BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] (111 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] Length = 111 Score = 222 bits (566), Expect = 1e-60, Method: Compositional matrix adjust. Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60 MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS Sbjct: 1 MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS 60 Query: 61 GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111 GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK Sbjct: 61 GKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK 111 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 27.3 bits (59), Expect = 0.065, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 17/27 (62%) Query: 41 KPSASSGEIMWVGAGVMDQSGKVIEPE 67 KPS + GE+ +GA +D+ K IE + Sbjct: 300 KPSLARGELHCIGATTLDEYRKYIEKD 326 >gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 Score = 26.2 bits (56), Expect = 0.14, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 60 SGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQES 98 SGK+ E V+KGD V +G + G +++ E+ + Q S Sbjct: 71 SGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNS 109 >gi|254780468|ref|YP_003064881.1| sensory box/GGDEF family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 25.4 bits (54), Expect = 0.29, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 64 IEP-EVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103 IEP +S D VL S T I +N GE++ V +DI GI Sbjct: 32 IEPINISSSDRVL-DLTSITRIYVNQGEDFQVFTAADIDGI 71 >gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] Length = 106 Score = 22.3 bits (46), Expect = 2.5, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query: 63 VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103 +I+ E+ K D+VLF K GT G V+Q D +G+ Sbjct: 8 IIQNEIKKNDVVLFMK--GTPTSPRCGFSGKVVQVLDSLGV 46 >gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 21.9 bits (45), Expect = 3.4, Method: Compositional matrix adjust. Identities = 16/79 (20%), Positives = 31/79 (39%) Query: 8 YLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPE 67 +L +GR +VR K + G+I+ D ++ S ++ A + + E Sbjct: 252 FLGLLQGRTMVRSANLREKASIGDIITGDKIAYWAYPSENSSGYISASATQEHTMAVSAE 311 Query: 68 VSKGDIVLFGKWSGTEIKL 86 ++ + GK I L Sbjct: 312 NARKRWRIMGKTDSYYITL 330 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 20.8 bits (42), Expect = 6.0, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 89 GEEYLVMQESDIMGIVVEEKKNK 111 GE++L+ + + +EEKKN+ Sbjct: 586 GEKFLLSAKRIFQILAIEEKKNR 608 >gi|254780688|ref|YP_003065101.1| putative flagellar motor switch protein [Candidatus Liberibacter asiaticus str. psy62] Length = 147 Score = 20.8 bits (42), Expect = 6.3, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Query: 50 MWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSG--TEIKLNDGE----EYLVMQESD 99 + +G+ M S V +SKGD++ K G +I +N+ + E +M+E D Sbjct: 81 IILGSCCMQISNLV---NLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDD 133 >gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus Liberibacter asiaticus str. psy62] Length = 833 Score = 20.4 bits (41), Expect = 9.0, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 87 NDGEEYLVMQESDIMGI 103 +DG +YLV + +I GI Sbjct: 236 SDGNQYLVEDKVEISGI 252 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.311 0.132 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,813 Number of Sequences: 1233 Number of extensions: 2816 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 111 length of database: 328,796 effective HSP length: 63 effective length of query: 48 effective length of database: 251,117 effective search space: 12053616 effective search space used: 12053616 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 32 (16.9 bits)