RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] (111 letters) >gnl|CDD|178988 PRK00364, groES, co-chaperonin GroES; Reviewed. Length = 95 Score = 108 bits (272), Expect = 4e-25 Identities = 48/96 (50%), Positives = 69/96 (71%), Gaps = 4/96 (4%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68 L+P RV+V+RL+ E KTA G I++PD+ EKP GE++ VG G +G+ + +V Sbjct: 3 LKPLGDRVLVKRLEEEEKTAGG-IVLPDSAKEKPQ--EGEVVAVGPGRRLDNGERVPLDV 59 Query: 69 SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104 GD VLFGK++GTE+K+ DGEEYL+++ESDI+ IV Sbjct: 60 KVGDKVLFGKYAGTEVKI-DGEEYLILRESDILAIV 94 >gnl|CDD|173604 PTZ00414, PTZ00414, 10 kDa heat shock protein; Provisional. Length = 100 Score = 49.2 bits (117), Expect = 2e-07 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 9/96 (9%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68 L+P RV+V+R + +T G +LIP+ V+ K + G ++ V A D + P V Sbjct: 12 LQPLGQRVLVKRTLAAKQTKAG-VLIPEQVAGK--VNEGTVVAVAAATKDWT-----PTV 63 Query: 69 SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104 GD VL ++ G+ +K+ +GEE+ + E ++G++ Sbjct: 64 KVGDTVLLPEFGGSSVKV-EGEEFFLYNEDSLLGVL 98 >gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional. Length = 91 Score = 47.9 bits (114), Expect = 6e-07 Identities = 31/98 (31%), Positives = 60/98 (61%), Gaps = 9/98 (9%) Query: 9 LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68 + P R++++ ++ E KT G I++PD+ EKP + E++ VG + + ++ Sbjct: 3 VIPLGERLLIKPIKEEKKTE-GGIVLPDSAKEKPMKA--EVVAVG-----KLDDEEDFDI 54 Query: 69 SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVE 106 GD V+F K++GTEIK++D E+Y+++ +DI+ + E Sbjct: 55 KVGDKVIFSKYAGTEIKIDD-EDYIIIDVNDILAKIEE 91 >gnl|CDD|162753 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by Pfam model pfam00501. Length = 625 Score = 29.1 bits (66), Expect = 0.25 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Query: 27 TATGNILI---PDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSG 81 T TG I+I P KP +++ + V+D+ G +E G +V+ W G Sbjct: 396 TETGGIMITPLPGATPTKPGSATLPFFGIEPAVVDEEGNPVEGPGEGGYLVIKQPWPG 453 >gnl|CDD|179717 PRK04027, PRK04027, 30S ribosomal protein S7P; Reviewed. Length = 195 Score = 27.6 bits (62), Expect = 0.82 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 67 EVSKGDIVLFGKWSGTEIKLND 88 E +I LFGKW E+++ D Sbjct: 5 EAEPMEIKLFGKWDVEEVEVRD 26 >gnl|CDD|183984 PRK13340, PRK13340, alanine racemase; Reviewed. Length = 406 Score = 26.1 bits (58), Expect = 1.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 66 PEVSKGD-IVLFGKWSGTEIKLNDGEEY 92 P V GD +VLFGK EI +++ EE Sbjct: 357 PNVKPGDEVVLFGKQGNAEITVDEVEEA 384 >gnl|CDD|179489 PRK02870, PRK02870, heat shock protein HtpX; Provisional. Length = 336 Score = 25.4 bits (56), Expect = 3.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Query: 80 SGTEIKLNDGEEYLVMQESDIMGIVVE 106 SGTE K E L +QE + +V E Sbjct: 97 SGTEYKEITPENALSLQERQLYNVVEE 123 >gnl|CDD|162677 TIGR02061, aprA, adenosine phosphosulphate reductase, alpha subunit. During dissimilatory sulfate reduction or sulfur oxidation, adenylylsulfate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulfite and AMP. Found in several bacterial lineages and in Archaeoglobales, APS reductase is a heterodimer composed of an alpha subunit containing a noncovalently bound FAD, and a beta subunit containing two [4Fe-4S] clusters. Described by this model is the alpha subunit of APS reductase, sharing common evolutionary origin with fumarate reductase/succinate dehydrogenase flavoproteins. Length = 614 Score = 25.2 bits (55), Expect = 4.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 81 GTEIKLNDGEEYLVMQESDIMGIVVEE 107 GT N+ E+Y+ +D+MG+V E+ Sbjct: 55 GTRFGENNAEDYVRYVRTDLMGLVRED 81 >gnl|CDD|130100 TIGR01028, S7_S5_E_A, ribosomal protein S7(archaeal)/S5(eukaryotic). This model describes the members from the eukaryotic cytosol and the Archaea of the family that includes ribosomal protein S7 of bacteria and S5 of eukaryotes. A separate model describes bacterial and organellar S7. Length = 186 Score = 25.1 bits (55), Expect = 4.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 72 DIVLFGKWSGTEIKLND 88 +I +FGKWS ++++ D Sbjct: 1 EIKVFGKWSTDDVEVKD 17 >gnl|CDD|180104 PRK05469, PRK05469, peptidase T; Provisional. Length = 408 Score = 25.1 bits (56), Expect = 4.7 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 7/36 (19%) Query: 58 DQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYL 93 D SGK ++P++ + + G +I L DG E L Sbjct: 84 DFSGKNVKPQIIEN-------YDGGDIALGDGNEVL 112 >gnl|CDD|162308 TIGR01346, isocit_lyase, isocitrate lyase. Isocitrate lyase and malate synthase are the enzymes of the glyoxylate shunt, a pathway associated with the TCA cycle. Length = 527 Score = 24.3 bits (52), Expect = 7.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 51 WVGAGVMDQSGKVIEPEVS 69 W GAG DQ K ++ S Sbjct: 495 WSGAGYFDQLLKTVQGGNS 513 >gnl|CDD|151044 pfam10479, FSA_C, Fragile site-associated protein C-terminus. This is the conserved C-terminal half of the protein KIAA1109 which is the fragile site-associated protein FSA. Genome-wide-association studies showed this protein to linked to the susceptibility to coeliac disease. The protein may also be associated with polycystic kidney disease. Length = 615 Score = 24.1 bits (52), Expect = 8.4 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 71 GDIVLFGKWSGTEIKLNDGEEYLVMQESD 99 G VL +WS KLND E+ ++E D Sbjct: 124 GTSVLMTRWSSPSAKLND--EWKGLKEGD 150 >gnl|CDD|185439 PTZ00091, PTZ00091, 40S ribosomal protein S5; Provisional. Length = 193 Score = 24.0 bits (52), Expect = 9.7 Identities = 7/14 (50%), Positives = 12/14 (85%) Query: 75 LFGKWSGTEIKLND 88 LFGKWS +++++D Sbjct: 8 LFGKWSYDDVQVSD 21 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.311 0.132 0.371 Gapped Lambda K H 0.267 0.0487 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,791,698 Number of extensions: 100680 Number of successful extensions: 155 Number of sequences better than 10.0: 1 Number of HSP's gapped: 150 Number of HSP's successfully gapped: 31 Length of query: 111 Length of database: 5,994,473 Length adjustment: 77 Effective length of query: 34 Effective length of database: 4,330,657 Effective search space: 147242338 Effective search space used: 147242338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.6 bits)