RPSBLAST alignment of GI: 254780848 and SCOP domain: d1aono_

Alignment
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Length = 97
 Score = 88.3 bits (219), Expect = 1e-19
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R + E K+A G I++  + + K +   GE++ VG G + ++G+V   +V
Sbjct: 3   IRPLHDRVIVKRKEVETKSAGG-IVLTGSAAAKST--RGEVLAVGNGRILENGEVKPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIV+F    G + +  D EE L+M ESDI+ IV
Sbjct: 60  KVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIV 95

SCOP domain information

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Escherichia coli [TaxId: 562]