HHsearch alignment for GI: 254780852 and conserved domain: CHL00022

>CHL00022 ndhC NADH dehydrogenase subunit 3.
Probab=100.00  E-value=0  Score=272.92  Aligned_cols=118  Identities=42%  Similarity=0.813  Sum_probs=116.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHCHHHHHCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86537999999999999999999999971567898324174443130004347665247999999999987599999799
Q gi|254780852|r    4 LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPW   83 (121)
Q Consensus         4 ~~~~y~~ili~~~~~~~~~~~~~~~s~~l~~~~~~~~K~s~yECGf~p~~~~~~~Fsi~fyliallFliFDvEiv~l~Pw   83 (121)
T Consensus         3 ml~~Y~~i~i~l~ia~~~~~~~l~~s~ll~p~~~~~~K~spYECG~~p~g~ar~~F~v~fylvAilFliFDvE~vfL~Pw   82 (120)
T CHL00022          3 LLYEYDIFWAFLIISSLIPILAFLISGVLAPISKGPEKLSSYESGIEPMGDAWLQFRIRYYMFALVFVVFDVETVFLYPW   82 (120)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHHHH
T ss_conf             08769999999999999999999999993799999644877588869988877541213099999999999999999999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99960243899999999999999999999983575789
Q gi|254780852|r   84 AVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD  121 (121)
Q Consensus        84 ~~~~~~~~~~~~~~~~~F~~iL~~gl~yew~~G~L~W~  121 (121)
T Consensus        83 av~~~~lg~~~~~~m~iFi~iL~iG~~Y~wkkGaL~W~  120 (120)
T CHL00022         83 AMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS  120 (120)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99995630999999999999999999998306735789