PSIBLAST alignment of GI: 254780848 and protein with PDB id: 1we3

>gi|50514047|pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100
>gi|50514048|pdb|1WE3|P Chain P, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100
 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 70/104 (67%), Gaps = 4/104 (3%)

Query: 2   VGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG 61
             E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++G
Sbjct: 1   AAEVKTVIKPLGDRVVVKRIEEEPKTKGG-IVLPDTAKEKP--QKGKVIAVGTGRVLENG 57

Query: 62  KVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++ 
Sbjct: 58  QRVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVLQ 100