLSEKDILAVV 102


>gi|319950732|ref|ZP_08024628.1| co-chaperonin GroES [Dietzia cinnamea P4]
 gi|319435610|gb|EFV90834.1| co-chaperonin GroES [Dietzia cinnamea P4]
          Length = 95

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V  +++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G  I  ++
Sbjct: 3   IKPLEDKILVEAIEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGKGRFDEDGDRIPMDI 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTEIK  +G+EYL++   D++ ++
Sbjct: 60  KEGDKVIYSKYGGTEIKY-EGKEYLILSSRDVLAVI 94


>gi|149974|gb|AAA25365.1| immunogenic protein MPB57 [Mycobacterium bovis]
 gi|581313|emb|CAA32149.1| unnamed protein product [Mycobacterium bovis]
 gi|226208|prf||1501258A immunogenic protein MPB57
          Length = 100

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 63/95 (66%), Gaps = 5/95 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMG 102
           V++GD V++ K+ GTEIK N GEEYL++   D++G
Sbjct: 63  VAEGDTVIYSKYGGTEIKYN-GEEYLILSARDVVG 96


>gi|170079052|ref|YP_001735690.1| co-chaperonin GroES [Synechococcus sp. PCC 7002]
 gi|226704053|sp|B1XK80|CH10_SYNP2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|169886721|gb|ACB00435.1| chaperonin, 10 kDa protein [Synechococcus sp. PCC 7002]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV V+  +SE KTA G IL+PD+  EKP    GE++ VG G  +  G     +V
Sbjct: 11  LKPLGDRVFVKVSESEEKTA-GGILLPDSAKEKPQI--GEVVAVGEGKRNDDGSRSAVDV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL+ G++Y+++ E DI+  V
Sbjct: 68  KVGDKVLYSKYAGTDIKLS-GDDYVLLSEKDILATV 102


>gi|85711846|ref|ZP_01042901.1| co-chaperonin GroES [Idiomarina baltica OS145]
 gi|85694243|gb|EAQ32186.1| co-chaperonin GroES [Idiomarina baltica OS145]
          Length = 96

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 63/95 (66%), Gaps = 3/95 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++R++ E K+A G I++  + +EK  ++ GE++ VG G + +SG+V   +V
Sbjct: 3   LRPLHDRVIIKRIEVEAKSA-GGIVLTGSAAEK--STRGEVVAVGNGRILESGEVRPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLF +  G + +  DGEEYL+M ESDI+ I
Sbjct: 60  KVGDKVLFNEGYGVKTEKIDGEEYLIMSESDILAI 94


>gi|227875106|ref|ZP_03993251.1| chaperone GroES [Mobiluncus mulieris ATCC 35243]
 gi|269977859|ref|ZP_06184815.1| chaperonin GroS [Mobiluncus mulieris 28-1]
 gi|306818373|ref|ZP_07452099.1| chaperone GroES [Mobiluncus mulieris ATCC 35239]
 gi|307701459|ref|ZP_07638478.1| chaperonin GroS [Mobiluncus mulieris FB024-16]
 gi|227844384|gb|EEJ54548.1| chaperone GroES [Mobiluncus mulieris ATCC 35243]
 gi|269933939|gb|EEZ90517.1| chaperonin GroS [Mobiluncus mulieris 28-1]
 gi|304648882|gb|EFM46181.1| chaperone GroES [Mobiluncus mulieris ATCC 35239]
 gi|307613369|gb|EFN92619.1| chaperonin GroS [Mobiluncus mulieris FB024-16]
          Length = 97

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++++++E  TA+G ++IPD   EKP    G ++ VG G +D  G  +  +V
Sbjct: 5   IKPLEDRVVIKQMEAETVTASG-LVIPDMAKEKPQ--EGTVVAVGPGRVDDKGVRVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTE+K   GEEY+++   D++ +V
Sbjct: 62  KEGDKVIYAKYGGTEVKYQ-GEEYIILSARDLLAVV 96


>gi|254483635|ref|ZP_05096857.1| chaperonin GroS [marine gamma proteobacterium HTCC2148]
 gi|214036097|gb|EEB76782.1| chaperonin GroS [marine gamma proteobacterium HTCC2148]
          Length = 96

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR  +E +T  G IL+P +  EKP+   GEI+ VG G +  SG +    V
Sbjct: 3   IRPLYDRVVVRR-NAEEETTAGGILLPGSAKEKPN--QGEIIAVGEGKVLDSGDIRPLAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+     DGEE ++M ES+I  +V
Sbjct: 60  KVGDTVVFGQYAGSNTIEIDGEELIIMGESEIFAVV 95


>gi|258648822|ref|ZP_05736291.1| chaperonin GroS [Prevotella tannerae ATCC 51259]
 gi|260850962|gb|EEX70831.1| chaperonin GroS [Prevotella tannerae ATCC 51259]
          Length = 90

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++   +E KT  G I+IPDT  EKP    G ++ VG G  D+   V++ E 
Sbjct: 3   IQPLADRVLIKPAAAEEKT-VGGIIIPDTAKEKPL--KGSVIAVGNGTKDEE-MVLKAE- 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D VL+GK+SGTE++L DGE+YL+M++SD++ I+
Sbjct: 58  ---DTVLYGKYSGTEVEL-DGEKYLIMRQSDVLAIL 89


>gi|297571874|ref|YP_003697648.1| chaperonin Cpn10 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932221|gb|ADH93029.1| Chaperonin Cpn10 [Arcanobacterium haemolyticum DSM 20595]
          Length = 98

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V++++++E  TA+G +L+ D+  EKP    GE++ VG G +D +G  I  +V
Sbjct: 5   IKPLDDRIVIKQVEAEETTASGLVLV-DSAKEKPQ--EGEVVAVGPGRVDDNGNRIPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+V++ K+ GTE+K    +EYL++ + D++ +V
Sbjct: 62  QVGDLVIYSKYGGTEVKYG-ADEYLILSQRDVLAVV 96


>gi|317124154|ref|YP_004098266.1| chaperonin Cpn10 [Intrasporangium calvum DSM 43043]
 gi|315588242|gb|ADU47539.1| Chaperonin Cpn10 [Intrasporangium calvum DSM 43043]
          Length = 118

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   R+VV+ L++E  TA+G ++IPDT  EKP    GE++ VG G  ++ G    P +
Sbjct: 25  IKPLEDRIVVKSLEAEQTTASG-LVIPDTAKEKPQ--EGEVLAVGPGRWNEDGDQRVPLD 81

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++ K+ GTE+K   GEEYL++   D++ +V
Sbjct: 82  VKVGDKVIYSKYGGTEVKYG-GEEYLILSARDVLAVV 117


>gi|269925681|ref|YP_003322304.1| chaperonin Cpn10 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789341|gb|ACZ41482.1| chaperonin Cpn10 [Thermobaculum terrenum ATCC BAA-798]
          Length = 102

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 66/106 (62%), Gaps = 4/106 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M       +RP   R+VV+ ++ E  T +G I++PDT  EKP    G ++ VG G + ++
Sbjct: 1   MTQSATKTIRPLGDRIVVKPIEREEVTKSG-IVLPDTAKEKPQM--GVVLAVGPGKILEN 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           G+    +V  G  VLF K++GTE +L DGE+ L+++ESD+MGI+ E
Sbjct: 58  GQRQPMDVQVGQTVLFAKYAGTEFEL-DGEDVLILRESDVMGILGE 102


>gi|89898173|ref|YP_515283.1| co-chaperonin GroES [Chlamydophila felis Fe/C-56]
 gi|123763219|sp|Q255A0|CH10_CHLFF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|89331545|dbj|BAE81138.1| heat shock protein HSP10 subunit [Chlamydophila felis Fe/C-56]
          Length = 102

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+R + E  T+ G I++PDT  +K      E++ +G G  D+ G+++  EV
Sbjct: 10  IKPLGDRILVKR-EEEDTTSHGGIILPDTAKKK--QDRAEVLALGTGKRDKDGQILPFEV 66

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVL  K++G E+ + +GEEY+++QES++M ++
Sbjct: 67  KVGDIVLIDKYAGQELTI-EGEEYVIVQESEVMAVL 101


>gi|293333178|ref|NP_001170055.1| hypothetical protein LOC100383971 [Zea mays]
 gi|224033159|gb|ACN35655.1| unknown [Zea mays]
          Length = 254

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +L+ +T  EKPS   G ++ VG G +D+ G+ +   V
Sbjct: 161 MKPLNDRVLIKVAEAEDKTP-GGLLLTETAKEKPSI--GTVVAVGPGPLDEDGERLALSV 217

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 218 SAGSTVLYSKYAGSEFKGADGTNYIVLRASDLMAVL 253



 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 61/104 (58%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      L+P   RV+V+   SE KT TG IL+P T   +P    GE++ VG G +   
Sbjct: 55  VVAPKYTTLKPLADRVLVKINSSEEKT-TGGILLPTTAQSRPQG--GEVVAVGEGRIIGD 111

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KV +  +  G  V++ K++GTE+ LND   +LV++E D++GI+
Sbjct: 112 KKV-DVSIQVGAQVVYSKYAGTEVALND-HSHLVLKEDDVIGIL 153


>gi|229818387|ref|ZP_04448668.1| hypothetical protein BIFANG_03689 [Bifidobacterium angulatum DSM
           20098]
 gi|229784257|gb|EEP20371.1| hypothetical protein BIFANG_03689 [Bifidobacterium angulatum DSM
           20098]
          Length = 97

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ ++E +TA+G + IPD   EKP    GE++ VG G  + +G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAEAETQTASG-LFIPDNAKEKPQ--QGEVLAVGPGRRNDAGERIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   DI+ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHY-EGEDYLIVAARDILAIL 96


>gi|77359227|ref|YP_338802.1| chaperonin [Pseudoalteromonas haloplanktis TAC125]
 gi|23813808|sp|Q9AKT2|CH10_PSEHT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|12697198|emb|CAC28359.1| groES protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76874138|emb|CAI85359.1| 10 kDa chaperonin (Protein Cpn10) (groES protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 95

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+RL+ E K+A G I++  + +EK  ++ GE++ VG G + +SG V   EV
Sbjct: 3   IRPLHDRVIVKRLEEETKSA-GGIVLTGSAAEK--STRGEVVAVGNGRILESGDVRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG +   +++  +G+EYL+M+E +I+GIV
Sbjct: 60  KAGDTVLFGSYV-EKVEKIEGQEYLIMREDNILGIV 94


>gi|242066742|ref|XP_002454660.1| hypothetical protein SORBIDRAFT_04g035040 [Sorghum bicolor]
 gi|241934491|gb|EES07636.1| hypothetical protein SORBIDRAFT_04g035040 [Sorghum bicolor]
          Length = 254

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E+KT  G +L+ +T  EKPS   G ++ VG G +D+ GK     V
Sbjct: 161 MKPLNDRVLIKVAEAEVKTP-GGLLLTETSKEKPSI--GTVVAVGPGPLDEEGKRSPLSV 217

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 218 SAGSTVLYSKYAGSEFKGADGTNYIVLRVSDLMAVL 253



 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      L+P   RV+V+   SE KT TG IL+P T   KP    GE++ VG G +   
Sbjct: 55  VVAPKYTTLKPLADRVLVKINSSEEKT-TGGILLPTTAQSKPQG--GEVVAVGEGRIIGD 111

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KV +  +  G  V++ K++GTE++LND   +LV++E DI+GI+
Sbjct: 112 KKV-DVSIQVGAQVVYSKYAGTEVELND-YNHLVLKEDDIIGIL 153


>gi|50660329|gb|AAT80889.1| chloroplast chaperonin 21 [Vitis vinifera]
          Length = 125

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KTA G +L+ +   EKPS   G ++ VG G +D+ GK     V
Sbjct: 32  LKPLNDRVLIKVAEAEEKTA-GGLLLTEASKEKPSI--GTVVAVGPGPLDEDGKRKPLSV 88

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G+ VL+ K++G + K +DG +Y+ ++ SDIM ++
Sbjct: 89  SPGNTVLYSKYAGNDFKGSDGSDYIALKASDIMAVL 124


>gi|28572252|ref|NP_789032.1| co-chaperonin GroES [Tropheryma whipplei TW08/27]
 gi|28410383|emb|CAD66769.1| 10 kDa chaperonin [Tropheryma whipplei TW08/27]
          Length = 127

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+R   +E  TA+G ++IPDT  E+P    GE++ VG G ++  G  +  +V
Sbjct: 34  IKPLGDRVVIRPADAEQVTASG-LVIPDTAQERPQ--EGEVVAVGPGSLNDDGNRVPLDV 90

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD V++ ++ GTE+KL D +EY ++   D++ +V
Sbjct: 91  SVGDRVIYARYGGTEVKLGD-DEYTILASRDVLAVV 125


>gi|227832302|ref|YP_002834009.1| molecular chaperone protein [Corynebacterium aurimucosum ATCC
           700975]
 gi|227453318|gb|ACP32071.1| molecular chaperone protein [Corynebacterium aurimucosum ATCC
           700975]
          Length = 97

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +V+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  +  G+V+   V
Sbjct: 4   IKPLEDKVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VVAVGPGRTNDKGEVVPVGV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F K+ GTE+K  DG+EYL++   D++ ++
Sbjct: 61  NEGDTVIFSKYGGTELKY-DGQEYLLLSARDLLAVI 95


>gi|153810950|ref|ZP_01963618.1| hypothetical protein RUMOBE_01340 [Ruminococcus obeum ATCC 29174]
 gi|149832838|gb|EDM87921.1| hypothetical protein RUMOBE_01340 [Ruminococcus obeum ATCC 29174]
          Length = 94

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 69/97 (71%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           L P   RVV+++L++E  T +G I++P    EKP  +  E++ VG  GV+D  GK ++ E
Sbjct: 3   LVPLGDRVVLKQLEAEETTKSG-IVLPGQAQEKPQQA--EVIAVGPGGVVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ G+ V++ K++GTE+KL DGEEY+++++SDI+ IV
Sbjct: 58  VATGNKVIYSKYAGTEVKL-DGEEYIIVKQSDILAIV 93


>gi|116511249|ref|YP_808465.1| co-chaperonin GroES [Lactococcus lactis subsp. cremoris SK11]
 gi|123125812|sp|Q031S9|CH10_LACLS RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|116106903|gb|ABJ72043.1| Co-chaperonin GroES (HSP10) [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 94

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+R  + E K + G I++     EKP   + E++ VG G     G +I P V
Sbjct: 2   LKPLENRVVLRVKEEEEK-SMGGIVLTSASQEKPQ--TAEVIAVGEGKTTNHGTLISPLV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K+SGT +K+ DGEE+L++++SD++ IV
Sbjct: 59  KVGDTVIFEKFSGTTVKM-DGEEFLILKDSDLLAIV 93


>gi|317508306|ref|ZP_07965986.1| chaperonin 10 kDa subunit protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253481|gb|EFV12871.1| chaperonin 10 kDa subunit protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 99

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V   ++E  TA+G ++IPDT  EKP    G ++ VG G + + G  I  +V
Sbjct: 6   IKPLEDKILVEANEAETTTASG-LVIPDTAKEKPQ--EGTVIAVGEGRVTEKGNRIPLDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++ K+ GTEIK N G+EYL++   DI+ ++
Sbjct: 63  KAGDTVIYSKYGGTEIKYN-GKEYLILSARDILAVI 97


>gi|302774314|ref|XP_002970574.1| hypothetical protein SELMODRAFT_147159 [Selaginella moellendorffii]
 gi|300162090|gb|EFJ28704.1| hypothetical protein SELMODRAFT_147159 [Selaginella moellendorffii]
          Length = 270

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KTA G +L+ D+V EKP    GE++ VG G   + G     EV
Sbjct: 177 LKPVNDRVLIKVAEAEDKTA-GGVLLTDSVKEKPVI--GEVVAVGPGSYGEDGTRKPLEV 233

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++G E K  D  +Y+VM+ SD++ I+
Sbjct: 234 SIGDNVLYSKYAGNEFKNKDNSQYVVMRVSDLLAIL 269



 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 61/99 (61%), Gaps = 5/99 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   SE K+  G I++P T   KP   SGE++ VG G      K +   V
Sbjct: 79  LKPLGDRVLVKIQASEEKS-DGGIILPTTTQTKP--QSGEVVEVGEG-KKIGEKSVPSCV 134

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
           + G+ +++ K++GTEI+ N G ++++++E D++G++  E
Sbjct: 135 TVGNTIVYSKYAGTEIQFN-GADHILLKEDDVIGLLSTE 172


>gi|254786971|ref|YP_003074400.1| chaperonin GroS [Teredinibacter turnerae T7901]
 gi|259585893|sp|C5BP09|CH10_TERTT RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|237685857|gb|ACR13121.1| chaperonin GroS [Teredinibacter turnerae T7901]
          Length = 96

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E K+A G I++P +  EKP+   GE++ VG+G +  +G+    +V
Sbjct: 3   IRPLHDRVVVRRKEEEEKSA-GGIVLPGSAKEKPN--QGEVVAVGSGRVLDNGETRPVDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK++G++    +GEE +++ ESDI  I+
Sbjct: 60  KVGDTVVFGKYAGSDTIEINGEELVILSESDIKAII 95


>gi|152993542|ref|YP_001359263.1| co-chaperonin GroES [Sulfurovum sp. NBC37-1]
 gi|166198418|sp|A6QBP7|CH10_SULNB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|151425403|dbj|BAF72906.1| co-chaperonin GroES [Sulfurovum sp. NBC37-1]
          Length = 86

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (63%), Gaps = 13/97 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R++++R++    TA+G I+IPD   EKPS   G+++ VG+ V D         +
Sbjct: 3   FKPLGDRLLIQRVEEANTTASG-IIIPDNAKEKPS--KGKVIAVGSEVED---------I 50

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           +  D V+FGK+SG EI L DGEE+L+M+ SDI GI++
Sbjct: 51  NVDDTVVFGKYSGNEIIL-DGEEFLIMESSDIFGILI 86


>gi|302769988|ref|XP_002968413.1| hypothetical protein SELMODRAFT_270691 [Selaginella moellendorffii]
 gi|300164057|gb|EFJ30667.1| hypothetical protein SELMODRAFT_270691 [Selaginella moellendorffii]
          Length = 270

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KTA G +L+ D+V EKP    GE++ VG G   + G     EV
Sbjct: 177 LKPVNDRVLIKVAEAEDKTA-GGVLLTDSVKEKPVI--GEVVAVGPGSYGEDGTRKPLEV 233

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD VL+ K++G E K  D  +Y+VM+ SD++ I+
Sbjct: 234 SIGDNVLYSKYAGNEFKNKDNSQYVVMRVSDLLAIL 269



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 62/99 (62%), Gaps = 5/99 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   SE K+  G I++P T   KP   SGE++ VG G      K + P V
Sbjct: 79  LKPLGDRVLVKIQASEEKS-DGGIILPTTSQTKP--QSGEVVEVGEG-KKMGEKSVPPCV 134

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE 107
           + G+ +++ K++GTEI+ N G ++++++E D++G++  E
Sbjct: 135 TVGNTIVYSKYAGTEIQFN-GADHILLKEDDVIGLLSTE 172


>gi|297180427|gb|ADI16643.1| co-chaperonin groes (hsp10) [uncultured delta proteobacterium
           HF0010_01J10]
          Length = 133

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   R+V+ R+ SE ++  G + +PD+  EK +   G ++ VG G +++ G +    V
Sbjct: 41  LRPMFDRIVIERVSSETRS-RGGLFLPDSAQEKQNI--GVVIAVGQGRLNEDGSLSPLAV 97

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++G  V+FGK++G EI++  GEE +V++ESDI+GI+
Sbjct: 98  AEGQKVMFGKYAGNEIEIG-GEERIVLRESDILGIL 132


>gi|46446813|ref|YP_008178.1| co-chaperonin GroES [Candidatus Protochlamydia amoebophila UWE25]
 gi|46400454|emb|CAF23903.1| probable chlamydial heat shock protein groES [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 106

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+VRRL +E K   G I++PDT  +K      E++ +G G  D++G ++   V
Sbjct: 13  LKPLGNRVLVRRLAAEEKLK-GGIILPDTAKKK--QEQAEVIAIGTGKKDKNGTLVPMPV 69

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD++L  K+SG EI LND EE ++++  DI+ IV
Sbjct: 70  KIGDVILMEKYSGQEITLND-EELVILRADDIIAIV 104


>gi|225444649|ref|XP_002276749.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|50660327|gb|AAT80888.1| chloroplast chaperonin 21 [Vitis vinifera]
 gi|297738526|emb|CBI27771.3| unnamed protein product [Vitis vinifera]
          Length = 251

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KTA G +L+ +   EKPS   G ++ VG G +D+ GK     V
Sbjct: 158 LKPLNDRVLIKVAEAEEKTA-GGLLLTEASKEKPSI--GTVVAVGPGPLDEDGKRKPLSV 214

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G+ VL+ K++G + K +DG +Y+ ++ SDIM ++
Sbjct: 215 SPGNTVLYSKYAGNDFKGSDGSDYIALKASDIMAVL 250



 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 57/96 (59%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G IL+P T   KP    GE++ VG G      K ++  V
Sbjct: 60  LKPLGDRVLVKIKTAEEKTV-GGILLPTTAQTKPQG--GEVVAVGEGKTIGKNK-LDICV 115

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ N G  +L+++E DI+GI+
Sbjct: 116 KTGAQVVYSKYAGTEVEFN-GSNHLILKEDDIVGIL 150


>gi|29839310|sp|Q8CY28|CH10_COREF RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
          Length = 99

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+  ++E  TA+G ++IPD+  EKP  ++  ++ VG G  D+ G+ I  ++
Sbjct: 6   IKPLEDKILVQINEAETTTASG-LVIPDSAKEKPQEAT--VIAVGPGRFDEKGERIPLDI 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            + D+V+F ++ GTEIK  DG EYL++   DI+ IV
Sbjct: 63  KEDDVVIFSRYGGTEIKF-DGVEYLLLSARDILAIV 97


>gi|294790469|ref|ZP_06755627.1| chaperonin GroS [Scardovia inopinata F0304]
 gi|294458366|gb|EFG26719.1| chaperonin GroS [Scardovia inopinata F0304]
          Length = 97

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   ++++++  +E  TA+G ++IPDT  EKP    GE++ VG G  D  G+ +  +V
Sbjct: 5   LKPLEDKIIIKQAPAETTTASG-LVIPDTAKEKPQ--QGEVLAVGPGRRDDKGERVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+ K+ GTE+    GE+YL++   DI+  +
Sbjct: 62  KEGDRVLYSKYGGTEVTYK-GEDYLIVSARDILATL 96


>gi|119025310|ref|YP_909155.1| co-chaperonin GroES [Bifidobacterium adolescentis ATCC 15703]
 gi|166233984|sp|A1A040|CH10_BIFAA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118764894|dbj|BAF39073.1| groES protein [Bifidobacterium adolescentis ATCC 15703]
          Length = 97

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ ++E +TA+G + IPD   EKP    GE++ VG G  + +G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAEAETQTASG-LFIPDNAKEKPQ--QGEVLAVGPGRRNDAGERIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+    GE+YL++   DI+ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHYQ-GEDYLIVSARDILAIL 96


>gi|262201666|ref|YP_003272874.1| chaperonin Cpn10 [Gordonia bronchialis DSM 43247]
 gi|262085013|gb|ACY20981.1| chaperonin Cpn10 [Gordonia bronchialis DSM 43247]
          Length = 99

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+ +++E  TA+G ++IPDT  EKP    G ++ VG G + + G  +  +V
Sbjct: 6   IKPLEDKILVQAVEAETTTASG-LVIPDTAKEKPQ--EGTVIAVGEGRVTEQGNRVPVDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTEIK   GEEYL++   D++ ++
Sbjct: 63  KEGDTVIYSKYGGTEIKYA-GEEYLILSARDVLAVI 97


>gi|15607129|ref|NP_214511.1| hypothetical protein aq_2199 [Aquifex aeolicus VF5]
 gi|23813772|sp|O67942|CH10_AQUAE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|2984380|gb|AAC07898.1| GroES [Aquifex aeolicus VF5]
          Length = 122

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   ++VV RL+ + +     I+IPDT  EKP    G+++ VG G +  +G++    V
Sbjct: 3   LRPLYDKIVVERLEEKEEKTPSGIIIPDTAKEKPQL--GKVVAVGPGKLLDNGELKPLSV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+VLF K++G E+++ +G+ YLVM E +++ +V
Sbjct: 61  KEGDVVLFNKYAGNEVEI-EGKIYLVMSEDEVLAVV 95


>gi|283455342|ref|YP_003359906.1| Hsp10 10 kDa chaperonin GROES [Bifidobacterium dentium Bd1]
 gi|306823591|ref|ZP_07456966.1| chaperone GroES [Bifidobacterium dentium ATCC 27679]
 gi|309802867|ref|ZP_07696968.1| chaperonin GroS [Bifidobacterium dentium JCVIHMP022]
 gi|283101976|gb|ADB09082.1| Hsp10 10 kDa chaperonin GROES [Bifidobacterium dentium Bd1]
 gi|304553298|gb|EFM41210.1| chaperone GroES [Bifidobacterium dentium ATCC 27679]
 gi|308220334|gb|EFO76645.1| chaperonin GroS [Bifidobacterium dentium JCVIHMP022]
          Length = 97

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ ++E +TA+G + IPD   EKP    GE++ VG G  + +G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAEAETQTASG-LFIPDNAKEKPQ--QGEVLAVGPGRRNDAGERIPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+    GE+YL++   DI+ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHYQ-GEDYLIVAARDILAIL 96


>gi|224283688|ref|ZP_03647010.1| co-chaperonin GroES [Bifidobacterium bifidum NCIMB 41171]
 gi|310288045|ref|YP_003939304.1| 10 kDa chaperonin GROES [Bifidobacterium bifidum S17]
 gi|311064920|ref|YP_003971646.1| 10 kDa chaperonin GROES Hsp10 [Bifidobacterium bifidum PRL2010]
 gi|313140844|ref|ZP_07803037.1| chaperonin [Bifidobacterium bifidum NCIMB 41171]
 gi|309251982|gb|ADO53730.1| 10 kDa chaperonin GROES [Bifidobacterium bifidum S17]
 gi|310867240|gb|ADP36609.1| Hsp10 10 kDa chaperonin GROES [Bifidobacterium bifidum PRL2010]
 gi|313133354|gb|EFR50971.1| chaperonin [Bifidobacterium bifidum NCIMB 41171]
          Length = 97

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++  +E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAAAETQTASG-LFIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   D++ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHY-EGEDYLIVSSRDVLAIL 96


>gi|32475648|ref|NP_868642.1| 10 kDa chaperonin [Rhodopirellula baltica SH 1]
 gi|77416389|sp|Q7UM98|CH101_RHOBA RecName: Full=10 kDa chaperonin 1; AltName: Full=GroES protein 1;
           AltName: Full=Protein Cpn10 1
 gi|32446190|emb|CAD76019.1| 10 kDa chaperonin [Rhodopirellula baltica SH 1]
 gi|327537243|gb|EGF23985.1| 10 kDa chaperonin [Rhodopirellula baltica WH47]
          Length = 101

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 63/101 (62%), Gaps = 4/101 (3%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           M    K  LRP   RVVV+  ++E +T  G I++PD+  EKP    G ++ VG G +  S
Sbjct: 1   MATAKKINLRPLDDRVVVQPSEAE-ETTAGGIVLPDSAKEKPQ--RGTVVAVGPGKLLDS 57

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIM 101
           G   E  VS GD+V++GK+ G+EI++ DG E  +++ESDI+
Sbjct: 58  GNRGELSVSVGDVVIYGKYGGSEIEV-DGHEMKILRESDIL 97


>gi|149277190|ref|ZP_01883332.1| 10 kDa chaperonin [Pedobacter sp. BAL39]
 gi|149232067|gb|EDM37444.1| 10 kDa chaperonin [Pedobacter sp. BAL39]
          Length = 96

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 11/100 (11%)

Query: 9   LRPTRG---RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           ++P  G   RV+V    +E KTA+G I IPDT  EKPS   G ++ V     D  GK  +
Sbjct: 5   IKPIAGSLNRVIVEPAAAEEKTASG-IYIPDTAKEKPS--KGTVVSVSE--EDSEGK--K 57

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           P V  GD+VL+GK+ GTE+ + DG++YL+M+E+DI  +V+
Sbjct: 58  PAVKVGDVVLYGKYGGTELPI-DGKDYLIMRENDIYAVVL 96


>gi|62185226|ref|YP_220011.1| co-chaperonin GroES [Chlamydophila abortus S26/3]
 gi|34391391|gb|AAL14264.1| GroES [Chlamydophila abortus]
 gi|62148293|emb|CAH64060.1| putative chaperonin [Chlamydophila abortus S26/3]
          Length = 102

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+R + E  T  G I++PDT  +K      E++ +G G  D+ G+V+  EV
Sbjct: 10  IKPLGDRILVKR-EEEDSTPRGGIILPDTAKKK--QDRAEVLALGTGKRDKDGQVLPFEV 66

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL  K++G E+ + DGEEY+++QES++M ++
Sbjct: 67  KVGDTVLIDKYAGQELTI-DGEEYVIVQESEVMAVL 101


>gi|332883655|gb|EGK03935.1| chaperonin [Dysgonomonas mossii DSM 22836]
          Length = 89

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E K+  G I+IPDT  EKP    GE++ VG G  D+   +++P+ 
Sbjct: 3   IKPLADRVLVKPAAAEEKS-VGGIIIPDTAKEKPL--KGEVIAVGNGTKDED-MIVKPK- 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D VL+GK++GTE++L DGE +L+M++SDI+ I+
Sbjct: 58  ---DQVLYGKYAGTEVEL-DGEVFLIMRQSDILAII 89


>gi|315226076|ref|ZP_07867864.1| chaperone GroES [Parascardovia denticolens DSM 10105]
 gi|315120208|gb|EFT83340.1| chaperone GroES [Parascardovia denticolens DSM 10105]
          Length = 132

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   ++++++  +E  TA+G ++IPD+  EKP    GE++ VG G  D  G+ +  +V
Sbjct: 40  LKPLEDKIIIKQAPAETTTASG-LVIPDSAKEKPQ--QGEVLAVGPGRRDDKGERVPMDV 96

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+ K+ GTE+    GE+YL++   DI+ ++
Sbjct: 97  KEGDRVLYSKYGGTEVTYK-GEDYLIVSARDILAVL 131


>gi|294786503|ref|ZP_06751757.1| chaperonin GroS [Parascardovia denticolens F0305]
 gi|294485336|gb|EFG32970.1| chaperonin GroS [Parascardovia denticolens F0305]
          Length = 97

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   ++++++  +E  TA+G ++IPD+  EKP    GE++ VG G  D  G+ +  +V
Sbjct: 5   LKPLEDKIIIKQAPAETTTASG-LVIPDSAKEKPQ--QGEVLAVGPGRRDDKGERVPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+ K+ GTE+    GE+YL++   DI+ ++
Sbjct: 62  KEGDRVLYSKYGGTEVTYK-GEDYLIVSARDILAVL 96


>gi|329942989|ref|ZP_08291763.1| 10 kDa chaperonin [Chlamydophila psittaci Cal10]
 gi|332287571|ref|YP_004422472.1| co-chaperonin GroES [Chlamydophila psittaci 6BC]
 gi|313848145|emb|CBY17146.1| putative chaperonin [Chlamydophila psittaci RD1]
 gi|325506581|gb|ADZ18219.1| co-chaperonin GroES [Chlamydophila psittaci 6BC]
 gi|328814536|gb|EGF84526.1| 10 kDa chaperonin [Chlamydophila psittaci Cal10]
 gi|328914821|gb|AEB55654.1| chaperonin, 10 kDa [Chlamydophila psittaci 6BC]
          Length = 102

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V+R + E  T+ G I++PDT  +K   +  +++ +G G  D+ G+V+  EV
Sbjct: 10  IKPLGDRILVKR-EEEDSTSRGGIILPDTAKKKQDRA--QVLALGTGKRDKDGQVLPFEV 66

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL  K++G E+ + DGEEY+++QES++M ++
Sbjct: 67  KVGDTVLIDKYAGQELTM-DGEEYVIVQESEVMAVL 101


>gi|25027157|ref|NP_737211.1| co-chaperonin GroES [Corynebacterium efficiens YS-314]
 gi|259506708|ref|ZP_05749610.1| chaperonin GroES [Corynebacterium efficiens YS-314]
 gi|23492438|dbj|BAC17411.1| putative chaperonin GroES [Corynebacterium efficiens YS-314]
 gi|259165691|gb|EEW50245.1| chaperonin GroES [Corynebacterium efficiens YS-314]
          Length = 104

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+  ++E  TA+G ++IPD+  EKP  ++  ++ VG G  D+ G+ I  ++
Sbjct: 11  IKPLEDKILVQINEAETTTASG-LVIPDSAKEKPQEAT--VIAVGPGRFDEKGERIPLDI 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            + D+V+F ++ GTEIK  DG EYL++   DI+ IV
Sbjct: 68  KEDDVVIFSRYGGTEIKF-DGVEYLLLSARDILAIV 102


>gi|317121127|ref|YP_004101130.1| chaperonin Cpn10 [Thermaerobacter marianensis DSM 12885]
 gi|315591107|gb|ADU50403.1| Chaperonin Cpn10 [Thermaerobacter marianensis DSM 12885]
          Length = 108

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVVV+ ++ E +T  G I++PDT  EKP    GE++ VG G + ++G+ +  EV
Sbjct: 16  LRPLGDRVVVKVIEEEERTK-GGIILPDTAKEKPQ--QGEVLAVGTGRILENGQKVPLEV 72

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K++GTE+KL+D EE L++ E DI+ ++
Sbjct: 73  KEGDRVIFSKYAGTEVKLDD-EELLILSERDILAVI 107


>gi|260905417|ref|ZP_05913739.1| co-chaperonin GroES [Brevibacterium linens BL2]
          Length = 97

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+V+R++++E  TA+G ++IP+T  EKP    GE++ VG G +  +G  +  +V
Sbjct: 5   IKPLEDRIVIRQVEAEQTTASG-LVIPETAKEKPQ--EGEVVAVGPGRVADNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V++ K+ GTE+K   GEE+LV+   D++ ++
Sbjct: 62  AIGDKVIYSKFGGTEVKYA-GEEFLVLSARDVLAVI 96


>gi|315924349|ref|ZP_07920571.1| chaperone GroES [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622228|gb|EFV02187.1| chaperone GroES [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 94

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 69/97 (71%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           LRP   ++VV+  + E KT++G I++PD+  EKP    GE++ VG+G V+D  GK +  +
Sbjct: 3   LRPLGDKLVVKVKEEEAKTSSG-IVLPDSAQEKPQ--QGEVIAVGSGEVID--GKKVPLD 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++ K+SG E+K+ +GE++L++++SD++ IV
Sbjct: 58  VRVGDQVIYSKYSGNEVKV-EGEQFLIIKQSDVLAIV 93


>gi|325281006|ref|YP_004253548.1| 10 kDa chaperonin [Odoribacter splanchnicus DSM 20712]
 gi|324312815|gb|ADY33368.1| 10 kDa chaperonin [Odoribacter splanchnicus DSM 20712]
          Length = 89

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (61%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           L+    +V+V  +++E  T  G I+IPDT  EKP    G ++  G G  D      EP E
Sbjct: 3   LKTVLNKVIVEPVEAETVTK-GGIIIPDTAQEKPQ--KGTVIATGKGKAD------EPME 53

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLFGK+SGTE+ ++D ++YLVM +SDI+ I+
Sbjct: 54  VKAGDTVLFGKYSGTEVHIDD-KKYLVMNQSDILAIL 89


>gi|111023152|ref|YP_706124.1| 10 kDa chaperonin [Rhodococcus jostii RHA1]
 gi|226305412|ref|YP_002765370.1| 10 kDa chaperonin [Rhodococcus erythropolis PR4]
 gi|226365658|ref|YP_002783441.1| co-chaperonin GroES [Rhodococcus opacus B4]
 gi|229489406|ref|ZP_04383269.1| chaperonin GroS [Rhodococcus erythropolis SK121]
 gi|123144238|sp|Q0S3C0|CH10_RHOSR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813852|sp|C1B075|CH10_RHOOB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|259585890|sp|C0ZW96|CH10_RHOE4 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|110822682|gb|ABG97966.1| 10 kDa chaperonin [Rhodococcus jostii RHA1]
 gi|226184527|dbj|BAH32631.1| 10 kDa chaperonin [Rhodococcus erythropolis PR4]
 gi|226244148|dbj|BAH54496.1| 10 kDa chaperonin [Rhodococcus opacus B4]
 gi|229323503|gb|EEN89261.1| chaperonin GroS [Rhodococcus erythropolis SK121]
          Length = 99

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G +++ G  I  +V
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGEGRVNEQGNRIPVDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+ GTEIK   G+EYL++   D++ +V
Sbjct: 63  KEGDTVIYSKYGGTEIKYA-GQEYLILSARDVLAVV 97


>gi|255022805|ref|ZP_05294791.1| co-chaperonin GroES [Listeria monocytogenes FSL J1-208]
          Length = 86

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 8/91 (8%)

Query: 9  LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEP- 66
          L+P   RVV+  L++E KTA+G I++PD+  EKP   SG+I+ VG+G V+D   K  EP 
Sbjct: 2  LKPLGDRVVIEVLEAEEKTASG-IVLPDSAKEKPQ--SGKIVAVGSGRVLDNGTK--EPL 56

Query: 67 EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQE 97
          EV++GD V+F K+SGTE+   +G +YL+++E
Sbjct: 57 EVAEGDTVIFAKYSGTEVTY-EGTDYLILRE 86


>gi|159030774|emb|CAO88452.1| groS [Microcystis aeruginosa PCC 7806]
          Length = 103

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE +TA G I +PD   EKP    GE++ VG G  +  G     EV
Sbjct: 11  VKPLGDRVFVKVSPSEERTA-GGIFLPDAAQEKPQI--GEVVTVGTGKRNDDGSRTPVEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  GEEY+++ E DI+ +V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-GEEYVLLSEKDILAVV 102


>gi|238855596|ref|ZP_04645897.1| chaperonin GroS [Lactobacillus jensenii 269-3]
 gi|260665344|ref|ZP_05866192.1| chaperonin GroS [Lactobacillus jensenii SJ-7A-US]
 gi|282932710|ref|ZP_06338120.1| chaperonin GroS [Lactobacillus jensenii 208-1]
 gi|238831740|gb|EEQ24076.1| chaperonin GroS [Lactobacillus jensenii 269-3]
 gi|260560848|gb|EEX26824.1| chaperonin GroS [Lactobacillus jensenii SJ-7A-US]
 gi|281303158|gb|EFA95350.1| chaperonin GroS [Lactobacillus jensenii 208-1]
          Length = 94

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+  + E +T  G I++     +KP+   GE++ VG G++   GKV+   V
Sbjct: 2   LQPIGDRVIVKVKKEEEETV-GGIVLASNAKQKPT--EGEVVAVGNGLVTSEGKVLPMTV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V++ K+SGT +K  DGEEYLV+ E DI+ IV
Sbjct: 59  KEGDRVVYDKYSGTNVKY-DGEEYLVLHEKDILAIV 93


>gi|332706272|ref|ZP_08426340.1| Co-chaperonin GroES/HSP10 [Lyngbya majuscula 3L]
 gi|332354977|gb|EGJ34449.1| Co-chaperonin GroES/HSP10 [Lyngbya majuscula 3L]
          Length = 103

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   +E KTA G IL+PD   EKP    GEI+  G G  +  G     EV
Sbjct: 11  VKPLGDRVFVKVSAAEEKTA-GGILLPDNAKEKPQV--GEIVATGPGKRNDDGSHAALEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL + EEY+++ E DI+ +V
Sbjct: 68  KVGDKVLYSKYAGTDIKLGN-EEYVLLSEKDILAVV 102


>gi|254413058|ref|ZP_05026830.1| chaperonin GroS [Microcoleus chthonoplastes PCC 7420]
 gi|196180222|gb|EDX75214.1| chaperonin GroS [Microcoleus chthonoplastes PCC 7420]
          Length = 103

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV ++   +E KTA G IL+PD   EKP    GEI+  G G  +  G   E EV
Sbjct: 11  VKPLGDRVFLKVSAAEEKTA-GGILLPDNAKEKPQV--GEIVATGPGKRNDDGSRSELEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL + EEY+++ E DI+ +V
Sbjct: 68  KIGDKVLYSKYAGTDIKLGN-EEYVLLSEKDILAVV 102


>gi|326381878|ref|ZP_08203571.1| co-chaperonin GroES [Gordonia neofelifaecis NRRL B-59395]
 gi|326199304|gb|EGD56485.1| co-chaperonin GroES [Gordonia neofelifaecis NRRL B-59395]
          Length = 98

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +++V+ +++E  TA+G ++IPD+  EKP    G+++ VG G +   G  I  +V
Sbjct: 6   IKPLEDKILVQAVEAETTTASG-LVIPDSAKEKPQ--EGKVIAVGEGRVTDQGTRIPVDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+V++ K+ GTEIK   G+EYL++   DI+ +V
Sbjct: 63  KEGDVVVYSKYGGTEIKYA-GQEYLILSARDILAVV 97


>gi|326203388|ref|ZP_08193253.1| Chaperonin Cpn10 [Clostridium papyrosolvens DSM 2782]
 gi|325986646|gb|EGD47477.1| Chaperonin Cpn10 [Clostridium papyrosolvens DSM 2782]
          Length = 94

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           ++P   RVV++ L+SE  T +G I++P +  EKP  +  E++ VG G V+D  GK I+ E
Sbjct: 3   IKPLGDRVVIKMLESEETTKSG-IVLPGSAKEKPQVA--EVVAVGPGTVVD--GKEIKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL  K+SGTE+K  DG+EY ++++SDI+ IV
Sbjct: 58  VKVGDRVLTSKYSGTEVKF-DGQEYTILKQSDILAIV 93


>gi|126697766|ref|YP_001086663.1| 10 kDa chaperonin [Clostridium difficile 630]
 gi|254973853|ref|ZP_05270325.1| 10 kDa chaperonin [Clostridium difficile QCD-66c26]
 gi|255091238|ref|ZP_05320716.1| 10 kDa chaperonin [Clostridium difficile CIP 107932]
 gi|255099356|ref|ZP_05328333.1| 10 kDa chaperonin [Clostridium difficile QCD-63q42]
 gi|255305189|ref|ZP_05349361.1| 10 kDa chaperonin [Clostridium difficile ATCC 43255]
 gi|255312897|ref|ZP_05354480.1| 10 kDa chaperonin [Clostridium difficile QCD-76w55]
 gi|255515656|ref|ZP_05383332.1| 10 kDa chaperonin [Clostridium difficile QCD-97b34]
 gi|255648750|ref|ZP_05395652.1| 10 kDa chaperonin [Clostridium difficile QCD-37x79]
 gi|255654275|ref|ZP_05399684.1| 10 kDa chaperonin [Clostridium difficile QCD-23m63]
 gi|260681972|ref|YP_003213257.1| 10 kDa chaperonin [Clostridium difficile CD196]
 gi|260685570|ref|YP_003216703.1| 10 kDa chaperonin [Clostridium difficile R20291]
 gi|296452565|ref|ZP_06894260.1| chaperone GroES [Clostridium difficile NAP08]
 gi|296881023|ref|ZP_06904968.1| chaperone GroES [Clostridium difficile NAP07]
 gi|306518867|ref|ZP_07405214.1| 10 kDa chaperonin [Clostridium difficile QCD-32g58]
 gi|123067181|sp|Q18CT6|CH10_CLOD6 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|115249203|emb|CAJ67015.1| 10 kDa chaperonin (Protein Cpn10) (GroES protein) [Clostridium
           difficile]
 gi|260208135|emb|CBA60422.1| 10 kDa chaperonin [Clostridium difficile CD196]
 gi|260211586|emb|CBE01795.1| 10 kDa chaperonin [Clostridium difficile R20291]
 gi|296258588|gb|EFH05488.1| chaperone GroES [Clostridium difficile NAP08]
 gi|296427982|gb|EFH13884.1| chaperone GroES [Clostridium difficile NAP07]
          Length = 94

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 70/96 (72%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV++++++E KTA+G I++P    E+P  +  E++ VG G + + GK I+ E+
Sbjct: 3   IRPLADRVVIKKVEAEEKTASG-IVLPGAAKEQPQIA--EVVEVGPGGIVE-GKEIKMEL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V+F K+SGTE+K+ +G+EY ++++SD++ ++
Sbjct: 59  TVGDKVIFQKYSGTEVKI-EGQEYTILRQSDVLAVI 93


>gi|225155844|ref|ZP_03724330.1| chaperonin Cpn10 [Opitutaceae bacterium TAV2]
 gi|224803394|gb|EEG21631.1| chaperonin Cpn10 [Opitutaceae bacterium TAV2]
          Length = 98

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ ++ E +   G I+IPD+  EKP  +  E++ +G G  D++GK +  EV
Sbjct: 6   IKPIGDRVLVKHIE-EKEQVRGGIIIPDSAKEKPQEA--EVIAIGTGKKDENGKAVAFEV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL  K+ GTE+K+ + E++ +++E DI+G++
Sbjct: 63  KVGDKVLISKYGGTEVKIEN-EKFTIVREDDILGVI 97


>gi|313674974|ref|YP_004052970.1| chaperonin cpn10 [Marivirga tractuosa DSM 4126]
 gi|312941672|gb|ADR20862.1| Chaperonin Cpn10 [Marivirga tractuosa DSM 4126]
          Length = 92

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 57/96 (59%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V     E KTA+G I+IPDT  EKP    G+++ VG G  D    V     
Sbjct: 6   FKPNEDRVLVEPAPVEEKTASG-IIIPDTAKEKPQ--QGKVVAVGPGKDDAPVTV----- 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE  L +G+EYL+M+ SDI G +
Sbjct: 58  KVGDSVLYGKYSGTEFTL-EGKEYLIMRNSDIFGTI 92


>gi|301300461|ref|ZP_07206661.1| chaperonin GroS [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851958|gb|EFK79642.1| chaperonin GroS [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 94

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV++ +Q E + + G I+I     EKP+  +GE++ VG G +  +G+ +EPEV
Sbjct: 2   LKPLGDRVVLK-VQKEEEQSIGGIVIASNAKEKPT--TGEVIAVGNGRILDNGQRVEPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V+F K++G+E+K  + EEYLV++E+DI+ ++
Sbjct: 59  KVGQSVVFDKYAGSEVKY-ESEEYLVIRENDIIAVI 93


>gi|210620563|ref|ZP_03292111.1| hypothetical protein CLOHIR_00054 [Clostridium hiranonis DSM 13275]
 gi|210155277|gb|EEA86283.1| hypothetical protein CLOHIR_00054 [Clostridium hiranonis DSM 13275]
          Length = 94

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 69/97 (71%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           +RP   RVV++R + E KTA+G I++     E+P  +  E++ VG  G++D  GK I+ E
Sbjct: 3   IRPLADRVVIKRAEVEEKTASG-IILAGAAKEQPQIA--EVIEVGPGGIVD--GKEIKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + KGD V++ K++GTE+K+ +GEEY++++E+DI+ ++
Sbjct: 58  LKKGDKVIYSKYAGTEVKV-EGEEYIIIKEADILAVL 93


>gi|163929817|dbj|BAF95908.1| chaperonin GroES [Nostoc commune]
          Length = 103

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 60/97 (61%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G + +PDT  EKP    GE++ +G G  +  G   E E+
Sbjct: 11  VKPLGDRVFVKVNASEEKTA-GGLYLPDTAKEKPQV--GEVVALGPGKRNDDGNRQELEI 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             GD VL+ K++GT+IKL   EEY+++ E DI+ +V+
Sbjct: 68  KVGDKVLYSKYAGTDIKLGT-EEYVLLSEKDILAVVI 103


>gi|125623277|ref|YP_001031760.1| co-chaperonin GroES [Lactococcus lactis subsp. cremoris MG1363]
 gi|23813806|sp|Q9AEP8|CH10_LACLM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|13641350|gb|AAK31638.1| chaperonin GroES [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492085|emb|CAL97014.1| heat shock protein groES [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070027|gb|ADJ59427.1| co-chaperonin GroES [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 94

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RVV+R  + E K+  G I++     EKP   + E++ VG G     G +I P V
Sbjct: 2   LKPLENRVVLRVKEEEEKSM-GGIVLTSASQEKPQ--TAEVIAVGEGKTTNHGTLISPLV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GT +K+ DGEE+L++++SD++ IV
Sbjct: 59  KVGDTVIFEKFAGTTVKM-DGEEFLILKDSDLLAIV 93


>gi|332827233|gb|EGK00006.1| chaperonin [Dysgonomonas gadei ATCC BAA-286]
          Length = 89

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E K+  G I+IPDT  EKP    GE++ VG G  D+   V++P+ 
Sbjct: 3   IKPLADRVLVKPAAAEEKS-VGGIIIPDTAKEKPL--KGEVIAVGNGTKDED-MVVKPK- 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D VL+GK++GTEI+L +G+ YL+M++SDI+ I+
Sbjct: 58  ---DNVLYGKYAGTEIEL-EGQVYLIMRQSDILAII 89


>gi|262183841|ref|ZP_06043262.1| molecular chaperone protein [Corynebacterium aurimucosum ATCC
           700975]
          Length = 129

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +V+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  +  G+V+   V
Sbjct: 36  IKPLEDKVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VVAVGPGRTNDKGEVVPVGV 92

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F K+ GTE+K  DG+EYL++   D++ ++
Sbjct: 93  NEGDTVIFSKYGGTELKY-DGQEYLLLSARDLLAVI 127


>gi|237750953|ref|ZP_04581433.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373398|gb|EEO23789.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 91

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 62/98 (63%), Gaps = 14/98 (14%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-- 66
            +P   RV+V R++ E KTA+G ++IPD  +EKPS           GV+ +  K +E   
Sbjct: 5   FKPLGKRVLVERIEEEKKTASG-LIIPDNATEKPSI----------GVIKEVSKEVEKDG 53

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           EV KGD VLFGK+ G E+K+ D ++++V++  DI+G++
Sbjct: 54  EVKKGDKVLFGKYKGNEVKI-DNKDFIVLESEDILGVL 90


>gi|229495386|ref|ZP_04389121.1| chaperonin GroS [Porphyromonas endodontalis ATCC 35406]
 gi|229317829|gb|EEN83727.1| chaperonin GroS [Porphyromonas endodontalis ATCC 35406]
          Length = 89

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+   +E K+  G I+IPDT  EKP    G ++  G G  D        E+
Sbjct: 3   IKPLADRVVVKPADAEQKS-QGGIIIPDTAKEKPL--RGTVVAAGKGTKDNPM-----EL 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD+VL+GK++GTEI+L +G+++++M+ESD++ I+
Sbjct: 55  KEGDVVLYGKYAGTEIEL-EGDKFIIMRESDVLAIL 89


>gi|126663270|ref|ZP_01734268.1| 10 kDa chaperonin [Flavobacteria bacterium BAL38]
 gi|126624928|gb|EAZ95618.1| 10 kDa chaperonin [Flavobacteria bacterium BAL38]
          Length = 91

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+  L +E  TA+G I+IPDT  EKP    G ++ VG G  D +       V
Sbjct: 5   IKPISDRVVIAPLAAETTTASG-IIIPDTAKEKPQ--KGTVVAVGNGKKDYTM-----TV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE K  +G++YL+M+E +I  I+
Sbjct: 57  KVGDTVLYGKYSGTEFKY-EGKDYLIMREDEIYAIL 91


>gi|218438762|ref|YP_002377091.1| co-chaperonin GroES [Cyanothece sp. PCC 7424]
 gi|226701751|sp|B7KCB8|CH10_CYAP7 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|218171490|gb|ACK70223.1| chaperonin Cpn10 [Cyanothece sp. PCC 7424]
          Length = 103

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 4/93 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G IL+PDT  EKP    GE++ VG G  +  G     EV
Sbjct: 11  VKPLGDRVFVKVSPSEEKTA-GGILLPDTAKEKPQL--GEVVAVGPGKRNDDGSRSPIEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIM 101
             GD VL+ K++GT+IKL  GE+Y+++ E DI+
Sbjct: 68  KVGDKVLYSKYAGTDIKLG-GEDYVLLSEKDIL 99


>gi|183221714|ref|YP_001839710.1| co-chaperonin GroES [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Paris)']
 gi|189911789|ref|YP_001963344.1| co-chaperonin GroES [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|226704007|sp|B0SCB9|CH10_LEPBA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226704008|sp|B0SKU1|CH10_LEPBP RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|167776465|gb|ABZ94766.1| GroES chaperone [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167780136|gb|ABZ98434.1| GroES protein, Hsp10 family [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 96

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV   ++E +   G+I++PDT  EKP    G+++  G G   + GK++  EV
Sbjct: 4   IKPLGDRVVVEP-KNESEEKIGSIIVPDTAKEKPQ--EGKVIAAGQGRY-EDGKLVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTEIK   G++ L+++ESDI+G+V
Sbjct: 60  KVGDTVLYGKYSGTEIK-QGGKDLLIIRESDILGVV 94


>gi|325106276|ref|YP_004275930.1| Chaperonin Cpn10 [Pedobacter saltans DSM 12145]
 gi|324975124|gb|ADY54108.1| Chaperonin Cpn10 [Pedobacter saltans DSM 12145]
          Length = 95

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (57%), Gaps = 11/99 (11%)

Query: 9   LRPTRG---RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           +RP  G   RV+V    +E KTA+G I IPDT  EKPS        V   V +Q     +
Sbjct: 5   IRPIAGTGNRVIVEPAAAEEKTASG-IYIPDTAKEKPSKG------VVVSVSEQDADAKK 57

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           P V  GDIV++GK+SGTE    +G++YL+M E DI  ++
Sbjct: 58  PSVKVGDIVIYGKYSGTEFSY-EGKDYLIMSEKDIYAVL 95


>gi|300864228|ref|ZP_07109111.1| 10 kDa chaperonin [Oscillatoria sp. PCC 6506]
 gi|300337765|emb|CBN54257.1| 10 kDa chaperonin [Oscillatoria sp. PCC 6506]
          Length = 103

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 57/96 (59%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G I IPD   EKP    GEI  VG G  +  G   E +V
Sbjct: 11  VKPLGERVFVKVSASEEKTA-GGIYIPDNAKEKPQV--GEIAAVGPGKRNDDGTRCEMDV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL   +EY+++ E DI+ IV
Sbjct: 68  KVGDKVLYSKYAGTDIKLGT-DEYVLLAEKDILAIV 102


>gi|56461381|ref|YP_156662.1| co-chaperonin GroES [Idiomarina loihiensis L2TR]
 gi|81362528|sp|Q5QVT3|CH10_IDILO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|56180391|gb|AAV83113.1| Co-chaperonin GroES (HSP10) [Idiomarina loihiensis L2TR]
          Length = 96

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 61/95 (64%), Gaps = 3/95 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RV+++R + E K+A G I++  + +EK  ++ GEI+ VG G +  +G+V   +V
Sbjct: 3   LRPLHDRVIIKRTEVEAKSA-GGIVLTGSAAEK--STRGEIVAVGKGRILDNGEVRALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD VLF +  G + +  DGEEYL+M ESDI+ +
Sbjct: 60  KAGDKVLFNEGYGVKTEKIDGEEYLIMSESDILAV 94


>gi|315127892|ref|YP_004069895.1| chaperonin [Pseudoalteromonas sp. SM9913]
 gi|315016406|gb|ADT69744.1| chaperonin [Pseudoalteromonas sp. SM9913]
          Length = 95

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+++RL+ E K+A G I++  + +EK  ++ GE++ VG G + ++G V   EV
Sbjct: 3   IRPLQDRVIIKRLEEETKSA-GGIVLTGSAAEK--STRGEVVAVGNGRVLENGDVRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG +     K+ +G+EYL+M+E +I+GIV
Sbjct: 60  KAGDTVLFGSYVEKTEKI-EGQEYLIMREDNILGIV 94


>gi|78484690|ref|YP_390615.1| chaperonin Cpn10 [Thiomicrospira crunogena XCL-2]
 gi|123741667|sp|Q31IT2|CH10_THICR RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|78362976|gb|ABB40941.1| Chaperonin 10 kDa subunit (groES protein) [Thiomicrospira crunogena
           XCL-2]
          Length = 96

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVVR+++ E K +TG IL+P +  EK +   GE++ VG G    +G +I   V
Sbjct: 3   IKPLHDRVVVRQVE-EQKESTGGILLPGSAQEKENL--GEVVAVGPGKAADNGSIIPMTV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG++SG E+K + G+   VM+E DI+ IV
Sbjct: 60  KVGDKVMFGQYSGQEVKDDAGKPLKVMREDDIIAIV 95


>gi|7331143|gb|AAF60293.1| chaperonin 21 precursor [Solanum lycopersicum]
          Length = 253

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KTA G +L+ +   EKPS   G I+ VG G +D+ G      V
Sbjct: 160 LQPLNDRVLIKVAEAEEKTA-GGLLLTEAAKEKPSI--GTIIAVGPGPLDEEGNRKPLSV 216

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G+ VL+ K++G+E K  DG +Y+ ++ SD+M ++
Sbjct: 217 SPGNTVLYSKYAGSEFKGADGSDYITLRVSDVMAVL 252



 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 62/97 (63%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKV-IEPE 67
           L+P   RV+V+   +E KT  G IL+P +V  KP+   GE++ VG G    +GK  ++  
Sbjct: 62  LKPLGDRVLVKIKTAEEKT-VGGILLPVSVQSKPNG--GEVVAVGEG--HSAGKTKVDIS 116

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G  V++ K++GTE++  DG ++L+++E DI+GI+
Sbjct: 117 VKTGAQVIYSKYAGTEVEF-DGSKHLILKEDDIVGIL 152


>gi|189501757|ref|YP_001957474.1| hypothetical protein Aasi_0309 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497198|gb|ACE05745.1| hypothetical protein Aasi_0309 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 92

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (61%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV+V    +E KTA G + IPDT  EKP    G+++ VG G  D      EP  
Sbjct: 6   VKPLADRVLVEPAAAEEKTA-GGLYIPDTAKEKPQ--KGKVVAVGPGKKD------EPLT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK+ GTE+ + DG++YL+M+ESDI  IV
Sbjct: 57  VKVGDNVLYGKYGGTELNI-DGKDYLIMRESDIYAIV 92


>gi|313683190|ref|YP_004060928.1| chaperonin cpn10 [Sulfuricurvum kujiense DSM 16994]
 gi|313156050|gb|ADR34728.1| Chaperonin Cpn10 [Sulfuricurvum kujiense DSM 16994]
          Length = 86

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 60/96 (62%), Gaps = 13/96 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V+RL+   KTA+G I+IPD   EKPS   G ++ V + V +         V
Sbjct: 3   FQPLGKRVLVQRLEEATKTASG-IIIPDNAKEKPS--QGTVVAVSSEVEN---------V 50

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S GD V+FGK++G E+ L DG+ YLV++  D++GI+
Sbjct: 51  STGDTVVFGKYAGNELTL-DGKAYLVIETDDLLGII 85


>gi|260579177|ref|ZP_05847067.1| chaperonin GroES [Corynebacterium jeikeium ATCC 43734]
 gi|258602663|gb|EEW15950.1| chaperonin GroES [Corynebacterium jeikeium ATCC 43734]
          Length = 99

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G        I  +V
Sbjct: 6   IKPLEDRVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VIAVGPGRWADDDDRIPMDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTE+K N GEEYL++ + DI+ ++
Sbjct: 63  KEGDTVIFSKYGGTELKYN-GEEYLLLTQRDILAVI 97


>gi|298491663|ref|YP_003721840.1| chaperonin cpn10 ['Nostoc azollae' 0708]
 gi|298233581|gb|ADI64717.1| Chaperonin Cpn10 ['Nostoc azollae' 0708]
          Length = 103

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   +E KTA G + +PDT  EKP    GE++ +G G  +  G   E E+
Sbjct: 11  VKPLGDRVFVKVTAAEEKTA-GGLYLPDTAKEKPQV--GEVVALGPGKRNDDGSRQELEI 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT++KL   EEY+++ E DI+ +V
Sbjct: 68  KAGDKVLYSKYAGTDVKLGT-EEYVLLSEKDILAVV 102


>gi|73662156|ref|YP_300937.1| co-chaperonin GroES [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82592674|sp|Q49YY6|CH10_STAS1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|72494671|dbj|BAE17992.1| co-chaperonin GroES [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 95

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++++ + E  T +G I++ D+  EK  ++ G I+ VGAG + + G  + PEV
Sbjct: 2   LKPLGNRVIIQKSEQEQTTKSG-IVLTDSAKEK--SNEGTIIAVGAGRILKDGSRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F +++GTE+K  D E YL++ E DI+ I+
Sbjct: 59  NEGDKVVFQQYAGTEVKRGD-ETYLIVNEEDILAII 93


>gi|119468165|ref|ZP_01611291.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Alteromonadales
           bacterium TW-7]
 gi|13366172|dbj|BAB39464.1| GroES [Pseudoalteromonas sp. PS1M3]
 gi|119448158|gb|EAW29422.1| 10 kDa chaperonin (Protein Cpn10) (groES protein) [Alteromonadales
           bacterium TW-7]
          Length = 95

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+RL+ E K+A G I++  + +EK  ++ GE++ VG G +  +G V   EV
Sbjct: 3   IRPLQDRVIVKRLEEETKSA-GGIVLTGSAAEK--STRGEVVAVGNGRILDNGDVRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG +     K+ +G+EYL+M+E +I+GIV
Sbjct: 60  KAGDTVLFGSYVEKTEKI-EGQEYLIMREDNILGIV 94


>gi|328954888|ref|YP_004372221.1| Chaperonin Cpn10 [Coriobacterium glomerans PW2]
 gi|328455212|gb|AEB06406.1| Chaperonin Cpn10 [Coriobacterium glomerans PW2]
          Length = 95

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+  ++E KT +G + I     EKP    GE++ VGAG +  SG  +  +V
Sbjct: 3   LKPLGDRVLVKPDEAEHKTKSG-LYIASNAQEKPQ--RGEVVAVGAGKLSDSGDRLPIDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD V++GK+ G E+K+N GE+YL+M+  DI  I
Sbjct: 60  HVGDTVIYGKFGGNEVKVN-GEDYLLMRADDIYAI 93


>gi|116784611|gb|ABK23407.1| unknown [Picea sitchensis]
 gi|224284442|gb|ACN39955.1| unknown [Picea sitchensis]
          Length = 254

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KT TG IL+ +T  EKPS  +G ++ VG G+ D+ G      +
Sbjct: 161 LKPLNDRVLIQVSKAEEKT-TGGILLTETAKEKPS--TGTVIAVGPGMYDEEGNRKPINI 217

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G E K +DG +Y+ M+ SD++ ++
Sbjct: 218 SPGKTVLYSKYAGNEFKSSDGSQYVSMRVSDVIAVM 253



 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 62/96 (64%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +Q+  + + G IL+PDT  +KP    GE++ VG G    S   +EP V
Sbjct: 63  IKPLGDRVLVK-IQAIEEKSRGGILLPDTTQDKPQG--GEVVAVGEG-KSFSKTQVEPSV 118

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  +++ K++GTE++ N G ++L+++E DI+G++
Sbjct: 119 QLGAKIIYSKYAGTELEFN-GVDHLLLKEDDIVGLL 153


>gi|75812805|ref|YP_320422.1| co-chaperonin GroES [Anabaena variabilis ATCC 29413]
 gi|75705561|gb|ABA25233.1| Chaperonin Cpn10 [Anabaena variabilis ATCC 29413]
          Length = 103

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 61/96 (63%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ ++  Q+E KTA G IL+PDT  EKP    GE++ VG G  ++ G     EV
Sbjct: 11  VKPLGDRIFIKVAQAEEKTA-GGILLPDTAKEKPQI--GEVVQVGPGKRNEDGSRQPMEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G+ VL+ +++GT+IKL   EEY+++ E D++ IV
Sbjct: 68  KIGERVLYSRYAGTDIKLGS-EEYVLLSEKDVLAIV 102


>gi|763440|gb|AAB18634.1| heat shock protein [Caulobacter crescentus CB15]
          Length = 99

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 9/100 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
            RP   RV+V+R++ E KT  G I+IPDT  EKP    GE++  G G  ++      P +
Sbjct: 3   FRPLGDRVLVKRVEEETKTK-GGIIIPDTAKEKPQ--EGEVVRSGPGARNEH--TSSPLD 57

Query: 68  VSKGDIVLFGKWSGTE---IKLNDGEEYLVMQESDIMGIV 104
           V  GD +LFGKWSGT     K+    + L+M+ESD++G+V
Sbjct: 58  VKAGDRILFGKWSGTASEGTKVKVTSDLLIMKESDVLGVV 97


>gi|291545840|emb|CBL18948.1| Co-chaperonin GroES (HSP10) [Ruminococcus sp. SR1/5]
          Length = 95

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   RV+V+  ++E KTA+G I++P++  EK      E++ VG G V+D  GK +  +
Sbjct: 3   LKPVADRVIVKYFETEDKTASG-IVLPESSKEK--TQQAEVIAVGGGKVVD--GKEVPVQ 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++GK++GTEIK  +GE+YLV+   DI+ IV
Sbjct: 58  VKPGDRVIYGKYTGTEIKY-EGEKYLVINADDIIAIV 93


>gi|300932940|ref|ZP_07148196.1| co-chaperonin GroES [Corynebacterium resistens DSM 45100]
          Length = 99

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G        I  +V
Sbjct: 6   IKPLEDRVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VIAVGPGRWADDDDRIPMDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTE+K N GEEYL++ + DI+ ++
Sbjct: 63  KEGDTVVFSKYGGTELKYN-GEEYLLLSQRDILAVI 97


>gi|118616656|ref|YP_904988.1| co-chaperonin GroES [Mycobacterium ulcerans Agy99]
 gi|183981145|ref|YP_001849436.1| 10 kDa chaperone (GroES) [Mycobacterium marinum M]
 gi|166198387|sp|A0PME8|CH10_MYCUA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226704014|sp|B2HD09|CH10_MYCMM RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|118568766|gb|ABL03517.1| 10 kDa chaperone (GroES) [Mycobacterium ulcerans Agy99]
 gi|183174471|gb|ACC39581.1| 10 kDa chaperone (GroES) [Mycobacterium marinum M]
          Length = 100

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V++GD V++ K+ GTEIK   GEEYL++   D++ +V
Sbjct: 63  VAEGDTVIYSKYGGTEIKYG-GEEYLILSARDVLAVV 98


>gi|260592217|ref|ZP_05857675.1| chaperonin GroS [Prevotella veroralis F0319]
 gi|260535851|gb|EEX18468.1| chaperonin GroS [Prevotella veroralis F0319]
          Length = 89

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++   Q+E K   G I+IPDT  EKP    G+++ VG G  D+     E  +
Sbjct: 3   IKPLSDRVLILPAQAEEKV--GGIIIPDTAKEKPQ--RGKVVAVGNGTKDE-----EMTL 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE++ N+GE+YL+M++SD++ +V
Sbjct: 54  KVGDEVLYGKYAGTELE-NEGEKYLMMRQSDVLAVV 88


>gi|116787517|gb|ABK24538.1| unknown [Picea sitchensis]
          Length = 249

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+++  ++E KT +G +L+ ++  EKPS   G I+ VG G  D+ GK     V
Sbjct: 156 LKPLNDRVLIKVTEAEDKT-SGGLLLAESAKEKPSI--GTIIAVGPGAYDEEGKRKPMSV 212

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ VL+ K++G E K  DG EY+ ++ SD++ ++
Sbjct: 213 TAGNTVLYSKFAGNEFKSGDGSEYVTLRVSDVLAVL 248



 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           L+P   RV+++  Q+E KT  G IL+P T  ++P    GE++ +G       GK   P  
Sbjct: 58  LKPLGDRVLIKLKQAEEKT-QGGILLPSTAQKRPEG--GEVVALGDA--KTVGKTQVPLS 112

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  G  ++  KWSGTEI+ N G  +L+++E DI+G++
Sbjct: 113 VQIGANIVHSKWSGTEIEFN-GVNHLLVKEDDIVGVL 148


>gi|313203669|ref|YP_004042326.1| chaperonin cpn10 [Paludibacter propionicigenes WB4]
 gi|312442985|gb|ADQ79341.1| Chaperonin Cpn10 [Paludibacter propionicigenes WB4]
          Length = 89

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 65/96 (67%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+   +E KT +G I+IPD+  EKP    GE++ VG G  D+     E  V
Sbjct: 3   IKPLADRVLVKPAPAEEKTISG-IIIPDSAKEKPL--KGEVLAVGNGTKDE-----EMVV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ VL+GK++GTE++  +GE+YL+M++SDI+ I+
Sbjct: 55  AVGNTVLYGKYAGTELEW-EGEKYLIMKQSDILAII 89


>gi|298253090|ref|ZP_06976882.1| co-chaperonin GroES (HSP10) [Gardnerella vaginalis 5-1]
 gi|297532485|gb|EFH71371.1| co-chaperonin GroES (HSP10) [Gardnerella vaginalis 5-1]
          Length = 90

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 58/90 (64%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           +++V++ Q+E +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V  GD V
Sbjct: 4   KIIVKQAQAETQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDVKVGDKV 60

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           L+ K+ GTE+   +GE+YL++   D++ I+
Sbjct: 61  LYSKYGGTEVHY-EGEDYLIVSSRDVLAIL 89


>gi|313680633|ref|YP_004058372.1| chaperonin cpn10 [Oceanithermus profundus DSM 14977]
 gi|313153348|gb|ADR37199.1| Chaperonin Cpn10 [Oceanithermus profundus DSM 14977]
          Length = 102

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 54/78 (69%), Gaps = 3/78 (3%)

Query: 27  TATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKL 86
           T  G I++PDT  EKP    G+++ VG+G +  +G+ +  EV +GDIV+F K+ GTEI++
Sbjct: 26  TTKGGIVLPDTAKEKPQ--RGKVIAVGSGKLLDNGERVPLEVKEGDIVVFAKYGGTEIEI 83

Query: 87  NDGEEYLVMQESDIMGIV 104
            DG EY+++ E D++ +V
Sbjct: 84  -DGNEYIILSERDLLAVV 100


>gi|150011023|gb|ABR57168.1| co-chaperonin GroES [Staphylococcus xylosus]
          Length = 95

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++++ + E  T +G I++ D+  EK  ++ G I+ VGAG + + G  + PEV
Sbjct: 2   LKPLGNRVIIQKSEQEQTTKSG-IVLTDSAKEK--SNEGTIIAVGAGRILEDGSRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F +++GTE+K  D E YL++ E DI+ I+
Sbjct: 59  NEGDNVVFQQFAGTEVKRGD-ETYLIVNEEDILAII 93


>gi|282896941|ref|ZP_06304947.1| Chaperonin Cpn10 [Raphidiopsis brookii D9]
 gi|281198350|gb|EFA73240.1| Chaperonin Cpn10 [Raphidiopsis brookii D9]
          Length = 103

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   +E KTA G + +PDT  EKP    GE++ +GAG  +  G   E ++
Sbjct: 11  VKPLGDRVFVKVTAAEEKTA-GGLFLPDTAKEKPQV--GEVVALGAGKRNDDGTRQEIDL 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT++KL   EEY+++ E DI+ +V
Sbjct: 68  KVGDKVLYSKYAGTDVKLGT-EEYVLLSEKDILAVV 102


>gi|317154639|ref|YP_004122687.1| Chaperonin Cpn10 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944890|gb|ADU63941.1| Chaperonin Cpn10 [Desulfovibrio aespoeensis Aspo-2]
          Length = 86

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 19/100 (19%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE- 67
           L+P   RV+V+R + E KTA G + IPD+  EKP A +     V AG          PE 
Sbjct: 3   LKPLHDRVIVKRKEGETKTA-GGLYIPDSAKEKPQAGT----VVAAG----------PEC 47

Query: 68  --VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
             V KGD +LF K++G+E K+ DG++ ++M+E DI+G+  
Sbjct: 48  ETVKKGDSILFAKYAGSEFKM-DGDDLVIMREDDILGVFA 86


>gi|225849565|ref|YP_002729799.1| chaperonin GroS [Persephonella marina EX-H1]
 gi|225646706|gb|ACO04892.1| chaperonin GroS [Persephonella marina EX-H1]
          Length = 97

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQ-SEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           ++P   RVVV+  + +E KT +G I+IPDT  EKPS   GE++ VG G + ++G++   +
Sbjct: 4   IKPLYDRVVVKPAEEAEEKTPSG-IIIPDTAKEKPS--EGEVVAVGEGRLLENGEIAPLK 60

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++ K++G E  + DGEE +V++E DI+ IV
Sbjct: 61  VKVGDKVIYSKYAGNEF-VVDGEELIVLREDDILAIV 96


>gi|195643284|gb|ACG41110.1| chaperonin [Zea mays]
          Length = 246

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +++ +T  EKPS   G ++ VG G +D+ GK     V
Sbjct: 153 MKPLNDRVLIKVAEAEDKTP-GGLILTETTKEKPSI--GTVVAVGPGPLDEEGKRQPLSV 209

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 210 SAGSTVLYSKYAGSEFKGADGTAYIVLRASDVMAVL 245



 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P    V+V+   +E KT  G IL+P T   KP    GE++ VGAG      K I  ++
Sbjct: 55  LKPLGDXVLVKLGAAEEKT-VGGILLPSTAQTKPQG--GEVVAVGAG-RTIGDKKIAVDI 110

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ ND  ++L+++E DI+GI+
Sbjct: 111 ETGAQVVYSKYAGTEVEFND-SKHLILKEDDIIGIL 145


>gi|212274725|ref|NP_001130154.1| hypothetical protein LOC100191248 [Zea mays]
 gi|195637206|gb|ACG38071.1| chaperonin [Zea mays]
          Length = 246

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +++ +T  EKPS   G ++ VG G +D+ GK     V
Sbjct: 153 MKPLNDRVLIKVAEAEDKTP-GGLILTETTKEKPSI--GTVVAVGPGPLDEEGKRQPLSV 209

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 210 SAGSTVLYSKYAGSEFKGADGTAYIVLRASDVMAVL 245



 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 59/96 (61%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +Z KT  G IL+P T   KP    GE++ VGAG      K I  ++
Sbjct: 55  LKPLGDRVLVKLGAAZEKT-VGGILLPSTAQTKPQG--GEVVAVGAG-RTIGDKKIAVDI 110

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ ND  ++L+++E DI+GI+
Sbjct: 111 ETGAQVVYSKYAGTEVEFND-SKHLILKEDDIIGIL 145


>gi|152964704|ref|YP_001360488.1| co-chaperonin GroES [Kineococcus radiotolerans SRS30216]
 gi|189044107|sp|A6W5Y5|CH10_KINRD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|151359221|gb|ABS02224.1| chaperonin Cpn10 [Kineococcus radiotolerans SRS30216]
          Length = 98

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           + P   R+VV+ L +E  TA+G ++IPDT  EKP    GE++ VG G +D +G  +  +V
Sbjct: 5   ITPLEDRIVVKPLDAEQTTASG-LVIPDTAKEKPQ--EGEVLAVGPGRVDDNGNRVPVDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
           + GD V++ K+ GTE+K   G+E L++   D++  V +
Sbjct: 62  AVGDKVIYSKYGGTEVKYG-GDELLILSARDVLAKVAK 98


>gi|332292311|ref|YP_004430920.1| Chaperonin Cpn10 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170397|gb|AEE19652.1| Chaperonin Cpn10 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 91

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 61/96 (63%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV+  + +E +TA+G + IPD+  EK     G+++ VG+G  D      E  V
Sbjct: 5   IKPLADRVVIEPVAAETQTASG-LYIPDSAQEK--QQKGKVVAVGSGTKDH-----EMTV 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V++GK+SG+E+K  DG +Y++M+E DI+ IV
Sbjct: 57  VVGDTVIYGKYSGSELKF-DGVDYMIMKEDDILAIV 91


>gi|109948170|ref|YP_665398.1| co-chaperonin GroES [Helicobacter acinonychis str. Sheeba]
 gi|123066082|sp|Q17VC7|CH10_HELAH RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|109715391|emb|CAK00399.1| heat-shock chaperonin GroES [Helicobacter acinonychis str. Sheeba]
          Length = 118

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDILGIV 89


>gi|68536819|ref|YP_251524.1| co-chaperonin GroES [Corynebacterium jeikeium K411]
 gi|123775667|sp|Q4JTF1|CH10_CORJK RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|68264418|emb|CAI37906.1| molecular chaperone protein [Corynebacterium jeikeium K411]
          Length = 99

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G        I  +V
Sbjct: 6   IKPLEDRVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VIAVGPGRWADDDDRIPMDV 62

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F K+ GTE+K N GEEYL++ + DI+ ++
Sbjct: 63  KEGDTVVFSKYGGTELKYN-GEEYLLLTQRDILAVI 97


>gi|194688414|gb|ACF78291.1| unknown [Zea mays]
 gi|194696546|gb|ACF82357.1| unknown [Zea mays]
 gi|194703280|gb|ACF85724.1| unknown [Zea mays]
 gi|195643356|gb|ACG41146.1| chaperonin [Zea mays]
 gi|223948697|gb|ACN28432.1| unknown [Zea mays]
 gi|238014128|gb|ACR38099.1| unknown [Zea mays]
          Length = 246

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KT  G +++ +T  EKPS   G ++ VG G +D+ GK     V
Sbjct: 153 MKPLNDRVLIKVAEAEDKTP-GGLILTETTKEKPSI--GTVVAVGPGPLDEEGKRQPLSV 209

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 210 SAGSTVLYSKYAGSEFKGADGTAYIVLRASDVMAVL 245



 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G IL+P T   KP    GE++ VGAG      K I  ++
Sbjct: 55  LKPLGDRVLVKLGAAEEKT-VGGILLPSTAQTKPQG--GEVVAVGAG-RTIGDKKIAVDI 110

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ ND  ++L+++E DI+GI+
Sbjct: 111 ETGAQVVYSKYAGTEVEFND-SKHLILKEDDIIGIL 145


>gi|223936009|ref|ZP_03627923.1| chaperonin Cpn10 [bacterium Ellin514]
 gi|223895231|gb|EEF61678.1| chaperonin Cpn10 [bacterium Ellin514]
          Length = 97

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R++V  ++ E +T  G I+IPD+  EKP  S   ++ +G G  D +GK +  EV
Sbjct: 5   VKPLGDRILVEAVE-EKETKKGGIIIPDSAKEKPMESI--VVALGTGKTDDNGKKVPFEV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KGD VL  K+ GTEIKL DG+EY ++   DI+ ++
Sbjct: 62  KKGDRVLVSKYGGTEIKL-DGKEYKILNSDDILAVL 96


>gi|300728211|ref|ZP_07061579.1| chaperonin GroS [Prevotella bryantii B14]
 gi|299774446|gb|EFI71070.1| chaperonin GroS [Prevotella bryantii B14]
          Length = 90

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V    +E K   G I+IPDT  EKP    G+++ VG G  D+   + E   
Sbjct: 3   IKPLADRVLVLPAPAEEKV--GGIIIPDTAKEKPQ--RGKVVAVGQGTKDEQMILKE--- 55

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD+VL+GK++GTE++ N GE+YL+M++SD++ IV
Sbjct: 56  --GDVVLYGKYAGTELEAN-GEKYLMMRQSDVLAIV 88


>gi|23336432|ref|ZP_00121650.1| COG0234: Co-chaperonin GroES (HSP10) [Bifidobacterium longum
           DJO10A]
 gi|23466110|ref|NP_696713.1| co-chaperonin GroES [Bifidobacterium longum NCC2705]
 gi|189440539|ref|YP_001955620.1| co-chaperonin GroES [Bifidobacterium longum DJO10A]
 gi|213693107|ref|YP_002323693.1| chaperonin Cpn10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227546448|ref|ZP_03976497.1| chaperone GroES [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|239620988|ref|ZP_04664019.1| Hsp10 [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|296454894|ref|YP_003662038.1| chaperonin Cpn10 [Bifidobacterium longum subsp. longum JDM301]
 gi|312133848|ref|YP_004001187.1| gros [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483020|ref|ZP_07942022.1| chaperonin 10 kDa subunit [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689951|ref|YP_004209685.1| co-chaperonin GroES [Bifidobacterium longum subsp. infantis 157F]
 gi|322691891|ref|YP_004221461.1| co-chaperonin GroES [Bifidobacterium longum subsp. longum JCM 1217]
 gi|29839311|sp|Q8CY47|CH10_BIFLO RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|226701728|sp|B3DPY3|CH10_BIFLD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813828|sp|B7GNF9|CH10_BIFLI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|23326844|gb|AAN25349.1| groes [Bifidobacterium longum NCC2705]
 gi|170516907|gb|ACB15389.1| GroES [Bifidobacterium longum]
 gi|189428974|gb|ACD99122.1| Co-chaperonin HSP10 [Bifidobacterium longum DJO10A]
 gi|213524568|gb|ACJ53315.1| chaperonin Cpn10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227213105|gb|EEI80984.1| chaperone GroES [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|239516089|gb|EEQ55956.1| Hsp10 [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|296184326|gb|ADH01208.1| chaperonin Cpn10 [Bifidobacterium longum subsp. longum JDM301]
 gi|311773139|gb|ADQ02627.1| GroS [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915521|gb|EFV36941.1| chaperonin 10 kDa subunit [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456747|dbj|BAJ67369.1| co-chaperonin GroES [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320459285|dbj|BAJ69906.1| co-chaperonin GroES [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|320461287|dbj|BAJ71907.1| co-chaperonin GroES [Bifidobacterium longum subsp. infantis 157F]
          Length = 97

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   +++V++ +++ +TA+G + IPD   EKP    GE++ VG G  D  G+ I  +V
Sbjct: 5   LTPLEDKIIVKQAEAQTQTASG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPMDV 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K+ GTE+   +GE+YL++   DI+ I+
Sbjct: 62  KVGDKVLYSKYGGTEVHY-EGEDYLIVGARDILAIL 96


>gi|323345084|ref|ZP_08085308.1| chaperone GroES [Prevotella oralis ATCC 33269]
 gi|323094354|gb|EFZ36931.1| chaperone GroES [Prevotella oralis ATCC 33269]
          Length = 179

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 62/95 (65%), Gaps = 10/95 (10%)

Query: 10  RPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVS 69
           +P   RV+V   Q+E K   G I+IPDT  EKP    G+++  G G  D+     E  + 
Sbjct: 94  KPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKVVATGNGTKDE-----EMVLK 144

Query: 70  KGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +GD VL+GK+SGTE+++ +GE+YL+M++SD++ +V
Sbjct: 145 EGDTVLYGKYSGTELEV-EGEKYLMMRQSDVLAVV 178


>gi|156742738|ref|YP_001432867.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941]
 gi|156234066|gb|ABU58849.1| chaperonin Cpn10 [Roseiflexus castenholzii DSM 13941]
          Length = 98

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 63/100 (63%), Gaps = 5/100 (5%)

Query: 8   YLRPTRGRVVVRRLQSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEP 66
           +++P   RVVV+    E +   G +++PDT + E+P    GE++ VG G     GK+I  
Sbjct: 2   HVQPLGDRVVVKPKPKE-EKTKGGVILPDTATKERPM--QGEVIAVGPGRRTDDGKLIPV 58

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            V  G  VLF K+SGTE K++D EEYL++QE D++GI+ E
Sbjct: 59  SVEVGQQVLFAKYSGTEFKIDD-EEYLILQERDLLGIIQE 97


>gi|329895202|ref|ZP_08270866.1| Heat shock protein 60 family co-chaperone GroES [gamma
           proteobacterium IMCC3088]
 gi|328922440|gb|EGG29782.1| Heat shock protein 60 family co-chaperone GroES [gamma
           proteobacterium IMCC3088]
          Length = 96

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 58/96 (60%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E +T  G IL+P +  EKP+   GE++ VG G    +G+     V
Sbjct: 3   IRPLYDRVVVRRKEEE-QTTAGGILLPGSAKEKPN--QGEVVAVGTGKALDNGETRAMAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+     DGEE ++M ES+I  +V
Sbjct: 60  KVGDKVVFGQYAGSNTIEVDGEELIIMSESEIYAVV 95


>gi|332667638|ref|YP_004450426.1| 10 kDa chaperonin [Haliscomenobacter hydrossis DSM 1100]
 gi|332336452|gb|AEE53553.1| 10 kDa chaperonin [Haliscomenobacter hydrossis DSM 1100]
          Length = 87

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVVV+   +E KT  G I+IPDT  EKP    GE++ VG G   + G ++   V
Sbjct: 1   MKPINDRVVVKPAPAEEKT-KGGIIIPDTAKEKPQ--RGEVVAVGPG---KDGNLMT--V 52

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GDIVL+GK++G E+   +G++YL+M+E DI+ I+
Sbjct: 53  TVGDIVLYGKYAGQELNF-EGQDYLIMREDDILVIL 87


>gi|260589063|ref|ZP_05854976.1| chaperonin GroS [Blautia hansenii DSM 20583]
 gi|260540483|gb|EEX21052.1| chaperonin GroS [Blautia hansenii DSM 20583]
          Length = 110

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 68/97 (70%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           L P   RVV+++L +E  T +G I++P    EKP  +  E++ VG  G++D  GK ++ E
Sbjct: 19  LVPLGDRVVLKQLVAEETTKSG-IVLPGQAQEKPQQA--EVVAVGPGGIVD--GKEVKME 73

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD V++ K++GTE+KL DGEEY++++++DI+ +V
Sbjct: 74  VAAGDQVIYSKYAGTEVKL-DGEEYIIVKQNDILAVV 109


>gi|54022853|ref|YP_117095.1| co-chaperonin GroES [Nocardia farcinica IFM 10152]
 gi|60389505|sp|Q5Z1G0|CH10_NOCFA RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|54014361|dbj|BAD55731.1| putative chaperonin GroES [Nocardia farcinica IFM 10152]
          Length = 100

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (63%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  TA+G ++IPDT  EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQANEAETTTASG-LVIPDTAKEKPQ--EGTVVAVGPGRWDEDGEKRIPLD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V +GD V++ K+ GTEIK   GEEYL++   D++ +V
Sbjct: 63  VQEGDTVIYSKYGGTEIKYQ-GEEYLILSARDVLAVV 98


>gi|88801437|ref|ZP_01116965.1| co-chaperonin GroES [Polaribacter irgensii 23-P]
 gi|88782095|gb|EAR13272.1| co-chaperonin GroES [Polaribacter irgensii 23-P]
          Length = 91

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (64%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA+G ++IPD   EKP    G ++ +G      +GK+ EP  
Sbjct: 5   IKPLADRVLIEPAAAETKTASG-LIIPDNAKEKPQ--QGTVVAIG------NGKIDEPLT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+ K+ GT++KL +G++YL+M+ESDI+ I+
Sbjct: 56  VKIGDTVLYSKYGGTDLKL-EGKDYLMMRESDILAII 91


>gi|189011854|emb|CAQ30447.1| heat shock protein [Helicobacter pylori]
          Length = 118

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+VRRL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVRRLEEENKTSSG-IIIPDNAKEKP------LMGVIKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ G EI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGAEIVL-DGTEYMVLELEDILGIV 89


>gi|332532751|ref|ZP_08408625.1| heat shock protein 60 family co-chaperone GroES [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037778|gb|EGI74228.1| heat shock protein 60 family co-chaperone GroES [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 95

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP + RV+V+RL+ E K+A G I++  + +EK  ++ GE++ VG G +  +G V   EV
Sbjct: 3   IRPLQDRVIVKRLEEETKSA-GGIVLTGSAAEK--STRGEVVAVGNGRVLDNGDVRALEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLFG +   +++  +G+EYL+M+E +I+GIV
Sbjct: 60  KAGDTVLFGSYV-EKVEKIEGQEYLIMREDNILGIV 94


>gi|192360354|ref|YP_001983107.1| GroES protein [Cellvibrio japonicus Ueda107]
 gi|190686519|gb|ACE84197.1| GroES protein [Cellvibrio japonicus Ueda107]
          Length = 175

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVVVRR + E KTA G I++     EKP+   GE++ VG G +  SG++   +V
Sbjct: 82  IRPLHDRVVVRRKEEETKTA-GGIILSGAAKEKPN--QGEVVAVGNGRVLTSGELRPLDV 138

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FGK++G++    +GEE +++ ESDI  ++
Sbjct: 139 KVGDTVVFGKYAGSDTITINGEELVILNESDIKAVL 174


>gi|288803598|ref|ZP_06409028.1| chaperonin GroS [Prevotella melaninogenica D18]
 gi|302345582|ref|YP_003813935.1| chaperonin GroS [Prevotella melaninogenica ATCC 25845]
 gi|288333838|gb|EFC72283.1| chaperonin GroS [Prevotella melaninogenica D18]
 gi|302150240|gb|ADK96502.1| chaperonin GroS [Prevotella melaninogenica ATCC 25845]
          Length = 89

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E K   G I+IPDT  EKP    G+++ VG G  D+     E  +
Sbjct: 3   IKPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKVVAVGNGTKDE-----EMIL 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTE++ N+GE+YL+M++SD++ +V
Sbjct: 54  KVGDEVLYGKYAGTELE-NEGEKYLMMRQSDVLAVV 88


>gi|212721180|ref|NP_001131801.1| hypothetical protein LOC100193174 [Zea mays]
 gi|242046720|ref|XP_002461106.1| hypothetical protein SORBIDRAFT_02g040870 [Sorghum bicolor]
 gi|194692578|gb|ACF80373.1| unknown [Zea mays]
 gi|195605592|gb|ACG24626.1| chaperonin [Zea mays]
 gi|195615144|gb|ACG29402.1| chaperonin [Zea mays]
 gi|195652979|gb|ACG45957.1| chaperonin [Zea mays]
 gi|241924483|gb|EER97627.1| hypothetical protein SORBIDRAFT_02g040870 [Sorghum bicolor]
          Length = 98

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P+  RV+V +L    KTA G IL+P+T  +    ++ +++ VG G  D++G +I   +
Sbjct: 5   LLPSLNRVLVEKLVQPKKTA-GGILLPETSKQ---LNAAKVVAVGPGERDKAGNLIPVAL 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD VL  ++ GTE+KL   +EYL+ +E DI+G +V+
Sbjct: 61  KEGDTVLLPEYGGTEVKLAADKEYLLFREHDILGTLVD 98


>gi|332982796|ref|YP_004464237.1| Chaperonin Cpn10 [Mahella australiensis 50-1 BON]
 gi|332700474|gb|AEE97415.1| Chaperonin Cpn10 [Mahella australiensis 50-1 BON]
          Length = 94

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 68/97 (70%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           L+P   R+V+++++ E  T +G I++P T  EKP  +  E++ VG  G++D  GK ++ E
Sbjct: 3   LKPLGDRIVIKQVEKEETTKSG-IVLPGTAQEKPQIA--EVIAVGPGGIVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++ K++GTE+K  DGEEY+++++SD++ ++
Sbjct: 58  VKPGDRVIYSKYAGTEVKY-DGEEYIIIKQSDVLAVI 93


>gi|299141025|ref|ZP_07034163.1| chaperonin GroS [Prevotella oris C735]
 gi|298577991|gb|EFI49859.1| chaperonin GroS [Prevotella oris C735]
          Length = 89

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E K   G I+IPDT  EKP    G+++ VG G  D++  + E   
Sbjct: 3   IKPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKVIAVGQGTKDEAMVLKE--- 55

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D+VL+GK++GTE++  +GE+YL+M++SD++ +V
Sbjct: 56  --NDVVLYGKYAGTELEY-EGEKYLIMRQSDVLAVV 88


>gi|88707169|ref|ZP_01104861.1| 10 kDa chaperonin [Congregibacter litoralis KT71]
 gi|88698574|gb|EAQ95701.1| 10 kDa chaperonin [Congregibacter litoralis KT71]
          Length = 96

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RVV+RR + E +T  G IL+P +  EKP+   GE++ VG G    +G+V    V
Sbjct: 3   IRPLYDRVVIRRNEEE-ETTAGGILLPGSAKEKPN--QGEVVAVGDGKALDNGEVRALAV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+FG+++G+     DGEE ++M ES+I  +V
Sbjct: 60  KVGDTVVFGQYAGSNTIEVDGEELIIMGESEIYAVV 95


>gi|332672800|gb|AEE69617.1| chaperone GroES [Helicobacter pylori 83]
          Length = 118

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDILGIV 89


>gi|327404265|ref|YP_004345103.1| 10 kDa chaperonin [Fluviicola taffensis DSM 16823]
 gi|327319773|gb|AEA44265.1| 10 kDa chaperonin [Fluviicola taffensis DSM 16823]
          Length = 92

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (61%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV++    +E  TA+G I+IPDT  EKP    G+++ VG G  D      EP  
Sbjct: 5   FKPLADRVLIEAAPAEQVTASG-IIIPDTAKEKPL--KGKVIAVGVGKKD------EPMT 55

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K  D V++G++SGTEIK+ DG +YL+M+E DI GI+
Sbjct: 56  LKVNDTVIYGQYSGTEIKI-DGNDYLIMKEGDIYGII 91


>gi|270284470|ref|ZP_05966182.2| chaperonin GroS [Bifidobacterium gallicum DSM 20093]
 gi|270276963|gb|EFA22817.1| chaperonin GroS [Bifidobacterium gallicum DSM 20093]
          Length = 90

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 59/90 (65%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           +++V++ ++E +T++G + IPD   EKP    GE++ VG G  D  G+ I  +V +GD +
Sbjct: 4   KIIVKQAEAETQTSSG-LYIPDNAKEKPQ--QGEVLAVGPGRRDDKGERIPVDVKEGDRI 60

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           LF K+ GTE+   +GE+YL++   D++ I+
Sbjct: 61  LFSKYGGTEVHY-EGEDYLIVAARDVLAIL 89


>gi|163753924|ref|ZP_02161047.1| 10 kDa chaperonin [Kordia algicida OT-1]
 gi|161326138|gb|EDP97464.1| 10 kDa chaperonin [Kordia algicida OT-1]
          Length = 92

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (62%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   RV++  L +E KTA+G + IPD+  EK     G ++ VG+G  D      EP  
Sbjct: 6   IKPLADRVLIAPLPAETKTASG-LYIPDSAQEK--QQRGTVVAVGSGKKD------EPLT 56

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL+GK+SGTEIK  +G +Y++M+E DI+ I+
Sbjct: 57  VKVGDTVLYGKFSGTEIKF-EGADYIIMREDDILAII 92


>gi|189011864|emb|CAQ30455.1| heat shock protein [Helicobacter pylori]
          Length = 117

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V  +S +  +  V
Sbjct: 3   FQPLGERVLVERLEEESKTSSG-IIIPDNAKEKP------LMGVIKAVSHRSSEGCKC-V 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD++ FGK+ G EI L DG EY+V++  DI+GIV
Sbjct: 55  KEGDVIAFGKYKGAEIVL-DGTEYMVLELEDILGIV 89


>gi|328958085|ref|YP_004375471.1| co-chaperonin GroES [Carnobacterium sp. 17-4]
 gi|328674409|gb|AEB30455.1| co-chaperonin GroES [Carnobacterium sp. 17-4]
          Length = 94

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++   + E KT +G I++P +  EKP   +G ++ VG G + ++G  +   V
Sbjct: 2   LKPLGDRVIIEVAKEEEKTISG-IVLPGSAQEKPQ--TGSVIAVGEGRVLENGSTLALSV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VLF K++GTE+K  DG+EYLV++E DI+ ++
Sbjct: 59  KVGDTVLFEKYAGTEVKY-DGKEYLVVKEHDIVAVI 93


>gi|51090748|dbj|BAD35228.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group]
 gi|125596360|gb|EAZ36140.1| hypothetical protein OsJ_20450 [Oryza sativa Japonica Group]
 gi|215737485|dbj|BAG96615.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215769443|dbj|BAH01672.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 252

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KTA G +++ +T  EKPS   G ++ VG G +D  GK     V
Sbjct: 159 MKPLNDRVLIKVAEAEDKTA-GGLILTETTKEKPSI--GTVVAVGPGPLDDEGKRQPLSV 215

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  V++ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 216 SAGSTVMYSKYAGSEFKGADGTNYIVLRVSDVMAVL 251



 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+   +E KT  G IL+P T   KP    GE++ VG G      KV E  +
Sbjct: 61  LKPLGDRVLVKLGAAEEKT-VGGILLPSTAQSKPQG--GEVVAVGEGRTIGDKKV-EVSL 116

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             G  V++ K++GTE++ ND  ++L+++E DI+G++
Sbjct: 117 QIGAEVVYSKYAGTEVQFND-TKHLILKEDDIIGVL 151


>gi|331082493|ref|ZP_08331618.1| chaperonin [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330400471|gb|EGG80101.1| chaperonin [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 94

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 68/97 (70%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           L P   RVV+++L +E  T +G I++P    EKP  +  E++ VG  G++D  GK ++ E
Sbjct: 3   LVPLGDRVVLKQLVAEETTKSG-IVLPGQAQEKPQQA--EVVAVGPGGIVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V+ GD V++ K++GTE+KL DGEEY++++++DI+ +V
Sbjct: 58  VAAGDQVIYSKYAGTEVKL-DGEEYIIVKQNDILAVV 93


>gi|281424225|ref|ZP_06255138.1| chaperonin GroS [Prevotella oris F0302]
 gi|281401494|gb|EFB32325.1| chaperonin GroS [Prevotella oris F0302]
          Length = 89

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E K   G I+IPDT  EKP    G+++ VG G  D++  + E   
Sbjct: 3   IKPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKVIAVGQGTKDEAMVLKE--- 55

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D+VL+GK++GTE++  +GE+YL+M++SD++ +V
Sbjct: 56  --NDVVLYGKYAGTELEY-EGEKYLIMRQSDVLAVV 88


>gi|317010293|gb|ADU84040.1| co-chaperonin GroES [Helicobacter pylori SouthAfrica7]
          Length = 118

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDILGIV 89


>gi|317013435|gb|ADU80871.1| co-chaperonin GroES [Helicobacter pylori Gambia94/24]
          Length = 118

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDILGIV 89


>gi|51090752|dbj|BAD35232.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group]
 gi|51091814|dbj|BAD36628.1| putative chaperonin 21 precursor [Oryza sativa Japonica Group]
          Length = 216

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++  ++E KTA G +++ +T  EKPS   G ++ VG G +D  GK     V
Sbjct: 123 MKPLNDRVLIKVAEAEDKTA-GGLILTETTKEKPSI--GTVVAVGPGPLDDEGKRQPLSV 179

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  V++ K++G+E K  DG  Y+V++ SD+M ++
Sbjct: 180 SAGSTVMYSKYAGSEFKGADGTNYIVLRVSDVMAVL 215



 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 5/92 (5%)

Query: 13  RGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGD 72
           R RV+V+   +E KT  G IL+P T   KP    GE++ VG G      KV E  +  G 
Sbjct: 29  RDRVLVKLGAAEEKTV-GGILLPSTAQSKPQG--GEVVAVGEGRTIGDKKV-EVSLQIGA 84

Query: 73  IVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V++ K++GTE++ ND  ++L+++E DI+G++
Sbjct: 85  EVVYSKYAGTEVQFND-TKHLILKEDDIIGVL 115


>gi|295107979|emb|CBL21932.1| Co-chaperonin GroES (HSP10) [Ruminococcus obeum A2-162]
          Length = 94

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 68/96 (70%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P   RVV+++L++E  T +G I++P    EKP  +  E++ VG G + + GK ++ EV
Sbjct: 3   LVPLGDRVVLKQLEAEETTKSG-IVLPGQAQEKPQQA--EVIAVGPGGVVE-GKEVKMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + G+ V++ K++GTE+KL DGEEY+++++SDI+ IV
Sbjct: 59  AVGNKVIYSKYAGTEVKL-DGEEYIIVKQSDILAIV 93


>gi|302333677|gb|ADL23870.1| co-chaperonin GroES [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 94

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (62%), Gaps = 4/97 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++ + + E  T +G I++ D+  EK  ++ G I+ VG G +   G  + PEV
Sbjct: 2   LKPIGNRVIIEKKEQEQTTKSG-IVLTDSAKEK--SNEGVIVAVGTGRLLNDGTRVTPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
            +GD V+F +++GTE+K  D E YLV+ E DI+ ++V
Sbjct: 59  KEGDRVVFQQYAGTEVK-RDNETYLVLNEEDILAVIV 94


>gi|210134210|ref|YP_002300649.1| co-chaperonin GroES [Helicobacter pylori P12]
 gi|226701773|sp|B6JPA8|CH10_HELP2 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|51035733|emb|CAH17474.1| heat shock protein [Helicobacter pylori]
 gi|210132178|gb|ACJ07169.1| cochaperone [Helicobacter pylori P12]
          Length = 118

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDILGIV 89


>gi|303237286|ref|ZP_07323856.1| chaperonin GroS [Prevotella disiens FB035-09AN]
 gi|302482673|gb|EFL45698.1| chaperonin GroS [Prevotella disiens FB035-09AN]
          Length = 89

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++  +++E K   G I+IPDT  EKP    G+++ VG G  D+     +  +
Sbjct: 3   IKPLADRVLILPIEAEQKV--GGIIIPDTAKEKPQ--RGKVVAVGNGTKDE-----DMIL 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V +GK++GTEI+ NDGE+YL+M++SD++ +V
Sbjct: 54  KVGDQVFYGKYAGTEIE-NDGEKYLMMRQSDVLAVV 88


>gi|227502734|ref|ZP_03932783.1| co-chaperonin GroES [Corynebacterium accolens ATCC 49725]
 gi|306835315|ref|ZP_07468341.1| chaperone GroES [Corynebacterium accolens ATCC 49726]
 gi|227076464|gb|EEI14427.1| co-chaperonin GroES [Corynebacterium accolens ATCC 49725]
 gi|304568794|gb|EFM44333.1| chaperone GroES [Corynebacterium accolens ATCC 49726]
          Length = 97

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  +     I  +V
Sbjct: 4   IKPLEDRVLVQIVEAESTTASG-LVIPDSAKEKPQEAT--VIAVGPGRWEDDDDRIPMDV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD V+F ++ GTE+K  DGEEYL++ + DI+ I+
Sbjct: 61  KEGDTVVFSRYGGTELKY-DGEEYLLLSQRDILAII 95


>gi|291532954|emb|CBL06067.1| Co-chaperonin GroES (HSP10) [Megamonas hypermegale ART12/1]
          Length = 93

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 64/96 (66%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++  + +IKTA+G I++PDT  EKP    G ++ V  G   + GK +  +V
Sbjct: 2   IKPLGDRVVIKVSEGDIKTASG-IVLPDTAKEKPQ--EGTVVAVSEGKYVE-GKKVALDV 57

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V+F K++GT++K  DG +YL++++SDI+ +V
Sbjct: 58  KVGDKVIFSKYAGTDVKF-DGTDYLIVRDSDILAVV 92


>gi|257783993|ref|YP_003179210.1| chaperonin Cpn10 [Atopobium parvulum DSM 20469]
 gi|257472500|gb|ACV50619.1| chaperonin Cpn10 [Atopobium parvulum DSM 20469]
          Length = 96

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV+V+    E KT++G + I     E P    GE++ VG G +DQ+G  I  +V
Sbjct: 3   LKPLGDRVLVKPAPKEEKTSSG-LYIASAAQELPQ--RGEVLAVGTGKLDQNGNRIALDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD V +GK+ GTE+K+ DGEE L+++  DI+ I+
Sbjct: 60  KVGDQVFYGKFGGTEVKV-DGEELLLLRADDILAIL 94


>gi|300779765|ref|ZP_07089621.1| chaperone GroES [Corynebacterium genitalium ATCC 33030]
 gi|300533875|gb|EFK54934.1| chaperone GroES [Corynebacterium genitalium ATCC 33030]
          Length = 124

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 64/97 (65%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP-E 67
           ++P   +++V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  D  G+   P +
Sbjct: 30  IKPLEDKILVQIVEAETTTASG-LVIPDSAQEKPQEAT--VIAVGPGRWDDEGEHRIPVD 86

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V +GD V+F K+ GTE+K  DGEEYL++   D++ +V
Sbjct: 87  VKEGDTVIFSKYGGTELKY-DGEEYLLLSARDLLAVV 122


>gi|332294903|ref|YP_004436826.1| 10 kDa chaperonin [Thermodesulfobium narugense DSM 14796]
 gi|332178006|gb|AEE13695.1| 10 kDa chaperonin [Thermodesulfobium narugense DSM 14796]
          Length = 95

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 4/95 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   R++V  +++E KT +G I++PDT  EKP    G ++ VG G +  +G  +  EV
Sbjct: 3   LKPLGDRIIVEPVEAEEKTVSG-IVLPDTAKEKPQ--EGIVVAVGPGRILDNGTRVPLEV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103
             GD V+F K+ GTEIK+N  ++YL++ E DI  I
Sbjct: 60  KVGDRVVFAKYGGTEIKINS-KDYLILSERDIYAI 93


>gi|303242494|ref|ZP_07328974.1| Chaperonin Cpn10 [Acetivibrio cellulolyticus CD2]
 gi|302589962|gb|EFL59730.1| Chaperonin Cpn10 [Acetivibrio cellulolyticus CD2]
          Length = 94

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           L+P   RVVV+ ++SE  T +G I++P +  EKP  +  E++ VG G V+D  GK I+ E
Sbjct: 3   LKPLADRVVVKMVESEETTKSG-IVLPGSAKEKPQVA--EVVAVGPGTVVD--GKEIKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V+  K+SGTE+K  DG+EY ++++ DI+ +V
Sbjct: 58  VKVGDKVIMSKYSGTEVKF-DGQEYTILKQGDILAVV 93


>gi|326494312|dbj|BAJ90425.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326511329|dbj|BAJ87678.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326525713|dbj|BAJ88903.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326526319|dbj|BAJ97176.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 249

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA G +L+ ++V EKPS   G ++ VG G +D+ GK I   V
Sbjct: 156 MKPLSDRVLIEVAVAEDKTA-GGLLLTNSVQEKPSV--GTVVAVGPGHLDEEGKRIPLPV 212

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G E K  DG  Y+V++  D+M I+
Sbjct: 213 STGSSVLYSKYAGAEFKGVDGTNYIVLRVPDLMAIL 248



 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 61/104 (58%), Gaps = 5/104 (4%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      ++P   RV+++   +E KT TG IL+P T   KP   SGE++ VG G     
Sbjct: 50  VVAPKYTTVKPLADRVLLKTKTAEQKT-TGGILLPSTAQSKP--QSGEVVAVGEGRTIGD 106

Query: 61  GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            KV E  +  G  V++ K++G E++LND   +L+++E DI+GI+
Sbjct: 107 SKV-EVGIKVGAQVVYSKYAGMEVELND-SNHLILKEDDIIGIL 148


>gi|296119275|ref|ZP_06837843.1| chaperonin GroS [Corynebacterium ammoniagenes DSM 20306]
 gi|295967667|gb|EFG80924.1| chaperonin GroS [Corynebacterium ammoniagenes DSM 20306]
          Length = 97

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 64/96 (66%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   +V+V+ +++E  TA+G ++IPD+  EKP  ++  ++ VG G  +  G++    V
Sbjct: 4   IKPLEDKVLVQIVEAETTTASG-LVIPDSAKEKPQEAT--VVAVGPGRANDKGELTPVGV 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           ++GD V+F K+ GTE+K  DGEE+L++   D++ ++
Sbjct: 61  NEGDTVIFSKYGGTELKY-DGEEFLLLSARDLLAVI 95


>gi|325269109|ref|ZP_08135729.1| chaperone GroES [Prevotella multiformis DSM 16608]
 gi|324988496|gb|EGC20459.1| chaperone GroES [Prevotella multiformis DSM 16608]
          Length = 89

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 10/96 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V   Q+E K   G I+IPDT  EKP    G+++  G G  D++  +     
Sbjct: 3   IKPLADRVLVLPAQAEEKV--GGIIIPDTAKEKPQ--RGKVVAAGNGTKDEAMVL----- 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++GTEI+ N+GE+YL+M++SD++ ++
Sbjct: 54  KAGDEVLYGKYAGTEIE-NEGEKYLMMRQSDVLAVI 88


>gi|313157597|gb|EFR57013.1| chaperonin GroS [Alistipes sp. HGB5]
          Length = 89

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA G ++IPDT  EKP A  G+++  G G  +     ++ EV
Sbjct: 3   VKPLSDRVLILPNPAEEKTA-GGLIIPDTAKEKPLA--GKVVAAGPGTSE-----VKMEV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++G EI++ DG +YL+M++SDI+ I+
Sbjct: 55  KAGDQVLYGKYAGQEIQI-DGVDYLIMKQSDILAII 89


>gi|163785343|ref|ZP_02179982.1| chaperonin Cpn10 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879388|gb|EDP73253.1| chaperonin Cpn10 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 97

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQS-EIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67
           L+P   RVVV+  +  E KTA+G I+IPD+  EKPS   GE++ VG G + ++G++   +
Sbjct: 4   LKPLYDRVVVKPTEEKEEKTASG-IIIPDSAKEKPS--EGEVVAVGEGRLLENGQIAPLK 60

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD V++ K++G E  + DG+E +V++E DI+ ++
Sbjct: 61  VKVGDKVVYSKYAGNEFVI-DGQELIVLREDDILAVI 96


>gi|118361262|ref|XP_001013861.1| chaperonin, 10 kDa family protein [Tetrahymena thermophila]
 gi|89295628|gb|EAR93616.1| chaperonin, 10 kDa family protein [Tetrahymena thermophila SB210]
          Length = 101

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 60/98 (61%), Gaps = 9/98 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPS--ASSGEIMWVGAGVMDQSGKVIEP 66
           L PT  R++V++ ++E KT TG IL      + P+   + GEI+  G G  D +GKVI  
Sbjct: 8   LVPTFNRILVKKFEAETKTRTGIIL------QDPADKTAYGEIVSAGPGNFDNNGKVIPL 61

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V  GDIV+   + G++I L DG E+ V +++DI+G++
Sbjct: 62  GVKVGDIVVLPDYGGSKINLKDG-EFFVYRDTDILGVL 98


>gi|91216875|ref|ZP_01253839.1| co-chaperonin GroES [Psychroflexus torquis ATCC 700755]
 gi|91185036|gb|EAS71415.1| co-chaperonin GroES [Psychroflexus torquis ATCC 700755]
          Length = 91

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 60/96 (62%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA+G I+IP+T  EKP    G+++ VG G    +  V     
Sbjct: 5   IKPLADRVLIEPQAAETKTASG-IIIPETAKEKPQ--RGKVVAVGNGKKKHTMTV----- 56

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIVL+GK+SGTE+K  +  +YL+M+E DI+ IV
Sbjct: 57  KVGDIVLYGKFSGTELKYEEN-DYLIMREDDILAIV 91


>gi|1942632|pdb|1LEP|A Chain A, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942633|pdb|1LEP|B Chain B, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942634|pdb|1LEP|C Chain C, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942635|pdb|1LEP|D Chain D, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942636|pdb|1LEP|E Chain E, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942637|pdb|1LEP|F Chain F, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
 gi|1942638|pdb|1LEP|G Chain G, Three-Dimensional Structure Of The Immunodominant Heat-
           Shock Protein Chaperonin-10 Of Mycobacterium Leprae
          Length = 99

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  T +G ++IP+   EKP    G ++ VG G  D+ G K I  +
Sbjct: 5   IKPLEDKILVQAGEAETMTPSG-LVIPENAKEKPQ--EGTVVAVGPGRWDEDGAKRIPVD 61

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GDIV++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 62  VSEGDIVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 97


>gi|15827109|ref|NP_301372.1| co-chaperonin GroES [Mycobacterium leprae TN]
 gi|221229587|ref|YP_002503003.1| co-chaperonin GroES [Mycobacterium leprae Br4923]
 gi|116199|sp|P24301|CH10_MYCLE RecName: Full=10 kDa chaperonin; AltName: Full=10 kDa antigen;
           AltName: Full=GroES protein; AltName: Full=Protein Cpn10
 gi|254813851|sp|B8ZUD1|CH10_MYCLB RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|467129|gb|AAA17311.1| chpA [Mycobacterium leprae]
 gi|6624972|emb|CAB63917.1| groES [Mycobacterium leprae]
 gi|13092657|emb|CAC29888.1| 10 kD chaperonin [Mycobacterium leprae]
 gi|219932694|emb|CAR70473.1| 10 kD chaperonin [Mycobacterium leprae Br4923]
          Length = 100

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPE 67
           ++P   +++V+  ++E  T +G ++IP+   EKP    G ++ VG G  D+ G K I  +
Sbjct: 6   IKPLEDKILVQAGEAETMTPSG-LVIPENAKEKPQ--EGTVVAVGPGRWDEDGAKRIPVD 62

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           VS+GDIV++ K+ GTEIK N GEEYL++   D++ +V
Sbjct: 63  VSEGDIVIYSKYGGTEIKYN-GEEYLILSARDVLAVV 98


>gi|150002943|ref|YP_001297687.1| co-chaperonin GroES [Bacteroides vulgatus ATCC 8482]
 gi|212690610|ref|ZP_03298738.1| hypothetical protein BACDOR_00096 [Bacteroides dorei DSM 17855]
 gi|237709653|ref|ZP_04540134.1| predicted protein [Bacteroides sp. 9_1_42FAA]
 gi|237725193|ref|ZP_04555674.1| co-chaperonin GroES [Bacteroides sp. D4]
 gi|254884687|ref|ZP_05257397.1| co-chaperonin GroES [Bacteroides sp. 4_3_47FAA]
 gi|265754285|ref|ZP_06089474.1| chaperonin GroS [Bacteroides sp. 3_1_33FAA]
 gi|294776603|ref|ZP_06742072.1| chaperonin GroS [Bacteroides vulgatus PC510]
 gi|319642356|ref|ZP_07997011.1| chaperonin GroS [Bacteroides sp. 3_1_40A]
 gi|166233982|sp|A6KXA1|CH10_BACV8 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|73672450|gb|AAZ80413.1| small heat shock protein 10 kDa [Bacteroides vulgatus]
 gi|149931367|gb|ABR38065.1| 10 kDa chaperonin [Bacteroides vulgatus ATCC 8482]
 gi|212666856|gb|EEB27428.1| hypothetical protein BACDOR_00096 [Bacteroides dorei DSM 17855]
 gi|229436459|gb|EEO46536.1| co-chaperonin GroES [Bacteroides dorei 5_1_36/D4]
 gi|229456289|gb|EEO62010.1| predicted protein [Bacteroides sp. 9_1_42FAA]
 gi|254837480|gb|EET17789.1| co-chaperonin GroES [Bacteroides sp. 4_3_47FAA]
 gi|263234994|gb|EEZ20549.1| chaperonin GroS [Bacteroides sp. 3_1_33FAA]
 gi|294449518|gb|EFG18049.1| chaperonin GroS [Bacteroides vulgatus PC510]
 gi|317386016|gb|EFV66940.1| chaperonin GroS [Bacteroides sp. 3_1_40A]
          Length = 90

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 63/96 (65%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KT  G I+IPDT  EKP    GE++ +G G  D+     E  +
Sbjct: 3   IKPLADRVLILPAPAEEKT-IGGIIIPDTAKEKPL--QGEVVAIGNGTKDE-----EMVL 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE++ +DG++YL+M++SD++ ++
Sbjct: 55  HVGDQVLYGKYSGTELE-HDGKKYLIMRQSDVLAVL 89


>gi|224418146|ref|ZP_03656152.1| co-chaperonin GroES [Helicobacter canadensis MIT 98-5491]
 gi|253827473|ref|ZP_04870358.1| co-chaperonin GroES [Helicobacter canadensis MIT 98-5491]
 gi|313141681|ref|ZP_07803874.1| heat shock protein GroES [Helicobacter canadensis MIT 98-5491]
 gi|253510879|gb|EES89538.1| co-chaperonin GroES [Helicobacter canadensis MIT 98-5491]
 gi|313130712|gb|EFR48329.1| heat shock protein GroES [Helicobacter canadensis MIT 98-5491]
          Length = 86

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 59/96 (61%), Gaps = 13/96 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V RL+ + KTA+G I+IPD   EKP    G +  +G+ V          EV
Sbjct: 3   FKPLGERVLVERLEEDTKTASG-IIIPDNAKEKPLM--GVVKAIGSEV---------KEV 50

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
              D V+FGK+SGTE+KL DG EYL+++  D++G++
Sbjct: 51  KVNDKVVFGKYSGTEVKL-DGTEYLILKLEDVLGVI 85


>gi|126660967|ref|ZP_01732055.1| co-chaperonin GroES [Cyanothece sp. CCY0110]
 gi|172036258|ref|YP_001802759.1| co-chaperonin GroES [Cyanothece sp. ATCC 51142]
 gi|254813837|sp|B1WWG9|CH10_CYAA5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|126617745|gb|EAZ88526.1| co-chaperonin GroES [Cyanothece sp. CCY0110]
 gi|171697712|gb|ACB50693.1| chaperonin [Cyanothece sp. ATCC 51142]
          Length = 103

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 60/96 (62%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   R+ V+   +E KTA G IL+PD   EKP    GE++ VG G  +  G   E +V
Sbjct: 11  VKPLGDRIFVKVSPAEEKTA-GGILLPDNAQEKPQI--GEVVAVGPGKRNDDGSRSELDV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT++KL+ GE+Y+++ E DI+  V
Sbjct: 68  KVGDKVLYSKYAGTDVKLS-GEDYVLLSEKDILASV 102


>gi|224068518|ref|XP_002326137.1| predicted protein [Populus trichocarpa]
 gi|118488687|gb|ABK96154.1| unknown [Populus trichocarpa]
 gi|222833330|gb|EEE71807.1| predicted protein [Populus trichocarpa]
          Length = 256

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV ++  ++E KTA G +L+ +   EKPS   G ++ VG G +D+ G      V
Sbjct: 163 LKPLNDRVFIKLAEAEEKTA-GGLLLTEATKEKPSI--GTVIAVGPGPLDEEGNRKALPV 219

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G + K +DG  Y+ ++ SD+M I+
Sbjct: 220 SPGSTVLYSKYAGNDFKGSDGANYIALKASDVMAIL 255



 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 7/105 (6%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      ++P   RV+V+    E K+  G IL+P +   KP A  GE++ VG G     
Sbjct: 57  VVAPKYTSIKPLGDRVLVKIKTVEEKS-EGGILLPSSAQTKPQA--GEVVAVGEG--KSI 111

Query: 61  GKV-IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK  ++  V  G  V++ K++GTE++  DG  +L+++E DI+GI+
Sbjct: 112 GKTKLDISVKTGARVVYSKYAGTEVEF-DGSSHLILKEDDIIGIL 155


>gi|220927847|ref|YP_002504756.1| co-chaperonin GroES [Clostridium cellulolyticum H10]
 gi|254813835|sp|B8I5V9|CH10_CLOCE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|219998175|gb|ACL74776.1| chaperonin Cpn10 [Clostridium cellulolyticum H10]
          Length = 94

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAG-VMDQSGKVIEPE 67
           ++P   RVV++ L+SE  T +G I++P +  EKP  +  EI+ VG G V+D  GK ++ E
Sbjct: 3   IKPLGDRVVIKMLESEETTKSG-IVLPGSAKEKPQVA--EIVAVGPGTVVD--GKEVKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VL  K+SGTE+K  DG+EY ++++ DI+ IV
Sbjct: 58  VKVGDRVLTSKYSGTEVKF-DGQEYTILKQGDILAIV 93


>gi|315638666|ref|ZP_07893840.1| chaperone GroES [Campylobacter upsaliensis JV21]
 gi|315481290|gb|EFU71920.1| chaperone GroES [Campylobacter upsaliensis JV21]
          Length = 86

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 57/96 (59%), Gaps = 13/96 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V+R++ E KT    I+IPD   EKP    GE++ V   V D         +
Sbjct: 3   FQPLGKRVLVKRVE-ETKTTASGIIIPDNAKEKPLM--GEVVAVSKEVSD---------I 50

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K+ GTE+KLNDG EYLV+   D++GI+
Sbjct: 51  ASGDKIVFAKYGGTEVKLNDG-EYLVLNLDDVLGIL 85


>gi|227510672|ref|ZP_03940721.1| chaperone GroES [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227513688|ref|ZP_03943737.1| chaperone GroES [Lactobacillus buchneri ATCC 11577]
 gi|227522523|ref|ZP_03952572.1| chaperone GroES [Lactobacillus hilgardii ATCC 8290]
 gi|227083007|gb|EEI18319.1| chaperone GroES [Lactobacillus buchneri ATCC 11577]
 gi|227090345|gb|EEI25657.1| chaperone GroES [Lactobacillus hilgardii ATCC 8290]
 gi|227189793|gb|EEI69860.1| chaperone GroES [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 106

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query: 7   NYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEP 66
           N L+P   RV++ R + E K   G I++ D   +KP   +G I+ VG G +  +G+ + P
Sbjct: 12  NVLKPLGDRVIIEREEEEEKN-VGGIVLADNAKKKPQ--TGTIVAVGEGRVLDNGQTVAP 68

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V KGD V+F K++GTEI+ ND + YLV+ E DI+ IV
Sbjct: 69  VVKKGDKVMFDKYAGTEIEDND-KSYLVLHEKDIVAIV 105


>gi|153953100|ref|YP_001393865.1| co-chaperonin GroES [Clostridium kluyveri DSM 555]
 gi|219853751|ref|YP_002470873.1| hypothetical protein CKR_0408 [Clostridium kluyveri NBRC 12016]
 gi|189044098|sp|A5N5D6|CH10_CLOK5 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|254813836|sp|B9DYY4|CH10_CLOK1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|146345981|gb|EDK32517.1| GroS [Clostridium kluyveri DSM 555]
 gi|219567475|dbj|BAH05459.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 94

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 66/97 (68%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           +RP   RVV++++++E  T +G I++P +  EKP  +  EI+ VG  GV+D  GK I+ E
Sbjct: 3   IRPLGDRVVIKKIEAEETTKSG-IVLPGSAKEKPQEA--EIVAVGPGGVID--GKEIKME 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V  GD VLF K++G E+K+ DG EY ++++ DI+ I+
Sbjct: 58  VKVGDRVLFSKYAGNEVKI-DGVEYTILRQDDILAII 93


>gi|166367348|ref|YP_001659621.1| co-chaperonin GroES [Microcystis aeruginosa NIES-843]
 gi|189044109|sp|B0JUI1|CH10_MICAN RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|166089721|dbj|BAG04429.1| 10 kDa chaperonin [Microcystis aeruginosa NIES-843]
          Length = 103

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 57/96 (59%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   SE KTA G I +PD   EKP    GE++ VG G  +  G     EV
Sbjct: 11  VKPLGDRVFVKVSPSEEKTA-GGIFLPDAAKEKPQI--GEVVAVGPGKRNDDGSRTPVEV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GT+IKL  GEE++++ E DI+  V
Sbjct: 68  GVGDKVLYSKYAGTDIKLG-GEEFVLLSEKDILAAV 102


>gi|18311272|ref|NP_563206.1| co-chaperonin GroES [Clostridium perfringens str. 13]
 gi|110800041|ref|YP_696964.1| co-chaperonin GroES [Clostridium perfringens ATCC 13124]
 gi|168205120|ref|ZP_02631125.1| chaperonin, 10 kDa [Clostridium perfringens E str. JGS1987]
 gi|168211639|ref|ZP_02637264.1| chaperonin, 10 kDa [Clostridium perfringens B str. ATCC 3626]
 gi|168213201|ref|ZP_02638826.1| chaperonin, 10 kDa [Clostridium perfringens CPE str. F4969]
 gi|168216745|ref|ZP_02642370.1| chaperonin, 10 kDa [Clostridium perfringens NCTC 8239]
 gi|169347059|ref|ZP_02866001.1| chaperonin, 10 kDa [Clostridium perfringens C str. JGS1495]
 gi|182625541|ref|ZP_02953312.1| chaperonin, 10 kDa [Clostridium perfringens D str. JGS1721]
 gi|116193|sp|P26822|CH10_CLOPE RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|123049619|sp|Q0TN26|CH10_CLOP1 RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|40571|emb|CAA44696.1| HSP10 chaperonin [Clostridium perfringens]
 gi|18145955|dbj|BAB81996.1| GroES protein [Clostridium perfringens str. 13]
 gi|110674688|gb|ABG83675.1| chaperonin, 10 kDa [Clostridium perfringens ATCC 13124]
 gi|169296742|gb|EDS78871.1| chaperonin, 10 kDa [Clostridium perfringens C str. JGS1495]
 gi|170663235|gb|EDT15918.1| chaperonin, 10 kDa [Clostridium perfringens E str. JGS1987]
 gi|170710384|gb|EDT22566.1| chaperonin, 10 kDa [Clostridium perfringens B str. ATCC 3626]
 gi|170715213|gb|EDT27395.1| chaperonin, 10 kDa [Clostridium perfringens CPE str. F4969]
 gi|177909229|gb|EDT71694.1| chaperonin, 10 kDa [Clostridium perfringens D str. JGS1721]
 gi|182381190|gb|EDT78669.1| chaperonin, 10 kDa [Clostridium perfringens NCTC 8239]
          Length = 94

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++RL++E  T +G I++  T  E+P  +  E++ VG G +   GK  E EV
Sbjct: 3   IKPLGDRVVIKRLEAEETTKSG-IIVTGTAKERPQEA--EVVAVGPGAI-VDGKRTEMEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+ K++GTE+K  +GEEY ++++ DI+ IV
Sbjct: 59  KIGDKVLYSKYAGTEVKF-EGEEYTILRQDDILAIV 93


>gi|108805099|ref|YP_645036.1| chaperonin Cpn10 [Rubrobacter xylanophilus DSM 9941]
 gi|123367993|sp|Q1ATQ4|CH10_RUBXD RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|108766342|gb|ABG05224.1| chaperonin Cpn10 [Rubrobacter xylanophilus DSM 9941]
          Length = 88

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 62/98 (63%), Gaps = 12/98 (12%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   R +V+ ++ E KTA+G I++PDT  EKP   + E++ VG           + +V
Sbjct: 3   FKPLGERALVKLVEREEKTASG-IVLPDTAKEKPQ--TAEVIAVGDSE--------DIKV 51

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD+V+F K+SGTEI LN G++Y+++   DI+G+V E
Sbjct: 52  KEGDVVVFAKYSGTEISLN-GDDYMILDADDILGVVEE 88


>gi|118489858|gb|ABK96728.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 256

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV ++  ++E KTA G +L+ +   EKPS   G ++ VG G +D+ G      V
Sbjct: 163 LKPLNDRVFIKIAEAEEKTA-GGLLLTEATKEKPSI--GTVIAVGPGPLDEEGNRKALSV 219

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S G  VL+ K++G + K +DG  Y+ ++ SD+M I+
Sbjct: 220 SPGSTVLYSKYAGNDFKGSDGANYIALKASDVMAIL 255



 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 61/105 (58%), Gaps = 7/105 (6%)

Query: 1   MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60
           +V      ++P   RV+V+    E K+  G IL+P +   KP A  GE++ VG G    +
Sbjct: 57  VVAPKYTSIKPLGDRVLVKIKTVEEKS-EGGILLPSSAQTKPQA--GEVVAVGEG--KST 111

Query: 61  GKV-IEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           GK  ++  V  G  V++ K++GTE++  DG  +L+++E DI+GI+
Sbjct: 112 GKTKLDISVKTGARVVYSKYAGTEVEF-DGSSHLILKEDDIIGIL 155


>gi|254445185|ref|ZP_05058661.1| chaperonin GroS [Verrucomicrobiae bacterium DG1235]
 gi|198259493|gb|EDY83801.1| chaperonin GroS [Verrucomicrobiae bacterium DG1235]
          Length = 96

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+++ ++ E +   G I IPD+  EKP  +  E++ +G G  D  GK +   V
Sbjct: 3   VKPLGDRVLIKHIE-EDEQVRGGIYIPDSAKEKPQEA--EVIALGTGAKDSDGKAVAFNV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL  K+ GTE+K+ DG  YL+++E DI+GI+
Sbjct: 60  KVGDRVLTSKYGGTEVKV-DGVTYLLVREDDILGII 94


>gi|62947196|gb|AAY22594.1| 10 kDa chaperonin [Bacteroides vulgatus]
          Length = 90

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KT  G IL PDT  EKP    GE++ +G G  D+     E  +
Sbjct: 3   IKPLADRVLILPAPAEEKT-IGGILFPDTAKEKPL--QGEVVAIGNGTKDE-----EMVL 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTE++ +DG++YL+M++SD++ ++
Sbjct: 55  HVGDQVLYGKYSGTELE-HDGKKYLIMRQSDVLAVL 89


>gi|158337531|ref|YP_001518706.1| chaperonin GroES [Acaryochloris marina MBIC11017]
 gi|158307772|gb|ABW29389.1| chaperonin GroES [Acaryochloris marina MBIC11017]
          Length = 103

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV V+   +E +TA G I++PD   EKP    GEI  VG G     G     +V
Sbjct: 11  VKPLGDRVFVKVSAAEEQTA-GGIILPDAAKEKPQV--GEITAVGPGKRGDDGSRQALDV 67

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +GD VL+ K++GT++KL  GEEY+++ E DI+ IV
Sbjct: 68  KEGDKVLYSKYAGTDVKLG-GEEYVLLSEKDILAIV 102


>gi|23813822|sp|Q9KKF1|CH10_CLODI RecName: Full=10 kDa chaperonin; AltName: Full=GroES protein;
           AltName: Full=Protein Cpn10
 gi|8215673|gb|AAF73983.1|AF080547_1 GroES protein [Clostridium difficile]
          Length = 94

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 70/96 (72%), Gaps = 5/96 (5%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RVV++++++E KTA+G I++P    E+P  +  E++ VG G + + GK I+ E+
Sbjct: 3   IKPFGDRVVIKKVEAEEKTASG-IVLPGAAKEQPQIA--EVVEVGPGGIVE-GKEIKMEL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD V+F K+SGTE+K+ +G+EY ++++SD++ ++
Sbjct: 59  TVGDKVIFQKYSGTEVKI-EGQEYTILRQSDVLAVI 93


>gi|325298984|ref|YP_004258901.1| 10 kDa chaperonin [Bacteroides salanitronis DSM 18170]
 gi|324318537|gb|ADY36428.1| 10 kDa chaperonin [Bacteroides salanitronis DSM 18170]
          Length = 90

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 62/96 (64%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KT  G I+IPDT  EKP    GE++ VG G  D+     +  +
Sbjct: 3   IKPLADRVLILPAPAEEKT-IGGIIIPDTAKEKPL--QGEVVAVGNGTKDE-----DMVL 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK+SGTEI+ +DG +YL+M++SD++ ++
Sbjct: 55  KAGDQVLYGKYSGTEIE-HDGVKYLIMRQSDVLAVL 89


>gi|328944504|ref|ZP_08241965.1| chaperone GroES [Atopobium vaginae DSM 15829]
 gi|327490905|gb|EGF22683.1| chaperone GroES [Atopobium vaginae DSM 15829]
          Length = 106

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 4/102 (3%)

Query: 5   HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVI 64
           H   L+P   RV+V+    E KT++G + I     EKP    GE++ VGAG ++  G+ I
Sbjct: 9   HIMTLKPLADRVLVKPAPKEEKTSSG-LYISSGAQEKPQ--RGEVVAVGAGKLNDKGERI 65

Query: 65  EPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             +V  GD V +GK+ G E+K+ DGE YL+++  DI  I+ E
Sbjct: 66  ALDVKVGDQVYYGKFGGNEVKI-DGETYLLLRSDDIYAILCE 106


>gi|19338966|gb|AAL86899.1|AF479029_1 heat shock protein A subunit [Helicobacter pylori]
          Length = 118

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 3   FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 52

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  D++GIV
Sbjct: 53  CVKEGDVIAFGKYKGTEIVL-DGTEYMVLELEDVLGIV 89


>gi|288926107|ref|ZP_06420035.1| chaperonin GroS [Prevotella buccae D17]
 gi|288337147|gb|EFC75505.1| chaperonin GroS [Prevotella buccae D17]
          Length = 90

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 62/98 (63%), Gaps = 10/98 (10%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV+V    +E K   G I+IPDT  EKP    G+I+  G G  D+     E  +
Sbjct: 3   IKPLADRVLVLPAPAEEKV--GGIIIPDTAKEKPQ--RGKIVATGKGTKDE-----EMLL 53

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GDIVL+GK++GTE++   GE+YL+M++SD++ +V E
Sbjct: 54  KEGDIVLYGKYAGTELEFG-GEKYLMMRQSDVLAVVEE 90


>gi|167754100|ref|ZP_02426227.1| hypothetical protein ALIPUT_02391 [Alistipes putredinis DSM 17216]
 gi|167658725|gb|EDS02855.1| hypothetical protein ALIPUT_02391 [Alistipes putredinis DSM 17216]
          Length = 89

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 62/96 (64%), Gaps = 9/96 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA G ++IPDT  EKP A  G+++ VG G  +     I+ EV
Sbjct: 3   VKPLSDRVLILPNPAEEKTA-GGLIIPDTAKEKPLA--GKVIAVGPGTSE-----IKMEV 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GD VL+GK++G EI + DG +YL+M++ DI+ I+
Sbjct: 55  KVGDQVLYGKYAGQEINV-DGTDYLIMKQQDILAII 89


>gi|309790766|ref|ZP_07685313.1| chaperonin Cpn10 [Oscillochloris trichoides DG6]
 gi|308227185|gb|EFO80866.1| chaperonin Cpn10 [Oscillochloris trichoides DG6]
          Length = 87

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (66%), Gaps = 5/84 (5%)

Query: 22  QSEIKTATGNILIPDTVS-EKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWS 80
           + E KT +G I +PDT S E+P    G I+  G G  D+SGK+I   V  GD V+F K+S
Sbjct: 6   EREEKTRSG-IFLPDTASKERPM--EGTIVAAGEGRRDESGKLIAMSVQVGDKVIFAKYS 62

Query: 81  GTEIKLNDGEEYLVMQESDIMGIV 104
           GTE+K++D  EYL++ E DI+G++
Sbjct: 63  GTEVKIDD-VEYLILAEKDILGVI 85


>gi|154486715|ref|ZP_02028122.1| hypothetical protein BIFADO_00536 [Bifidobacterium adolescentis
           L2-32]
 gi|212716650|ref|ZP_03324778.1| hypothetical protein BIFCAT_01583 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351082|ref|ZP_03742105.1| hypothetical protein BIFPSEUDO_02668 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|154084578|gb|EDN83623.1| hypothetical protein BIFADO_00536 [Bifidobacterium adolescentis
           L2-32]
 gi|212660354|gb|EEB20929.1| hypothetical protein BIFCAT_01583 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158538|gb|EEG71780.1| hypothetical protein BIFPSEUDO_02668 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 90

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 58/90 (64%), Gaps = 4/90 (4%)

Query: 15  RVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIV 74
           +++V++ ++E +TA+G + IPD   EKP    GE++ VG G  + +G+ I  +V  GD V
Sbjct: 4   KIIVKQAEAETQTASG-LFIPDNAKEKPQ--QGEVLAVGPGRRNDAGERIPVDVKVGDKV 60

Query: 75  LFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           L+ K+ GTE+    GE+YL++   DI+ I+
Sbjct: 61  LYSKYGGTEVHYQ-GEDYLIVSARDILAIL 89


>gi|2267597|gb|AAB63591.1| 10 kDa chaperonin [Oryza sativa Indica Group]
          Length = 98

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P+  RV+V +L    K+A G IL+P+T  +    +SG+++ VG G  D+ GK+I   +
Sbjct: 5   LIPSLNRVLVEKLVQPKKSA-GGILLPETSKQ---LNSGKVVAVGPGERDKDGKLIPVAL 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD VL  ++ G E+KL   +EYL+ +E DI+G +V+
Sbjct: 61  KEGDTVLLPEYGGLEVKLAAEKEYLLFREHDILGTLVD 98


>gi|57242680|ref|ZP_00370617.1| chaperonin, 10 kDa [Campylobacter upsaliensis RM3195]
 gi|57016609|gb|EAL53393.1| chaperonin, 10 kDa [Campylobacter upsaliensis RM3195]
          Length = 97

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 57/96 (59%), Gaps = 13/96 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
            +P   RV+V+R++ E KT    I+IPD   EKP    GE++ V   V D         +
Sbjct: 14  FQPLGKRVLVKRVE-ETKTTASGIIIPDNAKEKPLI--GEVVAVSKEVSD---------I 61

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           + GD ++F K+ GTE+KLNDG EYLV+   D++GI+
Sbjct: 62  ASGDKIVFAKYGGTEVKLNDG-EYLVLNLDDVLGIL 96


>gi|110638227|ref|YP_678436.1| co-chaperonin GroES [Cytophaga hutchinsonii ATCC 33406]
 gi|110280908|gb|ABG59094.1| 10 kDa chaperonin [Cytophaga hutchinsonii ATCC 33406]
          Length = 92

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (63%), Gaps = 11/97 (11%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           ++P   RV++    +E KTA+G I+IPDT  EKP    G ++ VG+G  D      EP  
Sbjct: 6   IKPLADRVLIEPAVAESKTASG-IIIPDTAKEKPL--KGIVVAVGSGKKD------EPMT 56

Query: 69  SK-GDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            K GD VL+GK+S TEI + DG++YL+M+ES+I  I+
Sbjct: 57  VKVGDSVLYGKYSSTEISV-DGKDYLIMKESEIYAIL 92


>gi|242371732|ref|ZP_04817306.1| co-chaperonin GroES [Staphylococcus epidermidis M23864:W1]
 gi|242350518|gb|EES42119.1| co-chaperonin GroES [Staphylococcus epidermidis M23864:W1]
          Length = 94

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L+P   RV++ + + E  T +G I++ D+  EK  ++ G I+ VG G +  +G  + PEV
Sbjct: 2   LKPLGNRVIIEKKEQEQTTKSG-IVLTDSAKEK--SNEGVIIAVGQGRLLDNGSRVAPEV 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           S+GD V+F +++GTE+K  D + YLV+ E DI+ ++
Sbjct: 59  SEGDTVVFQQYAGTEVKRGD-DTYLVLNEEDILAVI 93


>gi|323463962|gb|ADX76115.1| chaperonin GroES [Staphylococcus pseudintermedius ED99]
          Length = 95

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           LRP   RVV+ + + E  T +G I++ D+  EK  ++ G I+ VG G +  +G+ ++PE+
Sbjct: 2   LRPLGNRVVIEKKEHEQTTKSG-IVLTDSAKEK--SNEGVIVAVGPGRILDNGERLKPEL 58

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           +KGD V+F +++GTE+K +D +EYLV+ E +++ ++
Sbjct: 59  NKGDRVVFQQYAGTEVKRDD-KEYLVLTEGEVLAVI 93


>gi|302670553|ref|YP_003830513.1| chaperonin GroES [Butyrivibrio proteoclasticus B316]
 gi|302395026|gb|ADL33931.1| chaperonin GroES [Butyrivibrio proteoclasticus B316]
          Length = 94

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 67/97 (69%), Gaps = 7/97 (7%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVG-AGVMDQSGKVIEPE 67
           L P   RVV++ L++E  T +G I++P    EKP  +  E++ VG  G++D  GK ++ +
Sbjct: 3   LEPLADRVVLKALEAEETTKSG-IVLPGAEKEKPQQA--EVIAVGPGGIVD--GKEVKMQ 57

Query: 68  VSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
           V KGD V++ K+SGTE+KL+D E Y++++++DI+ I+
Sbjct: 58  VKKGDNVIYSKYSGTEVKLDD-ETYIIVKQNDILAII 93


>gi|51035635|emb|CAH17425.1| heat shock protein [Helicobacter pylori]
          Length = 128

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 13/98 (13%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE--P 66
            +P   RV+V RL+ E KT++G I+IPD   EKP      +M V   V   S K+ E   
Sbjct: 13  FQPLGERVLVERLEEENKTSSG-IIIPDNAKEKP------LMGVVKAV---SHKISEGCK 62

Query: 67  EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            V +GD++ FGK+ GTEI L DG EY+V++  DI+GIV
Sbjct: 63  CVKEGDVIAFGKYKGTEIVL-DGIEYMVLELEDILGIV 99


>gi|115473665|ref|NP_001060431.1| Os07g0641700 [Oryza sativa Japonica Group]
 gi|33146644|dbj|BAC79974.1| 10 kDa chaperonin [Oryza sativa Japonica Group]
 gi|113611967|dbj|BAF22345.1| Os07g0641700 [Oryza sativa Japonica Group]
 gi|125601258|gb|EAZ40834.1| hypothetical protein OsJ_25311 [Oryza sativa Japonica Group]
 gi|215768579|dbj|BAH00808.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218200107|gb|EEC82534.1| hypothetical protein OsI_27057 [Oryza sativa Indica Group]
          Length = 98

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           L P+  RV+V +L    K+A G IL+P+T  +    +SG+++ VG G  D+ GK+I   +
Sbjct: 5   LIPSLNRVLVEKLVQPKKSA-GGILLPETSKQ---LNSGKVVAVGPGERDKDGKLIPVAL 60

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
            +GD VL  ++ G E+KL   +EYL+ +E DI+G +V+
Sbjct: 61  KEGDTVLLPEYGGLEVKLAAEKEYLLFREHDILGTLVD 98


>gi|327541521|gb|EGF28055.1| Chaperonin Cpn10 [Rhodopirellula baltica WH47]
          Length = 105

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 63/99 (63%), Gaps = 4/99 (4%)

Query: 6   KNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIE 65
           K  L+P   R+VV+R +SE  TA G I++PD+  EKP+   G ++ +G G +   G   +
Sbjct: 10  KIRLQPLGERIVVQREESETTTA-GGIVLPDSAKEKPA--RGTVVALGTGKLLDDGSRAD 66

Query: 66  PEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +++ GD VLF  ++G  ++++D  EYL+M+E D++ ++
Sbjct: 67  FQLAAGDRVLFSSYAGETVEVDD-TEYLLMREDDVLAVI 104


>gi|171741298|ref|ZP_02917105.1| hypothetical protein BIFDEN_00377 [Bifidobacterium dentium ATCC
           27678]
 gi|171276912|gb|EDT44573.1| hypothetical protein BIFDEN_00377 [Bifidobacte