HHsearch alignment for GI: 254780852 and conserved domain: PRK06073

>PRK06073 NADH dehydrogenase subunit A; Validated.
Probab=99.87  E-value=1.8e-21  Score=132.75  Aligned_cols=112  Identities=17%  Similarity=0.179  Sum_probs=97.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHCHHHHHCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86537999999999999999999999971567898324174443130004347665247999999999987599999799
Q gi|254780852|r    4 LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPW   83 (121)
Q Consensus         4 ~~~~y~~ili~~~~~~~~~~~~~~~s~~l~~~~~~~~K~s~yECGf~p~~~~~~~Fsi~fyliallFliFDvEiv~l~Pw   83 (121)
T Consensus         3 ~m~~~~~v~l~~vl~l~~~v~~~~l~~ll~P~rp~p~K~~ryEaGn~p~G~~~~~f~mqYygy~Lmfv~~ep~~v~l~~~   82 (125)
T PRK06073          3 GMQAALAFGLPFVLLLLLGVGTVYLLKLIAPRRPTPVKVSRYEAGNPPTGEARAPLPMQYYGYLLMYVTLEPIVVLLFLI   82 (125)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             27888999999999999989999999981789989155100123899998713340116999999999998999999999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99960243899999999999999999999983
Q gi|254780852|r   84 AVYFKQITWLGFGSMMVFLGILTVGFIYEWKK  115 (121)
Q Consensus        84 ~~~~~~~~~~~~~~~~~F~~iL~~gl~yew~~  115 (121)
T Consensus        83 a~~~~~~~~~~l~~~l~~~~~~~p~l~ya~~~  114 (125)
T PRK06073         83 AIAPYYTFLNLLLLALVGLLLLYPVLYYAYRY  114 (125)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98343779999999999999999999999999