BLAST/PSIBLAST alignment of GI: 254780852 and GI: 110633376 at iteration 1
>gi|110633376|ref|YP_673584.1| NADH dehydrogenase subunit A [Mesorhizobium sp. BNC1] Length = 121
>gi|110284360|gb|ABG62419.1| NADH dehydrogenase subunit A [Chelativorans sp. BNC1] Length = 121
 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/121 (72%), Positives = 109/121 (90%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLL+SY PI++FM +A AI +VL+I+PFIVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNDLLSSYLPIIIFMGVALAICLVLLIAPFIVAYRNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F +I W GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWFGFWSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121