RPSBLAST alignment for GI: 254780848 and conserved domain: PRK14533

>gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional. Length = 91
 Score = 47.9 bits (114), Expect = 6e-07
 Identities = 31/98 (31%), Positives = 60/98 (61%), Gaps = 9/98 (9%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           + P   R++++ ++ E KT  G I++PD+  EKP  +  E++ VG     +     + ++
Sbjct: 3   VIPLGERLLIKPIKEEKKTE-GGIVLPDSAKEKPMKA--EVVAVG-----KLDDEEDFDI 54

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106
             GD V+F K++GTEIK++D E+Y+++  +DI+  + E
Sbjct: 55  KVGDKVIFSKYAGTEIKIDD-EDYIIIDVNDILAKIEE 91