BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A
[Candidatus Liberibacter asiaticus str. psy62]
         (121 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|163793187|ref|ZP_02187163.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [alpha
           proteobacterium BAL199]
 gi|159181833|gb|EDP66345.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [alpha
           proteobacterium BAL199]
          Length = 121

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+ Y PILVF+A+A  + I ++++ F+V  + PD EKLS YECGF+ FDD+R +FD
Sbjct: 1   MNELLSEYLPILVFLAVAVGLAIAMVVASFVVGTQRPDSEKLSAYECGFEAFDDSRRQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+    I   GF SM+VFLG+LT+GF+YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAISLGDIGLFGFWSMVVFLGVLTIGFVYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254501694|ref|ZP_05113845.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Labrenzia alexandrii DFL-11]
 gi|222437765|gb|EEE44444.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Labrenzia alexandrii DFL-11]
          Length = 127

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ IA  I + L+ISPF++A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 7   MEELLREYIPIVVFIGIALVIGLALLISPFLIAYKNPDPEKLSAYECGFNAFDDARMKFD 66

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLE+AFLFPWAV F ++ W G+GSMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 67  IRFYLVAILFIIFDLEVAFLFPWAVSFGELGWYGYGSMMVFLGVLTVGFIYEWKKGALEW 126

Query: 121 D 121
           D
Sbjct: 127 D 127


>gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040529|gb|ACT57325.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 121

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 121/121 (100%), Positives = 121/121 (100%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD
Sbjct: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW
Sbjct: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254476759|ref|ZP_05090145.1| NADH-quinone oxidoreductase chain a [Ruegeria sp. R11]
 gi|214031002|gb|EEB71837.1| NADH-quinone oxidoreductase chain a [Ruegeria sp. R11]
          Length = 121

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDAGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|86137601|ref|ZP_01056178.1| NADH dehydrogenase alpha subunit [Roseobacter sp. MED193]
 gi|85825936|gb|EAQ46134.1| NADH dehydrogenase alpha subunit [Roseobacter sp. MED193]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+ +A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLVVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|259419080|ref|ZP_05742997.1| NADH-quinone oxidoreductase, a subunit [Silicibacter sp. TrichCH4B]
 gi|259345302|gb|EEW57156.1| NADH-quinone oxidoreductase, a subunit [Silicibacter sp. TrichCH4B]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254460751|ref|ZP_05074167.1| NADH-quinone oxidoreductase chain a [Rhodobacterales bacterium
           HTCC2083]
 gi|206677340|gb|EDZ41827.1| NADH-quinone oxidoreductase chain a [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 132

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 75/121 (61%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           + D+   Y PIL+F+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 12  VEDIAREYLPILIFLAVAIGLGLVLILAAIVIAVRNPDPEKVSAYECGFNAFDDARMKFD 71

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMM+FL +LT GF YEWKKGALEW
Sbjct: 72  VRFYLVSILFIIFDLEIAFLFPWAVAFKDISMVGFWSMMIFLAVLTAGFAYEWKKGALEW 131

Query: 121 D 121
           +
Sbjct: 132 E 132


>gi|163738797|ref|ZP_02146211.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis BS107]
 gi|163741492|ref|ZP_02148883.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161385226|gb|EDQ09604.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis 2.10]
 gi|161388125|gb|EDQ12480.1| NADH dehydrogenase subunit A [Phaeobacter gallaeciensis BS107]
          Length = 121

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++  GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDAGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|99080582|ref|YP_612736.1| NADH dehydrogenase subunit A [Ruegeria sp. TM1040]
 gi|99036862|gb|ABF63474.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ruegeria sp.
           TM1040]
          Length = 121

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDAGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|159043856|ref|YP_001532650.1| NADH dehydrogenase subunit A [Dinoroseobacter shibae DFL 12]
 gi|157911616|gb|ABV93049.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Dinoroseobacter shibae DFL 12]
          Length = 121

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+AIA  + +VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAIAIGLGLVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F+ +  +GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFQDVGVVGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|260434182|ref|ZP_05788153.1| NADH-quinone oxidoreductase chain 7 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418010|gb|EEX11269.1| NADH-quinone oxidoreductase chain 7 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 121

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAVAVGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDLSDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|121609762|ref|YP_997569.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Verminephrobacter eiseniae EF01-2]
 gi|121554402|gb|ABM58551.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Verminephrobacter eiseniae EF01-2]
          Length = 136

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ +V ++  +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 20  LDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 79

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +Q+   GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 80  LVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE 136


>gi|118590039|ref|ZP_01547443.1| NADH dehydrogenase subunit A [Stappia aggregata IAM 12614]
 gi|118437536|gb|EAV44173.1| NADH dehydrogenase subunit A [Stappia aggregata IAM 12614]
          Length = 121

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ IA  I + L+ISPFI+A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYVPIVVFIGIALVIGLALLISPFILAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWATVFGDLGWYGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254465758|ref|ZP_05079169.1| NADH dehydrogenase i, a subunit [Rhodobacterales bacterium Y4I]
 gi|206686666|gb|EDZ47148.1| NADH dehydrogenase i, a subunit [Rhodobacterales bacterium Y4I]
          Length = 121

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 102/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PI+VF+A+A+ + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPIMVFLAVAAGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+  GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDTGFWSMMVFLGVLTIGFAYEWKKGALEW 120


>gi|75676079|ref|YP_318500.1| NADH dehydrogenase subunit A [Nitrobacter winogradskyi Nb-255]
 gi|74420949|gb|ABA05148.1| NADH dehydrogenase subunit A [Nitrobacter winogradskyi Nb-255]
          Length = 121

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ IA+AI + L+++PFIVA+K PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGIAAAIGVALLVAPFIVAYKQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLGVAGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|307942117|ref|ZP_07657468.1| NADH-quinone oxidoreductase subunit a 1 [Roseibium sp. TrichSKD4]
 gi|307774403|gb|EFO33613.1| NADH-quinone oxidoreductase subunit a 1 [Roseibium sp. TrichSKD4]
          Length = 121

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PI+VF+ I+  I + L+ISPFIVA+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEELLRDYIPIVVFIGISLVIGLALLISPFIVAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  + W GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVVFGDLGWYGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254510683|ref|ZP_05122750.1| NADH-quinone oxidoreductase chain 7 [Rhodobacteraceae bacterium
           KLH11]
 gi|221534394|gb|EEE37382.1| NADH-quinone oxidoreductase chain 7 [Rhodobacteraceae bacterium
           KLH11]
          Length = 121

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PILVF+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYLPILVFLAVAIGLGIVLILAAIVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDISDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|328543685|ref|YP_004303794.1| NADH-quinone oxidoreductase subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326413429|gb|ADZ70492.1| NADH-quinone oxidoreductase subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 121

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI VF+ I+  I + L++SPF++A+  PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLRDYLPIAVFIGISLVIGLALLVSPFLLAYSKPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVVFGDLGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|83592890|ref|YP_426642.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575804|gb|ABC22355.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodospirillum rubrum ATCC 11170]
          Length = 121

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PIL+F+ IA+ + +  + + ++V  ++PD EK S YECGF+ FDDAR KF 
Sbjct: 1   MQDLLLEYLPILIFIGIATLVAVAAIGTSYLVVRQNPDSEKDSAYECGFEAFDDARSKFQ 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV    I   GF SM+VFLG+LTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLGAIGVFGFWSMVVFLGVLTVGFVYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|114764718|ref|ZP_01443903.1| NADH dehydrogenase alpha subunit [Pelagibaca bermudensis HTCC2601]
 gi|114542918|gb|EAU45939.1| NADH dehydrogenase alpha subunit [Roseovarius sp. HTCC2601]
          Length = 121

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+ IA A+  +L+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLGIAVALGAILILAAVVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVSMVGFWSMMVFLGVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|110633376|ref|YP_673584.1| NADH dehydrogenase subunit A [Mesorhizobium sp. BNC1]
 gi|110284360|gb|ABG62419.1| NADH dehydrogenase subunit A [Chelativorans sp. BNC1]
          Length = 121

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 88/121 (72%), Positives = 109/121 (90%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLL+SY PI++FM +A AI +VL+I+PFIVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNDLLSSYLPIIIFMGVALAICLVLLIAPFIVAYRNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F +I W GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWFGFWSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|85717030|ref|ZP_01047992.1| NADH dehydrogenase alpha subunit [Nitrobacter sp. Nb-311A]
 gi|85696154|gb|EAQ34050.1| NADH dehydrogenase alpha subunit [Nitrobacter sp. Nb-311A]
          Length = 121

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ IA+ I  VL+I+PF+VA+K PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGIAAVIGAVLLIAPFVVAYKQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLGVTGFWSMIVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|163746196|ref|ZP_02153555.1| NADH dehydrogenase subunit A [Oceanibulbus indolifex HEL-45]
 gi|161380941|gb|EDQ05351.1| NADH dehydrogenase subunit A [Oceanibulbus indolifex HEL-45]
          Length = 121

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 100/120 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y PILVF+A+A  + +VL+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDHMLREYLPILVFLAVAIGLGLVLILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVSMVGFWSMMVFLGVLTAGFAYEWKKGALEW 120


>gi|114327966|ref|YP_745123.1| NADH-quinone oxidoreductase chain A [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316140|gb|ABI62200.1| NADH-quinone oxidoreductase chain A [Granulibacter bethesdensis
           CGDNIH1]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 92/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +LT Y PILVF+ IA+ I   ++   ++ A + P  EKL+ YECGFD FDDAR +FD
Sbjct: 1   MQPVLTEYFPILVFIGIATVIACAMVGGSYLAARQKPYAEKLAPYECGFDAFDDARSRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ LV++LF+IFDLE+AFLFPWAV   +I   GF SMM FLG+LTVGFIYEW+KGALEW
Sbjct: 61  VRYYLVAILFIIFDLEVAFLFPWAVSLSRIGMFGFFSMMGFLGVLTVGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|260427484|ref|ZP_05781463.1| NADH-quinone oxidoreductase, a subunit [Citreicella sp. SE45]
 gi|260421976|gb|EEX15227.1| NADH-quinone oxidoreductase, a subunit [Citreicella sp. SE45]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A A+  +L+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIALGAILILAAVVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWA  FK ++ +GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWATAFKDVSMVGFWSMMVFLAVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|163732067|ref|ZP_02139513.1| NADH dehydrogenase subunit A [Roseobacter litoralis Och 149]
 gi|161394365|gb|EDQ18688.1| NADH dehydrogenase subunit A [Roseobacter litoralis Och 149]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 80/120 (66%), Positives = 102/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120


>gi|254487784|ref|ZP_05100989.1| NADH-quinone oxidoreductase chain a [Roseobacter sp. GAI101]
 gi|214044653|gb|EEB85291.1| NADH-quinone oxidoreductase chain a [Roseobacter sp. GAI101]
          Length = 121

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 75/120 (62%), Positives = 99/120 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +++  Y PIL+F+A+A  + +VL++S  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDEMMREYLPILIFLAVAVGLGLVLILSAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDVSMAGFWSMMVFLAVLTAGFAYEWKKGALEW 120


>gi|110680472|ref|YP_683479.1| NADH dehydrogenase subunit A [Roseobacter denitrificans OCh 114]
 gi|109456588|gb|ABG32793.1| NADH-quinone oxidoreductase chain A [Roseobacter denitrificans OCh
           114]
          Length = 121

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 102/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120


>gi|56697624|ref|YP_167993.1| NADH dehydrogenase subunit A [Ruegeria pomeroyi DSS-3]
 gi|56679361|gb|AAV96027.1| NADH dehydrogenase I, A subunit [Ruegeria pomeroyi DSS-3]
          Length = 121

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 103/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y PILVF+A+A+ + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEELLREYLPILVFLAVAAGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVGFKDMSDVGFWSMMVFLGVLTIGFAYEWKKGALEW 120


>gi|17987441|ref|NP_540075.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 1 str. 16M]
 gi|62289751|ref|YP_221544.1| NADH dehydrogenase subunit A [Brucella abortus bv. 1 str. 9-941]
 gi|82699679|ref|YP_414253.1| NADH dehydrogenase subunit A [Brucella melitensis biovar Abortus
           2308]
 gi|148560084|ref|YP_001258780.1| NADH dehydrogenase subunit A [Brucella ovis ATCC 25840]
 gi|189023996|ref|YP_001934764.1| NADH dehydrogenase subunit A [Brucella abortus S19]
 gi|225627299|ref|ZP_03785336.1| NADH-quinone oxidoreductase subunit A [Brucella ceti str. Cudo]
 gi|225852318|ref|YP_002732551.1| NADH dehydrogenase subunit A [Brucella melitensis ATCC 23457]
 gi|237815238|ref|ZP_04594236.1| NADH-quinone oxidoreductase subunit A [Brucella abortus str. 2308
           A]
 gi|254689058|ref|ZP_05152312.1| NADH dehydrogenase subunit A [Brucella abortus bv. 6 str. 870]
 gi|254693540|ref|ZP_05155368.1| NADH dehydrogenase subunit A [Brucella abortus bv. 3 str. Tulya]
 gi|254697192|ref|ZP_05159020.1| NADH dehydrogenase subunit A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701570|ref|ZP_05163398.1| NADH dehydrogenase subunit A [Brucella suis bv. 5 str. 513]
 gi|254706983|ref|ZP_05168811.1| NADH dehydrogenase subunit A [Brucella pinnipedialis M163/99/10]
 gi|254709910|ref|ZP_05171721.1| NADH dehydrogenase subunit A [Brucella pinnipedialis B2/94]
 gi|254713911|ref|ZP_05175722.1| NADH dehydrogenase subunit A [Brucella ceti M644/93/1]
 gi|254717031|ref|ZP_05178842.1| NADH dehydrogenase subunit A [Brucella ceti M13/05/1]
 gi|254718911|ref|ZP_05180722.1| NADH dehydrogenase subunit A [Brucella sp. 83/13]
 gi|254730088|ref|ZP_05188666.1| NADH dehydrogenase subunit A [Brucella abortus bv. 4 str. 292]
 gi|256031403|ref|ZP_05445017.1| NADH dehydrogenase subunit A [Brucella pinnipedialis M292/94/1]
 gi|256044481|ref|ZP_05447385.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060914|ref|ZP_05451072.1| NADH dehydrogenase subunit A [Brucella neotomae 5K33]
 gi|256113332|ref|ZP_05454194.1| NADH dehydrogenase subunit A [Brucella melitensis bv. 3 str. Ether]
 gi|256159524|ref|ZP_05457292.1| NADH dehydrogenase subunit A [Brucella ceti M490/95/1]
 gi|256254811|ref|ZP_05460347.1| NADH dehydrogenase subunit A [Brucella ceti B1/94]
 gi|256257307|ref|ZP_05462843.1| NADH dehydrogenase subunit A [Brucella abortus bv. 9 str. C68]
 gi|256264183|ref|ZP_05466715.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369234|ref|YP_003106742.1| NADH dehydrogenase alpha subunit [Brucella microti CCM 4915]
 gi|260168537|ref|ZP_05755348.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|260545499|ref|ZP_05821240.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella abortus NCTC
           8038]
 gi|260563835|ref|ZP_05834321.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260754556|ref|ZP_05866904.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 6 str. 870]
 gi|260757777|ref|ZP_05870125.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 4 str. 292]
 gi|260761602|ref|ZP_05873945.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260883583|ref|ZP_05895197.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 9 str. C68]
 gi|261213805|ref|ZP_05928086.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 3 str. Tulya]
 gi|261218838|ref|ZP_05933119.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M13/05/1]
 gi|261221992|ref|ZP_05936273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           B1/94]
 gi|261314446|ref|ZP_05953643.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261317456|ref|ZP_05956653.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis B2/94]
 gi|261321663|ref|ZP_05960860.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M644/93/1]
 gi|261324914|ref|ZP_05964111.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           neotomae 5K33]
 gi|261752123|ref|ZP_05995832.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 5 str. 513]
 gi|261758010|ref|ZP_06001719.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|265983898|ref|ZP_06096633.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella sp.
           83/13]
 gi|265988492|ref|ZP_06101049.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M292/94/1]
 gi|265990905|ref|ZP_06103462.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265994742|ref|ZP_06107299.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 3 str. Ether]
 gi|265997956|ref|ZP_06110513.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M490/95/1]
 gi|297248156|ref|ZP_06931874.1| NADH dehydrogenase I subunit A [Brucella abortus bv. 5 str. B3196]
 gi|306838241|ref|ZP_07471093.1| NADH dehydrogenase subunit A [Brucella sp. NF 2653]
 gi|306841960|ref|ZP_07474637.1| NADH dehydrogenase subunit A [Brucella sp. BO2]
 gi|306843739|ref|ZP_07476338.1| NADH dehydrogenase subunit A [Brucella sp. BO1]
 gi|17983134|gb|AAL52339.1| NADH-quinone oxidoreductase chain a [Brucella melitensis bv. 1 str.
           16M]
 gi|62195883|gb|AAX74183.1| NuoA, NADH dehydrogenase I, A subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615780|emb|CAJ10778.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           melitensis biovar Abortus 2308]
 gi|148371341|gb|ABQ61320.1| NADH dehydrogenase I, A subunit [Brucella ovis ATCC 25840]
 gi|189019568|gb|ACD72290.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           abortus S19]
 gi|225617304|gb|EEH14349.1| NADH-quinone oxidoreductase subunit A [Brucella ceti str. Cudo]
 gi|225640683|gb|ACO00597.1| NADH-quinone oxidoreductase subunit A [Brucella melitensis ATCC
           23457]
 gi|237790075|gb|EEP64285.1| NADH-quinone oxidoreductase subunit A [Brucella abortus str. 2308
           A]
 gi|255999394|gb|ACU47793.1| NADH dehydrogenase alpha subunit [Brucella microti CCM 4915]
 gi|260096906|gb|EEW80781.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella abortus NCTC
           8038]
 gi|260153851|gb|EEW88943.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260668095|gb|EEX55035.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 4 str. 292]
 gi|260672034|gb|EEX58855.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260674664|gb|EEX61485.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 6 str. 870]
 gi|260873111|gb|EEX80180.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 9 str. C68]
 gi|260915412|gb|EEX82273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           abortus bv. 3 str. Tulya]
 gi|260920576|gb|EEX87229.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           B1/94]
 gi|260923927|gb|EEX90495.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M13/05/1]
 gi|261294353|gb|EEX97849.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M644/93/1]
 gi|261296679|gb|EEY00176.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis B2/94]
 gi|261300894|gb|EEY04391.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           neotomae 5K33]
 gi|261303472|gb|EEY06969.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M163/99/10]
 gi|261737994|gb|EEY25990.1| NADH dehydrogenase subunit A [Brucella sp. F5/99]
 gi|261741876|gb|EEY29802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 5 str. 513]
 gi|262552424|gb|EEZ08414.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella ceti
           M490/95/1]
 gi|262765855|gb|EEZ11644.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001689|gb|EEZ14264.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094401|gb|EEZ18246.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660689|gb|EEZ30950.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella
           pinnipedialis M292/94/1]
 gi|264662490|gb|EEZ32751.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella sp.
           83/13]
 gi|297175325|gb|EFH34672.1| NADH dehydrogenase I subunit A [Brucella abortus bv. 5 str. B3196]
 gi|306275930|gb|EFM57643.1| NADH dehydrogenase subunit A [Brucella sp. BO1]
 gi|306287951|gb|EFM59362.1| NADH dehydrogenase subunit A [Brucella sp. BO2]
 gi|306406685|gb|EFM62912.1| NADH dehydrogenase subunit A [Brucella sp. NF 2653]
 gi|326408825|gb|ADZ65890.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Brucella
           melitensis M28]
 gi|326538541|gb|ADZ86756.1| NADH-quinone oxidoreductase subunit A [Brucella melitensis M5-90]
          Length = 121

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|300023457|ref|YP_003756068.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525278|gb|ADJ23747.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 121

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DL + Y PI +F+ +A  I   LM++PF+VA+++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MVDLTSHYLPIAIFIGVALLIGAALMVAPFLVAYRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF++FDLEIAFLFPWAV FK I   GF SMM FLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIVFDLEIAFLFPWAVAFKDIGVFGFWSMMAFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|23501689|ref|NP_697816.1| NADH dehydrogenase subunit A [Brucella suis 1330]
 gi|161618766|ref|YP_001592653.1| NADH dehydrogenase subunit A [Brucella canis ATCC 23365]
 gi|163843075|ref|YP_001627479.1| NADH dehydrogenase subunit A [Brucella suis ATCC 23445]
 gi|254704117|ref|ZP_05165945.1| NADH dehydrogenase subunit A [Brucella suis bv. 3 str. 686]
 gi|260566634|ref|ZP_05837104.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella suis bv. 4
           str. 40]
 gi|261754783|ref|ZP_05998492.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 3 str. 686]
 gi|23347611|gb|AAN29731.1| NADH dehydrogenase I, A subunit [Brucella suis 1330]
 gi|161335577|gb|ABX61882.1| NADH-quinone oxidoreductase chain A [Brucella canis ATCC 23365]
 gi|163673798|gb|ABY37909.1| NADH-quinone oxidoreductase chain A [Brucella suis ATCC 23445]
 gi|260156152|gb|EEW91232.1| NADH-ubiquinone/plastoquinone oxidoreductase [Brucella suis bv. 4
           str. 40]
 gi|261744536|gb|EEY32462.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brucella suis
           bv. 3 str. 686]
          Length = 121

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF++A++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLIAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|153009752|ref|YP_001370967.1| NADH dehydrogenase subunit A [Ochrobactrum anthropi ATCC 49188]
 gi|239831686|ref|ZP_04680015.1| NADH-quinone oxidoreductase subunit A [Ochrobactrum intermedium LMG
           3301]
 gi|151561640|gb|ABS15138.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ochrobactrum
           anthropi ATCC 49188]
 gi|239823953|gb|EEQ95521.1| NADH-quinone oxidoreductase subunit A [Ochrobactrum intermedium LMG
           3301]
          Length = 121

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 106/121 (87%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ IA  I + L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGIAMVIGVALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F +I W GF SMMVFLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWFGFASMMVFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|126736074|ref|ZP_01751818.1| NADH-quinone oxidoreductase chain A [Roseobacter sp. CCS2]
 gi|126714631|gb|EBA11498.1| NADH-quinone oxidoreductase chain A [Roseobacter sp. CCS2]
          Length = 121

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 75/121 (61%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D+L+ Y PI++F+ +A A+ ++L+++  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MQDMLSEYLPIMIFLGLAIALGLILILAAAIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F+ ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFQDVSMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|312116342|ref|YP_004013938.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221471|gb|ADP72839.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 121

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL  Y P+++F+ ++  I + L+++PF VA  +PDPEK++ YECGF  FDDAR+KFD
Sbjct: 1   MTELLQQYFPLVIFLGVSLIIGLGLLVAPFFVAPNNPDPEKVAAYECGFPAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV FK+    GF +MM FL +LT+GFIYEWKKGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFKEAGVAGFWAMMAFLSVLTIGFIYEWKKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|296444794|ref|ZP_06886757.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylosinus
           trichosporium OB3b]
 gi|296257742|gb|EFH04806.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylosinus
           trichosporium OB3b]
          Length = 121

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P+++F+A+A+ I   L+++PF++AFK+PDPEKLS YECGF+PF DAR+KFD
Sbjct: 1   MPGLLDQYLPLVIFIALAAIISGALLVAPFLIAFKAPDPEKLSAYECGFNPFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF++FDLE+AFLFPWAV FK+    GF SMM FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVALLFIVFDLEVAFLFPWAVAFKEAGAFGFWSMMFFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|316933891|ref|YP_004108873.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Rhodopseudomonas palustris DX-1]
 gi|315601605|gb|ADU44140.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodopseudomonas palustris DX-1]
          Length = 121

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L++Y PI+VF+ +A+ + + L+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILSNYLPIVVFIIVAAGLSLALLVAPFAVAYQQPDPEKLSAYECGFNAFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|144899465|emb|CAM76329.1| NADH-ubiquinone oxidoreductase chain 3 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 122

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA A+ ++ + + ++V  + PDPEK + YECGF+ F DAR KFD
Sbjct: 2   MEAWLLEYLPILIFIGIAVAVSVIAVGASWLVGRQKPDPEKNAAYECGFEAFGDARSKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 62  VRFYLVAILFIIFDLEVAFLFPWAVSLGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|154253665|ref|YP_001414489.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Parvibaculum
           lavamentivorans DS-1]
 gi|154157615|gb|ABS64832.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Parvibaculum
           lavamentivorans DS-1]
          Length = 121

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PIL+FM ++  + + L+I+PF++A   PDPEKL+ YECGFD FDDAR+KFD
Sbjct: 1   MEDLLLEYLPILIFMGLSLVVGLALLIAPFVIAPSKPDPEKLAAYECGFDAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LF+IFDLE+AFLFPWAV    +   GF SMMVFLG+LT+GF YEW+KGALEW
Sbjct: 61  VKYYLVAILFIIFDLEVAFLFPWAVSLGDVGGFGFWSMMVFLGVLTIGFTYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|83942675|ref|ZP_00955136.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. EE-36]
 gi|83953914|ref|ZP_00962635.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83841859|gb|EAP81028.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. NAS-14.1]
 gi|83846768|gb|EAP84644.1| NADH dehydrogenase alpha subunit [Sulfitobacter sp. EE-36]
          Length = 121

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 76/120 (63%), Positives = 99/120 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D++  Y PIL+F+A+A  + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDDMMREYLPILLFLAVAIVLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFQDVSMAGFWSMMVFLAVLTAGFAYEWKKGALEW 120


>gi|126727141|ref|ZP_01742978.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126703569|gb|EBA02665.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 121

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +A  + +VL+ +  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDQLLAEYLPILVFLGLAIGLGLVLIFAALIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWAV FK +  LGF SM+VFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEIAFLFPWAVAFKDVGLLGFWSMIVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|298291847|ref|YP_003693786.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Starkeya
           novella DSM 506]
 gi|296928358|gb|ADH89167.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Starkeya
           novella DSM 506]
          Length = 121

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS LL  Y P+++F+ I++ I + L+++PF+VAF  PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MSSLLQDYLPVVIFIGISAVIGLALLVAPFLVAFSRPDPEKMSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA+ F+++   GF SMMVFL +LTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAITFRELGGFGFWSMMVFLAVLTVGFVYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|121604330|ref|YP_981659.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Polaromonas
           naphthalenivorans CJ2]
 gi|223635469|sp|A1VM60|NUOA_POLNA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120593299|gb|ABM36738.1| NADH dehydrogenase subunit A [Polaromonas naphthalenivorans CJ2]
          Length = 119

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + I+ M+   ++    PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGVGVGILPMVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K+I  LGF S+MVFLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLKEIGALGFWSVMVFLGILVVGFVYEWKKGALDWE 119


>gi|86749690|ref|YP_486186.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris HaA2]
 gi|91977357|ref|YP_570016.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisB5]
 gi|86572718|gb|ABD07275.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris HaA2]
 gi|91683813|gb|ABE40115.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisB5]
          Length = 121

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y PI+VF+ +A+ +  VL+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILPNYLPIVVFILVAAGLSFVLLVAPFAVAYQQPDPEKLSAYECGFNAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|114707367|ref|ZP_01440264.1| NADH dehydrogenase alpha subunit [Fulvimarina pelagi HTCC2506]
 gi|114537248|gb|EAU40375.1| NADH dehydrogenase alpha subunit [Fulvimarina pelagi HTCC2506]
          Length = 121

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LLTSY PI++F+ I   I + L++SPF++A+KSPD EKLS YECGFD FDD+R+KFD
Sbjct: 1   MEELLTSYLPIVIFVGICLVIGLALLVSPFLLAYKSPDDEKLSAYECGFDAFDDSRMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F ++ W G  SMM FLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAASFGEVGWFGLWSMMFFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|89067782|ref|ZP_01155236.1| NADH dehydrogenase alpha subunit [Oceanicola granulosus HTCC2516]
 gi|89046752|gb|EAR52807.1| NADH dehydrogenase alpha subunit [Oceanicola granulosus HTCC2516]
          Length = 121

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 75/121 (61%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M + L  Y PILVF+ +A A+ ++ + +  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEFLREYLPILVFLGLAIALGVIFIGAAALIAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK ++ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFKDMSMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|296136706|ref|YP_003643948.1| hypothetical protein Tint_2268 [Thiomonas intermedia K12]
 gi|295796828|gb|ADG31618.1| hypothetical protein Tint_2268 [Thiomonas intermedia K12]
          Length = 119

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +  +++A + PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEQYLPVLLFILVGIGVGVVPQLLGYLIAPRHPDAEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K +  +GF +MM+FL ILT+GFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDVGQIGFWAMMIFLAILTIGFIYEWKKGALDWE 119


>gi|163759543|ref|ZP_02166628.1| NADH dehydrogenase subunit A [Hoeflea phototrophica DFL-43]
 gi|162283140|gb|EDQ33426.1| NADH dehydrogenase subunit A [Hoeflea phototrophica DFL-43]
          Length = 121

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 83/121 (68%), Positives = 105/121 (86%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL +Y PI +F+ +A  I + L+I+PF +A+K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGAYVPIAIFIGLALVIGLALLIAPFAIAYKNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F +I W+GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFGEIGWIGFWSMMVFLGVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|170742511|ref|YP_001771166.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium sp. 4-46]
 gi|168196785|gb|ACA18732.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium sp. 4-46]
          Length = 121

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LLT Y P+++F+ ++  I + L+++PF+VA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGLLTDYLPLVIFIGVSLVIALALLVAPFLVAYNSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|217979049|ref|YP_002363196.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocella
           silvestris BL2]
 gi|217504425|gb|ACK51834.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocella
           silvestris BL2]
          Length = 121

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P++VFMAIA  I   L+++PF+VAFK+PD EKLS YECGF+ FDDAR++FD
Sbjct: 1   MPSLLDQYLPLVVFMAIAGVISGALLVAPFLVAFKAPDSEKLSAYECGFNAFDDARMQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F Q+   GF +MM+FLGILTVGF+YEWKKGALEW
Sbjct: 61  VRFYLVALLFIIFDLEVAFLFPWAVAFHQVGLFGFWAMMLFLGILTVGFVYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|294852159|ref|ZP_06792832.1| NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-0026]
 gi|294820748|gb|EFG37747.1| NADH dehydrogenase I subunit A [Brucella sp. NVSL 07-0026]
          Length = 121

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI++F+ +A  I   L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNELLSSYLPIVIFLGVAIVIGAALLVAPFLVAYRQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F QI W GF SMMVFLG+LT+GFIYEWKKG LEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGQIGWFGFLSMMVFLGVLTIGFIYEWKKGVLEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|126740376|ref|ZP_01756064.1| NADH dehydrogenase subunit A [Roseobacter sp. SK209-2-6]
 gi|126718512|gb|EBA15226.1| NADH dehydrogenase subunit A [Roseobacter sp. SK209-2-6]
          Length = 118

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 100/118 (84%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A+ + IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAAGLGIVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLEIAFLFPWAV F+ ++  GF SMMVFL +LT+GF YEWKKGALEW+
Sbjct: 61  YLVSILFIIFDLEIAFLFPWAVGFQDMSDTGFWSMMVFLAVLTIGFAYEWKKGALEWE 118


>gi|90423900|ref|YP_532270.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisB18]
 gi|90105914|gb|ABD87951.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y PI++F+ +A+ + + ++++PF+VA++ PDPEKLS YECGF  F DAR+KFD
Sbjct: 1   MSGILPNYLPIVIFIMVAAGLSVAMLVAPFVVAYQQPDPEKLSAYECGFTAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|39936017|ref|NP_948293.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris CGA009]
 gi|192291672|ref|YP_001992277.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris TIE-1]
 gi|39649871|emb|CAE28393.1| NADH-ubiquinone dehydrogenase chain A [Rhodopseudomonas palustris
           CGA009]
 gi|192285421|gb|ACF01802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Rhodopseudomonas palustris TIE-1]
          Length = 121

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L++Y PI+VF+ +A+ +  VL+++PF VA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MSGILSNYLPIVVFIIVAAGLSFVLLVAPFAVAYQQPDPEKLSAYECGFNAFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|294340861|emb|CAZ89256.1| putative NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Thiomonas sp. 3As]
          Length = 119

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +  +++A + PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEQYLPVLLFILVGIGVGVVPQLLGYLIAPRHPDAEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  +GF +MM+FL ILT+GFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDIGQIGFWAMMIFLAILTIGFIYEWKKGALDWE 119


>gi|209885051|ref|YP_002288908.1| NADH-quinone oxidoreductase subunit a [Oligotropha carboxidovorans
           OM5]
 gi|209873247|gb|ACI93043.1| NADH-quinone oxidoreductase subunit a [Oligotropha carboxidovorans
           OM5]
          Length = 121

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +L +Y P++VF+ +A+ I + L+I+PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGILQNYLPLVVFIGVAAVIGLALLIAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAAGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|92117744|ref|YP_577473.1| NADH dehydrogenase subunit A [Nitrobacter hamburgensis X14]
 gi|91800638|gb|ABE63013.1| NADH dehydrogenase subunit A [Nitrobacter hamburgensis X14]
          Length = 121

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y P++VF+ IA+ I  VL+I+PFIVA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MGGILQNYLPLVVFIGIAAVIGAVLLIAPFIVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGKLDATGFWSMIVFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|254469811|ref|ZP_05083216.1| NADH-quinone oxidoreductase chain a [Pseudovibrio sp. JE062]
 gi|211961646|gb|EEA96841.1| NADH-quinone oxidoreductase chain a [Pseudovibrio sp. JE062]
          Length = 121

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI+VF+ +A  I + L+I+PFIVAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYIPIVVFIGVALVIGLALLIAPFIVAFKNPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVAFGDLGWFGFVSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|146341115|ref|YP_001206163.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. ORS278]
 gi|148255915|ref|YP_001240500.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. BTAi1]
 gi|146193921|emb|CAL77938.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [Bradyrhizobium sp. ORS278]
 gi|146408088|gb|ABQ36594.1| NADH dehydrogenase subunit A [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +L +Y P++VF+ +A+ I +VL+I+PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGILQNYLPLVVFIGVAAIIGVVLLIAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAAGFWSMLVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|319761762|ref|YP_004125699.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Alicycliphilus denitrificans BC]
 gi|330826542|ref|YP_004389845.1| NAD(P)H-quinone oxidoreductase subunit 3 [Alicycliphilus
           denitrificans K601]
 gi|317116323|gb|ADU98811.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Alicycliphilus denitrificans BC]
 gi|329311914|gb|AEB86329.1| NAD(P)H-quinone oxidoreductase subunit 3 [Alicycliphilus
           denitrificans K601]
          Length = 129

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PDP K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 13  LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFDDARMKFDVRYY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  + +   GF ++++FL IL +GF YEWKKGAL+W+
Sbjct: 73  LVAILFILFDLEIAFLFPWAVALQDVGATGFVAVVIFLSILVIGFAYEWKKGALDWE 129


>gi|254450468|ref|ZP_05063905.1| NADH-quinone oxidoreductase chain a [Octadecabacter antarcticus
           238]
 gi|198264874|gb|EDY89144.1| NADH-quinone oxidoreductase chain a [Octadecabacter antarcticus
           238]
          Length = 121

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 75/121 (61%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PI++F+ +A  +  VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDEMLREYLPIIIFLGLAIVLGAVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV F  I+   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFGDISMAAFWSMMVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|170748478|ref|YP_001754738.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655000|gb|ACB24055.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium radiotolerans JCM 2831]
          Length = 121

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P++VF+ +A  I   L++ PF+VAFKSPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIVFIGVALFIATALLVVPFLVAFKSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SM+VFLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMIVFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|152980321|ref|YP_001353152.1| NADH dehydrogenase I chain A [Janthinobacterium sp. Marseille]
 gi|151280398|gb|ABR88808.1| NADH dehydrogenase I chain A [Janthinobacterium sp. Marseille]
          Length = 140

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   ++A   PD +KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 24  LENYFPVLLFILVGIGVGVVPQVLGRVLAPHKPDAQKLSPYECGFEAFEDARMKFDVRYY 83

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE+AFL PWAV  +++  LGF SMM+FLG+LT+G ++EWKKGAL+W+
Sbjct: 84  LVAILFILFDLEVAFLVPWAVAMREVGMLGFWSMMIFLGVLTIGLVFEWKKGALDWE 140


>gi|326316099|ref|YP_004233771.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372935|gb|ADX45204.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 119

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV   ++   GF +++VFL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLHEVGVTGFVAVIVFLAILVVGFAYEWKKGALDWE 119


>gi|288942134|ref|YP_003444374.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Allochromatium vinosum DSM 180]
 gi|288897506|gb|ADC63342.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Allochromatium vinosum DSM 180]
          Length = 118

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++  +++  + PD EK S YECGF+ F+ AR+KFD+R+
Sbjct: 1   MLDNYLPILIFILVGILVGVGPLVMGYLLGPRRPDSEKDSPYECGFEAFESARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   ++    F +M+VFLGIL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALGELGLFAFWAMVVFLGILVVGFIYEWKKGALEWE 118


>gi|220924005|ref|YP_002499307.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium nodulans ORS 2060]
 gi|219948612|gb|ACL59004.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium nodulans ORS 2060]
          Length = 121

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+ Y P+++F+ ++  I + L+++PF+VA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNGLLSDYLPLVIFIGVSLVIALALLVAPFLVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F  + W GF SMM FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGDLGWFGFWSMMFFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|241763288|ref|ZP_04761345.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           delafieldii 2AN]
 gi|241367563|gb|EER61850.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           delafieldii 2AN]
          Length = 119

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ IV ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFVLVGVAVGIVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF ++++FL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVVIFLAILVVGFAYEWKKGALNWE 119


>gi|121593377|ref|YP_985273.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Acidovorax
           sp. JS42]
 gi|223635443|sp|A1W4M2|NUOA_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120605457|gb|ABM41197.1| NADH dehydrogenase subunit A [Acidovorax sp. JS42]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PDP K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF +++VFL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE 119


>gi|255019907|ref|ZP_05291982.1| NADH ubiquinone oxidoreductase chain A [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970687|gb|EET28174.1| NADH ubiquinone oxidoreductase chain A [Acidithiobacillus caldus
           ATCC 51756]
          Length = 118

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P+L+F+ +A  + IV +     +  K PD EKLS YECGF+ F+DARVKFD+R+
Sbjct: 1   MLDHYLPVLIFLLVALVVGIVPLWLGSNLGPKRPDSEKLSPYECGFEAFEDARVKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV F  I   GF +MM+FL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVFDAIGVTGFLAMMIFLAILVVGFIYEWKKGALEWE 118


>gi|89900286|ref|YP_522757.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Rhodoferax
           ferrireducens T118]
 gi|89345023|gb|ABD69226.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodoferax
           ferrireducens T118]
          Length = 137

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PI +F+ +   + +   +  +I+    PD  K S YECGF+ F DAR+KFD+R+ 
Sbjct: 21  LDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVRYY 80

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  LGF S+MVFL IL VGFIYEWKKGAL+W+
Sbjct: 81  LVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE 137


>gi|299135033|ref|ZP_07028224.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Afipia sp.
           1NLS2]
 gi|298590010|gb|EFI50214.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Afipia sp.
           1NLS2]
          Length = 121

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y P++VF+ +A+ I + L+++PF+VA++ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MGGILQNYLPLVVFIGVAAIIGLALLVAPFLVAYQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++  +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGAVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|27380030|ref|NP_771559.1| NADH dehydrogenase subunit A [Bradyrhizobium japonicum USDA 110]
 gi|27353184|dbj|BAC50184.1| NADH ubiquinone oxidoreductase chain A [Bradyrhizobium japonicum
           USDA 110]
          Length = 121

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +L +Y P++VF+ +A  I +VL+I+PFIVAF+ PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MSGILQNYLPLVVFIGVAGLIGLVLLIAPFIVAFQQPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SM+VFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMVVFLAVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|15965017|ref|NP_385370.1| NADH dehydrogenase subunit A [Sinorhizobium meliloti 1021]
 gi|307301089|ref|ZP_07580858.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
 gi|307317823|ref|ZP_07597261.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|6647654|sp|O68852|NUOA1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|3025801|gb|AAC12754.1| NADH-ubiquinone oxidoreductase subunit NuoA [Sinorhizobium
           meliloti]
 gi|5650734|emb|CAB51620.1| nuoA1 [Sinorhizobium meliloti]
 gi|15074196|emb|CAC45843.1| NADH dehydrogenase I chain A [Sinorhizobium meliloti 1021]
 gi|306896585|gb|EFN27333.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|306904044|gb|EFN34630.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
          Length = 121

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK++ W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|223635538|sp|A1WLP4|NUOA_VEREI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ +V ++  +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +Q+   GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE 119


>gi|120609950|ref|YP_969628.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Acidovorax
           citrulli AAC00-1]
 gi|223635405|sp|A1TLL6|NUOA_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120588414|gb|ABM31854.1| NADH dehydrogenase subunit A [Acidovorax citrulli AAC00-1]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV   ++   GF +++VFL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALHEVGMTGFVAVIVFLAILVVGFAYEWKKGALDWE 119


>gi|294083711|ref|YP_003550468.1| NADH:ubiquinone oxidoreductase subunit 3 [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663283|gb|ADE38384.1| NADH:ubiquinone oxidoreductase subunit 3 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 121

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ Y PI VF AIA  +    +++ F+   + PD EK++ YECGFD FDD+R +FD
Sbjct: 1   MPGFLSEYLPIAVFFAIAVGLSAAFVLTAFVFGTQRPDEEKMTAYECGFDAFDDSRRQFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV    I   GF SMM+FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLGGIGMFGFWSMMIFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|304391398|ref|ZP_07373340.1| NADH-quinone oxidoreductase subunit a 1 [Ahrensia sp. R2A130]
 gi|303295627|gb|EFL89985.1| NADH-quinone oxidoreductase subunit a 1 [Ahrensia sp. R2A130]
          Length = 121

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 83/121 (68%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL SY P+L+FM +A  I + L+ISPFI+A ++PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MDDLLYSYLPVLIFMGVALFIGLALLISPFIIAHRAPDDEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  + W GF SMM FLG+LT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSFGTLGWFGFWSMMTFLGVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|171058185|ref|YP_001790534.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Leptothrix
           cholodnii SP-6]
 gi|223635509|sp|B1Y827|NUOA_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|170775630|gb|ACB33769.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Leptothrix
           cholodnii SP-6]
          Length = 119

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+++F+ +   + +   +  F++  + P   K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LENYLPVILFILVGVGVGVAPQVLGFLLGPRRPYAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  ++I   GF +MM+FLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLREIGATGFWAMMIFLGILVVGFVYEWKKGALDWE 119


>gi|114798172|ref|YP_760446.1| NADH-quinone oxidoreductase subunit A [Hyphomonas neptunium ATCC
           15444]
 gi|114738346|gb|ABI76471.1| NADH-quinone oxidoreductase, A subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 124

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 90/115 (78%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y P+++F+ I +AI  + +I   ++A   PDPEK S YECGF  FDDAR+KFD+RF LV
Sbjct: 10  DYLPVIIFLVIGAAISGLFVIGNVLLAPSKPDPEKNSAYECGFPAFDDARMKFDVRFYLV 69

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF+IFDLE+AFLFPWAV   +I  LGF SM+ FLG+LTVGFIYEW++GALEW+
Sbjct: 70  AILFIIFDLEVAFLFPWAVSLGEIGILGFWSMVGFLGVLTVGFIYEWRRGALEWE 124


>gi|13471407|ref|NP_102973.1| NADH dehydrogenase subunit A [Mesorhizobium loti MAFF303099]
 gi|260462230|ref|ZP_05810474.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|319782981|ref|YP_004142457.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|14022149|dbj|BAB48759.1| NADH-ubiquinone dehydrogenase chain A 1 [Mesorhizobium loti
           MAFF303099]
 gi|259032090|gb|EEW33357.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|317168869|gb|ADV12407.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 121

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY PI++F+ +A  + + L+ +PF+VA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNALLSSYLPIVLFIGVALVVGLALLAAPFLVAYRNPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F +I  LGF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFSKIGMLGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|23013444|ref|ZP_00053338.1| COG0838: NADH:ubiquinone oxidoreductase subunit 3 (chain A)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 121

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA AI  + +   +IVA + PD EK + YECGFD F DAR +F+
Sbjct: 1   MEAWLLEYLPILIFLGIAIAISAICVGGSWIVARQKPDTEKATAYECGFDAFGDARSRFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVALGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|71083582|ref|YP_266301.1| NADH dehydrogenase I subunit A [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91761997|ref|ZP_01263962.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|123646647|sp|Q4FM91|NUOA_PELUB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|71062695|gb|AAZ21698.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717799|gb|EAS84449.1| NADH Dehydrogenase I Chain A [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 122

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +S+ L  Y PI++F+ IA  +    ++   I++ K PDPEKLS YECGF+PF+D+R++FD
Sbjct: 2   LSEFLKDYLPIIIFLIIALGLSCAFVVVNLILSPKHPDPEKLSAYECGFEPFEDSRMEFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA+    I  LGF SMM+FL ILTVGFIYEWKKGAL+W
Sbjct: 62  VRFYLVAILFIIFDLEIAFLFPWAISLGNIGGLGFTSMMIFLFILTVGFIYEWKKGALDW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|332528751|ref|ZP_08404728.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hylemonella
           gracilis ATCC 19624]
 gi|332041817|gb|EGI78166.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hylemonella
           gracilis ATCC 19624]
          Length = 119

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +  A+ ++  +  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGLAVGVLPQVIGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K +  +GF + MVF+ IL VGF+YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDVGAVGFWAAMVFIAILVVGFVYEWKKGALDWE 119


>gi|49475658|ref|YP_033699.1| NADH dehydrogenase subunit A [Bartonella henselae str. Houston-1]
 gi|49238465|emb|CAF27693.1| NADH dehydrogenase I, A subunit [Bartonella henselae str.
           Houston-1]
          Length = 121

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLL+SY P+L+F+ +++ I   L++ P+IVA++SPDPEKLS YECGF+ F+DAR+KFD
Sbjct: 1   MNDLLSSYLPVLIFIVVSAVIAGGLLVIPYIVAYRSPDPEKLSAYECGFNSFNDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGSIGMFGFWSMIIFLALLTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|83951738|ref|ZP_00960470.1| NADH dehydrogenase I, A subunit [Roseovarius nubinhibens ISM]
 gi|83836744|gb|EAP76041.1| NADH dehydrogenase I, A subunit [Roseovarius nubinhibens ISM]
          Length = 121

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 99/121 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+A+A  + +VL+ +  IVA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAVAIGLGLVLIFAAIIVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV FK ++ +GF SMMVFL +LT GF YEWKKGA+EW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFKDVSMVGFWSMMVFLAVLTAGFAYEWKKGAMEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|222148274|ref|YP_002549231.1| NADH dehydrogenase subunit A [Agrobacterium vitis S4]
 gi|221735262|gb|ACM36225.1| NADH ubiquinone oxidoreductase chain A [Agrobacterium vitis S4]
          Length = 124

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 88/121 (72%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI+VF+ IA  I I L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 4   MTELLSSYLPIVVFVGIAMVIGIALLVTPFAVAFKAPDSEKLSAYECGFNAFDDARIKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 64  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|254455324|ref|ZP_05068753.1| NADH dehydrogenase i chain a [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082326|gb|EDZ59752.1| NADH dehydrogenase i chain a [Candidatus Pelagibacter sp. HTCC7211]
          Length = 122

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 96/121 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +SD L  Y PI++F+ IA  +    ++  FI++ K PDPEKLS YECGF+PF+D+R++FD
Sbjct: 2   LSDFLKDYLPIIIFLIIALGLSCAFVVINFILSPKRPDPEKLSAYECGFEPFEDSRMEFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA+    I  LGF SMM+FL ILT+GFIYEWKKGAL+W
Sbjct: 62  VRFYLVAILFIIFDLEIAFLFPWAISLGNIGLLGFSSMMIFLFILTIGFIYEWKKGALDW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|288958989|ref|YP_003449330.1| NADH dehydrogenase I chain A [Azospirillum sp. B510]
 gi|288911297|dbj|BAI72786.1| NADH dehydrogenase I chain A [Azospirillum sp. B510]
          Length = 122

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 74/120 (61%), Positives = 96/120 (80%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+  Y PILVF+ I  A+  V++ + ++++ K+PD EKLS YECGF+PF+DAR KFD+
Sbjct: 3   TPLIIEYLPILVFLLIGIALAAVMVGASYVISPKNPDAEKLSPYECGFEPFEDARTKFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LVS+LF+IFDLE+AFLFPWA+    I   GF SMM+FLGILT+GFIYEWKKGALEW+
Sbjct: 63  RFYLVSILFIIFDLEVAFLFPWAIALGDIGLFGFWSMMLFLGILTIGFIYEWKKGALEWE 122


>gi|319794668|ref|YP_004156308.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus EPS]
 gi|315597131|gb|ADU38197.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus EPS]
          Length = 129

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   + +   +  +I+    PD  K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 13  LDSYLPVLLFILVGVGVGVAPQVIGYILGPNRPDAAKNAPYECGFEAFEDARMKFDVRYY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+  K+I  +GF +MM+FL IL VGFIYEWKKGAL+W+
Sbjct: 73  LVAILFILFDLEIAFLFPWAIALKEIGAVGFWAMMIFLAILVVGFIYEWKKGALDWE 129


>gi|134095031|ref|YP_001100106.1| NADH-quinone oxidoreductase subunit A [Herminiimonas
           arsenicoxydans]
 gi|133738934|emb|CAL61981.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [Herminiimonas arsenicoxydans]
          Length = 119

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   I+    PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LETYFPVLLFILVGIGVGVVPQVLGRILGPHKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE+AFL PWAV  +++  LGF SMM+FLG+LT+G ++EWKKGAL+W+
Sbjct: 63  LVAILFILFDLEVAFLVPWAVAMREVGMLGFWSMMIFLGVLTIGLVFEWKKGALDWE 119


>gi|301631483|ref|XP_002944827.1| PREDICTED: NADH-quinone oxidoreductase subunit A-like [Xenopus
           (Silurana) tropicalis]
          Length = 124

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ + +A+ ++ ++  +++    P+PEK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 8   LDQYLPVLLFILVGAAVGVLPLVFGYVLGPNRPNPEKNSPYECGFEAFEDARMKFDVRYY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  + +   GF ++ +FL IL VGF YEWKKGAL+W+
Sbjct: 68  LVAILFILFDLEIAFLFPWAVALRDVGLAGFIAVAIFLAILVVGFAYEWKKGALDWE 124


>gi|150396111|ref|YP_001326578.1| NADH dehydrogenase subunit A [Sinorhizobium medicae WSM419]
 gi|150027626|gb|ABR59743.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           medicae WSM419]
          Length = 121

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+++PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK I W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFKAIGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|115524526|ref|YP_781437.1| NADH dehydrogenase subunit A [Rhodopseudomonas palustris BisA53]
 gi|115518473|gb|ABJ06457.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Rhodopseudomonas palustris BisA53]
          Length = 121

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L +Y PI++F+ +A+A+  VL+++PFIVA++ PDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MGGILPNYLPIVIFIMVAAALSFVLLLAPFIVAYQQPDPEKLSAYECGFNAFGDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F ++   GF SMM+FLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVAFGKLGATGFWSMMIFLGVLTVGFAYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|222110086|ref|YP_002552350.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           ebreus TPSY]
 gi|221729530|gb|ACM32350.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Acidovorax
           ebreus TPSY]
          Length = 119

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  +++   GF +++VFL IL VGF YEWKKGAL W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE 119


>gi|83311886|ref|YP_422150.1| NADH:ubiquinone oxidoreductase subunit 3 [Magnetospirillum
           magneticum AMB-1]
 gi|82946727|dbj|BAE51591.1| NADH:ubiquinone oxidoreductase subunit 3 [Magnetospirillum
           magneticum AMB-1]
          Length = 121

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PIL+F+ IA  I  + + + +IVA + PD EK + YECGFD F DAR KF+
Sbjct: 1   MEAWLLEYLPILIFLGIAIVISAICVGASWIVARQKPDTEKATAYECGFDAFGDARSKFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMMVFLG+LT+GFIYEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVALGKIGMFGFWSMMVFLGVLTIGFIYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|77166023|ref|YP_344548.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Nitrosococcus oceani ATCC 19707]
 gi|254436330|ref|ZP_05049836.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
 gi|76884337|gb|ABA59018.1| NADH dehydrogenase subunit A [Nitrosococcus oceani ATCC 19707]
 gi|207088020|gb|EDZ65293.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
          Length = 118

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+LVF+ ++  +  V+M+  F +A   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLVFIIVSLLLGGVMMVLGFGLAPYRPDREKTSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVVGFVYEWKKGALEWE 118


>gi|126729548|ref|ZP_01745361.1| NADH dehydrogenase subunit A [Sagittula stellata E-37]
 gi|126709667|gb|EBA08720.1| NADH dehydrogenase subunit A [Sagittula stellata E-37]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILVF+AIA  I +V + +  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVFLAIAIVIGLVFIFAAILVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV F+ I+   F +MMVFLG+LT GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFQHISMTAFWAMMVFLGVLTAGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254560053|ref|YP_003067148.1| NADH-quinone oxidoreductase subunit A [Methylobacterium extorquens
           DM4]
 gi|254267331|emb|CAX23163.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens DM4]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I   L+I+PFIVA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIIFLGVSLFIAAALLIAPFIVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F ++ W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGELGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|163850517|ref|YP_001638560.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium extorquens PA1]
 gi|188580285|ref|YP_001923730.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium populi BJ001]
 gi|218529214|ref|YP_002420030.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium chloromethanicum CM4]
 gi|240137582|ref|YP_002962053.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens AM1]
 gi|163662122|gb|ABY29489.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium extorquens PA1]
 gi|179343783|gb|ACB79195.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium populi BJ001]
 gi|218521517|gb|ACK82102.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methylobacterium chloromethanicum CM4]
 gi|240007550|gb|ACS38776.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           [Methylobacterium extorquens AM1]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L+I+PFIVA+ SPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTGLLADYLPLIIFLGVSLFIAVALLIAPFIVAYSSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+ F ++ W GF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAITFGELGWFGFWSMMIFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|323138145|ref|ZP_08073218.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocystis
           sp. ATCC 49242]
 gi|322396607|gb|EFX99135.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylocystis
           sp. ATCC 49242]
          Length = 121

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y P+++F+A+++ I   L+++PF+ AFK+PDPEKLS YECGF+PF+D+R+KFD
Sbjct: 1   MPMLLEQYLPLVIFIALSAIIAGALLVAPFLFAFKAPDPEKLSAYECGFNPFNDSRMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF++FDLE+AFLFPWAV FK+    GF SMMVFLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVSLLFIVFDLEVAFLFPWAVAFKEAGAFGFWSMMVFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|124266596|ref|YP_001020600.1| NADH dehydrogenase I subunit A [Methylibium petroleiphilum PM1]
 gi|124259371|gb|ABM94365.1| NADH dehydrogenase I chain A [Methylibium petroleiphilum PM1]
          Length = 119

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+++F+ + +A+ I   +  FI     PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LESYLPVILFILVGAAVGIAPQLIGFIFGPHRPDADKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K+I   GF +MMVFLGIL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKEIGAPGFWAMMVFLGILVVGFAYEWKKGALDWE 119


>gi|226348819|gb|ACO50723.1| NADH dehydrogenase subunit 3 [Micromonas pusilla CCMP1545]
          Length = 117

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 94/117 (80%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ YAP+LV++ I++ + ++++   F+ + +  DPEK+S YECGFDPFDDAR +FDIRF 
Sbjct: 1   MSEYAPLLVYLVISATLSVLILSLSFVFSTQKADPEKVSAYECGFDPFDDARGRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWAV    +   GF +MM+FLG+LTVGF+YEW+KGAL+W+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAVSLHNVGPFGFWAMMIFLGVLTVGFVYEWRKGALDWE 117


>gi|160900612|ref|YP_001566194.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Delftia
           acidovorans SPH-1]
 gi|223635451|sp|A9BNB4|NUOA_DELAS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|160366196|gb|ABX37809.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Delftia
           acidovorans SPH-1]
          Length = 119

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ +   + +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILVGMGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  + +   GF ++++FL +L VGF+YEWKKGAL+WD
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALRDVGGAGFAAVLIFLTVLVVGFVYEWKKGALDWD 119


>gi|84502604|ref|ZP_01000723.1| NADH dehydrogenase alpha subunit [Oceanicola batsensis HTCC2597]
 gi|84388999|gb|EAQ01797.1| NADH dehydrogenase alpha subunit [Oceanicola batsensis HTCC2597]
          Length = 121

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 79/120 (65%), Positives = 98/120 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y PILVF+A+A  + +V +I+  I+A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEVMLREYLPILVFLAVAIGLGLVFIIAAVIIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV FK I+ +GF SMMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFKDISMVGFWSMMVFLAVLTVGFAYEWKKGALEW 120


>gi|187477541|ref|YP_785565.1| NADH dehydrogenase I subunit A [Bordetella avium 197N]
 gi|115422127|emb|CAJ48651.1| NADH dehydrogenase I chain A [Bordetella avium 197N]
          Length = 119

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIAVATLIGFALITAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|198284346|ref|YP_002220667.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667509|ref|YP_002427008.1| NADH-quinone oxidoreductase, A subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|223635410|sp|B5EN71|NUOA_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|198248867|gb|ACH84460.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519722|gb|ACK80308.1| NADH-quinone oxidoreductase, A subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 118

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P+L+F+ +A  + +  ++    +    PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLNHYLPVLIFLLVALVVGVAPLLMGSSLGPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV F QI   GF +MM+FL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVFDQIGMTGFLAMMLFLAILVVGFIYEWKKGALEWE 118


>gi|239816483|ref|YP_002945393.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus S110]
 gi|239803060|gb|ACS20127.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Variovorax
           paradoxus S110]
          Length = 119

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   + +   +  +I+    PD  K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDSYLPVLLFILVGVGVGVAPQVIGYILGPNRPDAAKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+  K+I  +GF +MM+FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIALKEIGAVGFWAMMIFLAILVVGFAYEWKKGALDWE 119


>gi|114771816|ref|ZP_01449209.1| NADH dehydrogenase subunit A [alpha proteobacterium HTCC2255]
 gi|114547632|gb|EAU50523.1| NADH dehydrogenase subunit A [alpha proteobacterium HTCC2255]
          Length = 121

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 98/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL +Y PILVF+ +A+ + +VL+++  IVA ++PD EK S YECGF+ FDDAR+KFD
Sbjct: 1   MQDLLMNYLPILVFLGVAAGLGLVLILAAIIVAVRNPDAEKTSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F+    LGF SMM+FL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWATSFQYQGMLGFWSMMIFLVVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|221068612|ref|ZP_03544717.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Comamonas
           testosteroni KF-1]
 gi|220713635|gb|EED69003.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Comamonas
           testosteroni KF-1]
          Length = 119

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ I  A+ +V +   +++    PD  K S YECGF+ FDDAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILIGMAVGVVPLALGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  K +  +GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALKDVGGVGFVAVLIFLAILVVGFAYEWKKGALDWE 119


>gi|293603919|ref|ZP_06686334.1| NADH-quinone oxidoreductase subunit A [Achromobacter piechaudii
           ATCC 43553]
 gi|292817756|gb|EFF76822.1| NADH-quinone oxidoreductase subunit A [Achromobacter piechaudii
           ATCC 43553]
 gi|317401988|gb|EFV82588.1| NADH-ubiquinone oxidoreductase chain A [Achromobacter xylosoxidans
           C54]
          Length = 119

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIVVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|158423291|ref|YP_001524583.1| NADH-ubiquinone dehydrogenase chain A 1 precursor [Azorhizobium
           caulinodans ORS 571]
 gi|158330180|dbj|BAF87665.1| NADH-ubiquinone dehydrogenase chain A 1 precursor [Azorhizobium
           caulinodans ORS 571]
          Length = 121

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L+++PFIVA+++PDPEKLS YECGF+ FDDAR+ FD
Sbjct: 1   MNALLMDYLPVVIFIGVSLVIGLALLVAPFIVAYQNPDPEKLSAYECGFNAFDDARMTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV F  +  LGF SMM+FLG+LTVGF+YEW+KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTFGGLGDLGFWSMMLFLGVLTVGFVYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|89053645|ref|YP_509096.1| NADH dehydrogenase subunit A [Jannaschia sp. CCS1]
 gi|88863194|gb|ABD54071.1| NADH dehydrogenase subunit A [Jannaschia sp. CCS1]
          Length = 121

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LLT YAPIL+F+ +A  + +VL+++  +VA  +PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MTELLTEYAPILIFLGLAIGLALVLILAAVVVAVSNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEIAFLFPWA  F  ++ L F SMMVFLG+LT+GF YEWKKGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEIAFLFPWATAFPGLSDLAFWSMMVFLGVLTIGFAYEWKKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|264677198|ref|YP_003277104.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni CNB-2]
 gi|299530742|ref|ZP_07044157.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni S44]
 gi|262207710|gb|ACY31808.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni CNB-2]
 gi|298721258|gb|EFI62200.1| NADH-ubiquinone/plastoquinone oxidoreductase [Comamonas
           testosteroni S44]
          Length = 119

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+ I  A+ +V ++  +++    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IDQYLPVLLFILIGMAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFL PWAV  K +  +GF ++++FL IL VGF YEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLLPWAVALKDVGGVGFVAVLIFLAILVVGFAYEWKKGALDWE 119


>gi|227821617|ref|YP_002825587.1| NADH dehydrogenase subunit A [Sinorhizobium fredii NGR234]
 gi|227340616|gb|ACP24834.1| NADH dehydrogenase I chain A [Sinorhizobium fredii NGR234]
          Length = 121

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLGSYVPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F ++ W GF SMMVFL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGELGWFGFWSMMVFLLVLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|209964550|ref|YP_002297465.1| NADH-quinone oxidoreductase chain A [Rhodospirillum centenum SW]
 gi|209958016|gb|ACI98652.1| NADH-quinone oxidoreductase chain A [Rhodospirillum centenum SW]
          Length = 122

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 94/121 (77%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++ L+  Y PIL+F+ IA+ + I +M + ++V  ++PD EKLS YECGF+PF DAR KFD
Sbjct: 2   LNPLIVEYLPILIFICIAAGVAISMMAAAYLVGRQNPDSEKLSPYECGFEPFADARSKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV    I   GF SMMVF+GIL +GF YEWKKGALEW
Sbjct: 62  VRFYLVSILFIIFDLEVAFLFPWAVALGDIGMFGFWSMMVFIGILLIGFAYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|292493668|ref|YP_003529107.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
 gi|291582263|gb|ADE16720.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
          Length = 118

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +   I  V+M   F +A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLIFIIVGLLIGGVMMFLGFSLAPHRPDREKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL  GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVAGFVYEWKKGALEWE 118


>gi|227536076|ref|ZP_03966125.1| NADH dehydrogenase (ubiquinone) subunit A [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|300772046|ref|ZP_07081916.1| NADH-quinone oxidoreductase subunit A [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|227243973|gb|EEI93988.1| NADH dehydrogenase (ubiquinone) subunit A [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|300760349|gb|EFK57175.1| NADH-quinone oxidoreductase subunit A [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 198

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 9/125 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+ Y  IL+   +   +V   +    +++ K P+PEKLSTYECG +    A ++F+ RF 
Sbjct: 7   LSEYGKILIIALVGILLVCATIFLAKLISPKKPNPEKLSTYECGEESQGTAWIQFNPRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQI---------TWLGFGSMMVFLGILTVGFIYEWKK 115
           +++++F++FD+E+ F+FPWA  F Q           W     M +FLGIL +G +Y W+K
Sbjct: 67  VIALVFLLFDVELIFVFPWATVFGQSEFINADLRWGWFTMVEMAMFLGILVLGLVYVWRK 126

Query: 116 GALEW 120
           G L+W
Sbjct: 127 GDLDW 131


>gi|311104658|ref|YP_003977511.1| NADH-quinone oxidoreductase subunit A [Achromobacter xylosoxidans
           A8]
 gi|310759347|gb|ADP14796.1| NADH-quinone oxidoreductase subunit A [Achromobacter xylosoxidans
           A8]
          Length = 119

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIVVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  LGF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLLGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|332526747|ref|ZP_08402849.1| NADH dehydrogenase I subunit A [Rubrivivax benzoatilyticus JA2]
 gi|332111150|gb|EGJ11182.1| NADH dehydrogenase I subunit A [Rubrivivax benzoatilyticus JA2]
          Length = 119

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y P+++F+ +  A+ +   +  FI     PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   IQAYLPVILFVLVGLAVGVAPQVLGFIFGPNRPDVEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV    I   GF +MM+FLGIL VGF+YEWKKGAL+WD
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALHDIGATGFWAMMLFLGILVVGFVYEWKKGALDWD 119


>gi|254468438|ref|ZP_05081844.1| NADH-ubiquinone oxidoreductase chain 3 [beta proteobacterium KB13]
 gi|207087248|gb|EDZ64531.1| NADH-ubiquinone oxidoreductase chain 3 [beta proteobacterium KB13]
          Length = 118

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+F+ +   + I  ++   I+A   P+ +K S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLDSYFPVLLFILVGLGVGIGPLVLGKILAPHKPNDQKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEI FLFPWAV    +   GF  MM+FLGIL VGFIYEWKKGAL+W+
Sbjct: 61  YLVAILFILFDLEITFLFPWAVVLDSLGLQGFIVMMIFLGILVVGFIYEWKKGALDWE 118


>gi|88812976|ref|ZP_01128219.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrococcus
           mobilis Nb-231]
 gi|88789754|gb|EAR20878.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrococcus
           mobilis Nb-231]
          Length = 118

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PILVF+ IA    +  +++  ++A + PD  KLS YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLESYLPILVFLVIAGFAGLAPLVAGLVLAPRRPDENKLSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   Q+   GF +M +F+GIL +GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDQVGLFGFVAMAIFVGILLIGFLYEWKKGALEWE 118


>gi|226939456|ref|YP_002794529.1| NADH-quinone oxidoreductase subunit [Laribacter hongkongensis
           HLHK9]
 gi|226714382|gb|ACO73520.1| NADH-quinone oxidoreductase subunit [Laribacter hongkongensis
           HLHK9]
          Length = 118

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 93/118 (78%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ I   + +V ++   +++   PDPEK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFVIIGIMVGVVPILLGKLISPNRPDPEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  ++I   GFG+M+VFL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLREIGMFGFGAMLVFLAILVVGFIYEWKKGALEWE 118


>gi|162148811|ref|YP_001603272.1| NADH-ubiquinone oxidoreductase chain 3 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545441|ref|YP_002277670.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787388|emb|CAP56983.1| putative NADH-ubiquinone oxidoreductase chain 3 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533118|gb|ACI53055.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 121

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 87/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  Y P+L+F  +A  I   ++ S  +   + P  EK+S YECGFD FDDAR +FD
Sbjct: 1   MQSVLADYFPVLIFGVLAVVIAGAMLGSCLLFGHQKPYAEKVSAYECGFDAFDDARHRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I   GF SMM FLGILTVGFIYEW KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLSRIGLFGFLSMMGFLGILTVGFIYEWCKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|300113265|ref|YP_003759840.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Nitrosococcus watsonii C-113]
 gi|299539202|gb|ADJ27519.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           watsonii C-113]
          Length = 118

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+LVF+ ++  +  V+M+  F +A   PD EK+S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYIPVLVFIIVSLLLGGVMMVLGFGLAPYRPDREKISPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   GF SM+VFL IL VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDDIGLFGFFSMVVFLAILVVGFVYEWKKGALEWE 118


>gi|330994054|ref|ZP_08317984.1| NADH-quinone oxidoreductase subunit A [Gluconacetobacter sp.
           SXCC-1]
 gi|329759000|gb|EGG75514.1| NADH-quinone oxidoreductase subunit A [Gluconacetobacter sp.
           SXCC-1]
          Length = 121

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  ++  Y P+L+F  IA  I   ++ S  +   + P  EK S YECGF+ FDDAR +FD
Sbjct: 1   MHSVIADYLPVLIFGCIAVVIAGAMLGSSLLFGHQKPYAEKTSAYECGFEAFDDARHRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I W GF SMM FLG+L VGFIYEW KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWALSLSRIGWFGFASMMGFLGVLVVGFIYEWSKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|313200458|ref|YP_004039116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. MP688]
 gi|312439774|gb|ADQ83880.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. MP688]
          Length = 120

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 92/119 (77%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           ++L +Y PIL+F+ +  A+ I  ++   +VA   PD EK S YECGF+ F+DAR+KFD+R
Sbjct: 2   NMLENYFPILLFIIVGLAVGIAPIVLGKVVAPSRPDAEKNSPYECGFEAFEDARMKFDVR 61

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + LV++LF++FDLEIAFLFPWAV  ++I   GF +M+VFLGIL VGF+YEW KGALEW+
Sbjct: 62  YYLVAILFILFDLEIAFLFPWAVVLQEIGLFGFIAMLVFLGILVVGFVYEWMKGALEWE 120


>gi|157828359|ref|YP_001494601.1| NADH dehydrogenase subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800840|gb|ABV76093.1| NADH dehydrogenase subunit A [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 176

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI 
Sbjct: 59  ELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIC 118

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 119 FYLVAILFIIFDLEIAFLVPWAISLNTIGQIGFFSMMFFLFVLIIGFIYEWKKGALDW 176


>gi|146278044|ref|YP_001168203.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides ATCC 17025]
 gi|145556285|gb|ABP70898.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 139

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 75/120 (62%), Positives = 95/120 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  + PI++   +A  + ++LM+S  IVA ++PDPEK+S YECGF+ FDDAR+KF+
Sbjct: 19  MDDLLREFLPIVILTVLAGGLGLLLMLSAVIVAVRNPDPEKVSAYECGFNAFDDARMKFE 78

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 79  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMVFLAVLTVGFAYEWKKGALEW 138


>gi|239947490|ref|ZP_04699243.1| NADH-quinone oxidoreductase subunit A [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921766|gb|EER21790.1| NADH-quinone oxidoreductase subunit A [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 133

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF D R KFDI
Sbjct: 15  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDTRSKFDI 74

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 75  RFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 133


>gi|91776413|ref|YP_546169.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Methylobacillus flagellatus KT]
 gi|91710400|gb|ABE50328.1| NADH dehydrogenase subunit A [Methylobacillus flagellatus KT]
          Length = 118

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++   +V+   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFIIVGLVVGVAPIVLGKLVSPNRPDAEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +MMVFLGIL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLQEIGLFGFLAMMVFLGILVVGFVYEWMKGALEWE 118


>gi|253998383|ref|YP_003050446.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. SIP3-4]
 gi|253985062|gb|ACT49919.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylovorus
           sp. SIP3-4]
          Length = 118

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A+ I  ++   +VA   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFIIVGLAVGIAPIVLGKVVAPSRPDAEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +M+VFLGIL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLQEIGLFGFIAMLVFLGILVVGFVYEWMKGALEWE 118


>gi|153875119|ref|ZP_02003054.1| NADH dehydrogenase I chain A [Beggiatoa sp. PS]
 gi|152068416|gb|EDN66945.1| NADH dehydrogenase I chain A [Beggiatoa sp. PS]
          Length = 118

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y PIL+F+ I   I + L    F++  + PDPEK STYECGF+ F+DAR+KFD+R+
Sbjct: 1   MLSEYFPILLFIMIGIVIGVALPTLGFLLGPRQPDPEKNSTYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV FK +   GF +MM+FL IL +GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVFKDLGLFGFIAMMIFLAILVIGFIYEWKKGALEWE 118


>gi|254438072|ref|ZP_05051566.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Octadecabacter antarcticus 307]
 gi|198253518|gb|EDY77832.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Octadecabacter antarcticus 307]
          Length = 118

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 73/118 (61%), Positives = 98/118 (83%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PI++F+ +A  +  VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPIIIFLGLAIVLGAVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV F +I+ +GF SMM+FL +LTVGF YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVAFGEISMVGFWSMMIFLAVLTVGFAYEWKKGALEWE 118


>gi|310816716|ref|YP_003964680.1| NADH dehydrogenase subunit A [Ketogulonicigenium vulgare Y25]
 gi|308755451|gb|ADO43380.1| NADH dehydrogenase subunit A [Ketogulonicigenium vulgare Y25]
          Length = 121

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+F+ +A+ + I+L+++  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MGQLLQDYLPILIFLGLATVLGIILILAAVVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F SMMVFL +LT+GF+YEW+KGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFAGMSMVSFWSMMVFLAVLTIGFVYEWRKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|121998544|ref|YP_001003331.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Halorhodospira halophila SL1]
 gi|121589949|gb|ABM62529.1| NADH dehydrogenase subunit A [Halorhodospira halophila SL1]
          Length = 118

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     ++ + + F++  +  DPEK S YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLENYLPVLLFIVVGLVFGVLPLAAGFVLGPRREDPEKQSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV    I   G  +M +F+G+L +G +YEW+KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLDDIGLFGILAMGLFVGLLVIGLLYEWRKGALEWE 118


>gi|157964437|ref|YP_001499261.1| NADH dehydrogenase subunit A [Rickettsia massiliae MTU5]
 gi|157844213|gb|ABV84714.1| NADH dehydrogenase I chain A [Rickettsia massiliae MTU5]
          Length = 177

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 59  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 118

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 119 RFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 177


>gi|119384982|ref|YP_916038.1| NADH dehydrogenase subunit A [Paracoccus denitrificans PD1222]
 gi|119374749|gb|ABL70342.1| NADH dehydrogenase subunit A [Paracoccus denitrificans PD1222]
          Length = 121

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 77/120 (64%), Positives = 98/120 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +ASA+ IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F  MMVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASLSDVAFWGMMVFLAVLTVGFAYEWKKGALEW 120


>gi|124515816|gb|EAY57325.1| putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           rubarum]
 gi|206602060|gb|EDZ38542.1| Putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           sp. Group II '5-way CG']
          Length = 123

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 76/116 (65%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PI +F+ +A     V +    ++  ++P  +K + YECG  P +DAR +F +R+ +
Sbjct: 8   EHYVPIFLFLLVAIGFGAVSLTVGRLIRPRNPYKDKNAPYECGVPPINDARERFSVRYYV 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++LF++FD+E+ FL+PWAV F ++   G   MM+F+ IL VG++Y WKK ALEW+
Sbjct: 68  IAMLFLVFDVEVVFLYPWAVDFGRLGLFGLVEMMIFIFILLVGYVYAWKKEALEWE 123


>gi|33592007|ref|NP_879651.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella pertussis Tohama
           I]
 gi|33597911|ref|NP_885554.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella parapertussis
           12822]
 gi|33602816|ref|NP_890376.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella bronchiseptica
           RB50]
 gi|33571651|emb|CAE41144.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           pertussis Tohama I]
 gi|33574340|emb|CAE38676.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           parapertussis]
 gi|33577258|emb|CAE35815.1| probable NADH-ubiquinone oxidoreductase chain 3 [Bordetella
           bronchiseptica RB50]
 gi|332381423|gb|AEE66270.1| NADH-ubiquinone oxidoreductase chain 3 [Bordetella pertussis CS]
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 90/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LHPYFPVLLFILVATLIGFALLTAGSLLGPRRPYAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|325292632|ref|YP_004278496.1| NADH dehydrogenase I, A subunit [Agrobacterium sp. H13-3]
 gi|325060485|gb|ADY64176.1| NADH dehydrogenase I, A subunit [Agrobacterium sp. H13-3]
          Length = 121

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 83/120 (69%), Positives = 102/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VA+K+PDPEKLS +ECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAYKAPDPEKLSAFECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  + W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGDMGWFGFWSMMVFLAVLTIGFIYEWKKGALEW 120


>gi|223635539|sp|Q21YC7|NUOA_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y PI +F+ +   + +   +  +I+    PD  K S YECGF+ F DAR+KFD+R+ 
Sbjct: 3   LDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV  K I  LGF S+MVFL IL VGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE 119


>gi|21673596|ref|NP_661661.1| NADH dehydrogenase I, subunit 3 [Chlorobium tepidum TLS]
 gi|81791548|sp|Q8KEC3|NUOA_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|21646710|gb|AAM72003.1| NADH dehydrogenase I, subunit 3 [Chlorobium tepidum TLS]
          Length = 143

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V+   ++  ++    P+PEK STYECG      A VKF+
Sbjct: 1   MDQTLSGFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNPEKNSTYECGEHAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+       +++F+GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGAFALVEVLIFVGILVLGLVYAWVKGDLDW 120


>gi|15888597|ref|NP_354278.1| NADH dehydrogenase subunit A [Agrobacterium tumefaciens str. C58]
 gi|15156317|gb|AAK87063.1| NADH ubiquinone oxidoreductase chain A [Agrobacterium tumefaciens
           str. C58]
          Length = 121

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 83/120 (69%), Positives = 103/120 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VA+K+PDPEKLS +ECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAYKAPDPEKLSAFECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F ++ W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGEMGWFGFWSMMVFLAVLTIGFIYEWKKGALEW 120


>gi|251773167|gb|EES53720.1| putative NADH dehydrogenase (ubiquinone), subunit A [Leptospirillum
           ferrodiazotrophum]
          Length = 123

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 77/116 (66%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PIL+F+ IA     V ++   ++   +P  +K + YECG  P +DAR +  IR+ +
Sbjct: 8   DHYIPILIFLLIAIGFGAVSLLVGRLIRPNNPYRDKDAPYECGVPPINDARERISIRYYV 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++LF++FD+E+ FL+PWAV F+++   G   M++FL IL VG++Y WKK ALEW+
Sbjct: 68  IAMLFLVFDVEVVFLYPWAVDFRRLGLFGLVEMLIFLVILIVGYVYAWKKEALEWE 123


>gi|163855987|ref|YP_001630285.1| NADH-ubiquinone oxidoreductase chain A [Bordetella petrii DSM
           12804]
 gi|163259715|emb|CAP42016.1| NADH-ubiquinone oxidoreductase chain A [Bordetella petrii]
          Length = 119

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+A+ I   L+ +  ++  + P  EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIAVATLIGFALLTAGSLLGPRRPYAEKLSAYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    +  +GF ++MVFL +LTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAIAHGAVGLVGFWTVMVFLAVLTVGFIYEWKKGALDWE 119


>gi|34496088|ref|NP_900303.1| NADH dehydrogenase I chain A [Chromobacterium violaceum ATCC 12472]
 gi|34101942|gb|AAQ58309.1| NADH dehydrogenase I chain A [Chromobacterium violaceum ATCC 12472]
          Length = 119

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 91/119 (76%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + ++ M+    +    PDPEKLS YECGF+ F+DAR++FD+R+
Sbjct: 1   MLENYFPILLFIVVGLLVGVLPMMLGRFLGPNRPDPEKLSPYECGFEAFEDARMRFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV  + ++   G G+M VFLGILT+GF+YEWKKGAL+WD
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVTLRDELGLFGLGAMAVFLGILTIGFVYEWKKGALQWD 119


>gi|325135044|gb|EGC57672.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M13399]
          Length = 118

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K   PEK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYPEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGVYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|190891285|ref|YP_001977827.1| NADH-ubiquinone oxidoreductase, chain A [Rhizobium etli CIAT 652]
 gi|190696564|gb|ACE90649.1| NADH-ubiquinone oxidoreductase protein, chain A [Rhizobium etli
           CIAT 652]
          Length = 121

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|319779198|ref|YP_004130111.1| NADH ubiquinone oxidoreductase chain A [Taylorella equigenitalis
           MCE9]
 gi|317109222|gb|ADU91968.1| NADH ubiquinone oxidoreductase chain A [Taylorella equigenitalis
           MCE9]
          Length = 118

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   Y P+L+F+ IA+     L+ +  ++    PD EK S YECGF  F+DAR++FD+R+
Sbjct: 1   MTAEYFPVLLFIVIATVFGAFLVFTGAMLGPHKPDSEKNSPYECGFVAFEDARMRFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AFLFPWA+    I  +GFG+ ++FL ILTVGF+YEW+KGAL+WD
Sbjct: 61  YLVAILFILFDLELAFLFPWAIANDHIGLVGFGTALLFLFILTVGFVYEWRKGALDWD 118


>gi|225077016|ref|ZP_03720215.1| hypothetical protein NEIFLAOT_02068 [Neisseria flavescens
           NRL30031/H210]
 gi|224951573|gb|EEG32782.1| hypothetical protein NEIFLAOT_02068 [Neisseria flavescens
           NRL30031/H210]
          Length = 118

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|153207264|ref|ZP_01946028.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161830456|ref|YP_001597293.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           331]
 gi|165918809|ref|ZP_02218895.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           334]
 gi|223635508|sp|A9N8X3|NUOA_COXBR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|120576752|gb|EAX33376.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii 'MSU
           Goat Q177']
 gi|161762323|gb|ABX77965.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           331]
 gi|165917533|gb|EDR36137.1| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           334]
          Length = 118

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ I+  I ++ +   +    + PD  KLS YECGF+ F DAR+ FD+RF
Sbjct: 1   MLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I W GF +MMVFL IL VGFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE 118


>gi|289207893|ref|YP_003459959.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. K90mix]
 gi|288943524|gb|ADC71223.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. K90mix]
          Length = 118

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+A+   I IV ++    V  + PD  K S YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLEGYLPILLFIAVGIVIGIVPLVVGMAVGPRKPDAAKNSPYECGFEAFEDSRLKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   G  +M VFL IL VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVSLDAIGLFGLLAMAVFLLILVVGFIYEWKKGALEWE 118


>gi|330813982|ref|YP_004358221.1| NADH ubiquinone oxidoreductase chain A [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487077|gb|AEA81482.1| NADH ubiquinone oxidoreductase chain A [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 122

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 67/120 (55%), Positives = 91/120 (75%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++ L  YA IL+F+ I+  +    +   F+ +  +PD EKLS YECGF+ F D+R+KFD+
Sbjct: 3   TEFLRDYATILIFLFISIGLGFGFIFVNFLFSPSNPDTEKLSAYECGFEAFSDSRMKFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLE+AFLFPWAV   Q+  LGF SMM+FL +LT+GFIYEWKKGAL+W+
Sbjct: 63  RFYLVAILFIIFDLEVAFLFPWAVTLGQLGPLGFWSMMIFLTVLTIGFIYEWKKGALDWE 122


>gi|16126199|ref|NP_420763.1| NADH dehydrogenase subunit A [Caulobacter crescentus CB15]
 gi|221234970|ref|YP_002517406.1| NADH dehydrogenase subunit A [Caulobacter crescentus NA1000]
 gi|13423415|gb|AAK23931.1| NADH dehydrogenase I, A subunit [Caulobacter crescentus CB15]
 gi|220964142|gb|ACL95498.1| NADH-quinone oxidoreductase chain A [Caulobacter crescentus NA1000]
          Length = 125

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 77/125 (61%), Positives = 98/125 (78%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+AI IV +++  ++A K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTAFLLQYLPIVIFLGIAAAIGIVFLLAAAVLAPKAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT----WLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV   ++        F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVTLMKLPQDVAQFAFWSMMTFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|255263222|ref|ZP_05342564.1| NADH-quinone oxidoreductase subunit a [Thalassiobium sp. R2A62]
 gi|255105557|gb|EET48231.1| NADH-quinone oxidoreductase subunit a [Thalassiobium sp. R2A62]
          Length = 121

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PI+VF+ +A A+ ++L+ +  +VA ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEALLAEYLPIIVFLGLAIALGLILIAAAAVVAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV FK+I+ +GF SMMVFLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFKEISMVGFWSMMVFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|319408579|emb|CBI82234.1| NADH dehydrogenase I chain A [Bartonella schoenbuchensis R1]
          Length = 121

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I   L+I+P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTHLLSSYLPVLIFIIVSAVIAGALLITPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLEIAFLFPWAV F  I  LGF SMM+FL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEIAFLFPWAVSFGSIGMLGFWSMMMFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|49474177|ref|YP_032219.1| NADH dehydrogenase subunit A [Bartonella quintana str. Toulouse]
 gi|49239681|emb|CAF26056.1| NADH dehydrogenase I, A subunit [Bartonella quintana str. Toulouse]
          Length = 121

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+ +F+ +++ I  VL+I P++VA++SPDPEKLS YECGF+ F+DAR+KFD
Sbjct: 1   MTHLLSSYLPVFIFIVVSAVIAGVLLIMPYLVAYRSPDPEKLSAYECGFNSFNDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL +LTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGSIGMFGFWSMIIFLALLTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|78485162|ref|YP_391087.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Thiomicrospira crunogena XCL-2]
 gi|78363448|gb|ABB41413.1| NADH dehydrogenase I chain A [Thiomicrospira crunogena XCL-2]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ +     +  ++  +++  + PD EKLS YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLENYLPILVFVVLGILFGVGPILMGYLLGPQRPDAEKLSPYECGFEVFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV  +++   G  +M VFL +L VGFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALEEVGTFGLLAMGVFLTLLVVGFIYEWKKGALEWE 118


>gi|329114678|ref|ZP_08243437.1| NADH-quinone oxidoreductase subunit A 1 [Acetobacter pomorum DM001]
 gi|326696158|gb|EGE47840.1| NADH-quinone oxidoreductase subunit A 1 [Acetobacter pomorum DM001]
          Length = 127

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 62/121 (51%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  YAP+LVF  ++  I   ++    +   + P  EKL+ YECGF+ FDDAR +FD
Sbjct: 7   MQSVLGDYAPVLVFGGMSVIIAAAMLGMALLSGHQKPYSEKLTAYECGFEAFDDARRRFD 66

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I   GF SM+ FL +L +GF+YEW+KGAL+W
Sbjct: 67  VRFYLVAILFIIFDLEVAFLFPWAITLGRIGLFGFLSMLGFLAVLGIGFLYEWRKGALDW 126

Query: 121 D 121
           D
Sbjct: 127 D 127


>gi|315122726|ref|YP_004063215.1| NADH dehydrogenase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496128|gb|ADR52727.1| NADH dehydrogenase subunit A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 121

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 110/121 (90%), Positives = 117/121 (96%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+DLLTSYAPILVF+AIASAIVI LMISPF+VAFKSPDPEKLSTYECGFDPFD A +KFD
Sbjct: 1   MNDLLTSYAPILVFIAIASAIVIALMISPFLVAFKSPDPEKLSTYECGFDPFDSAHMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RFCLVSVLF+IFDLEIAFLFPWAVYFK+I WLGFGSMMVFLGILTVGFIYEWKKGALEW
Sbjct: 61  VRFCLVSVLFIIFDLEIAFLFPWAVYFKKIGWLGFGSMMVFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|266657|sp|P29919|NQO7_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 7; AltName:
           Full=NADH dehydrogenase I subunit 7; AltName: Full=NDH-1
           subunit 7
 gi|150620|gb|AAA03035.1| NADH dehydrogenase [Paracoccus denitrificans]
          Length = 121

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 76/120 (63%), Positives = 98/120 (81%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PILVF+ +ASA+ IVL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  ++ + F  +MVFL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASLSDVAFWGLMVFLAVLTVGFAYEWKKGALEW 120


>gi|261400469|ref|ZP_05986594.1| NADH dehydrogenase, A subunit [Neisseria lactamica ATCC 23970]
 gi|313669286|ref|YP_004049570.1| NADH dehydrogenase I chain A [Neisseria lactamica ST-640]
 gi|269209728|gb|EEZ76183.1| NADH dehydrogenase, A subunit [Neisseria lactamica ATCC 23970]
 gi|313006748|emb|CBN88218.1| NADH dehydrogenase I chain A [Neisseria lactamica 020-06]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|302879342|ref|YP_003847906.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gallionella
           capsiferriformans ES-2]
 gi|302582131|gb|ADL56142.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gallionella
           capsiferriformans ES-2]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +  A  +V ++   + A   PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLLFICVGLAFGVVPIVLGRLAAPHRPDAKKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  K+I   G+ SMM+FL IL VGF+YEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLKEIGMFGYVSMMIFLAILVVGFVYEWMKGALEWE 118


>gi|295689629|ref|YP_003593322.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Caulobacter
           segnis ATCC 21756]
 gi|295431532|gb|ADG10704.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Caulobacter
           segnis ATCC 21756]
          Length = 125

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 77/125 (61%), Positives = 98/125 (78%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+AI IV +++  ++A K+PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTAFLLQYLPIVIFLGIAAAIGIVFLLAAAVLAPKAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITW----LGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV   ++        F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVTLMKLPHDVAQFAFWSMMAFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|309379803|emb|CBX21579.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 118

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|294624678|ref|ZP_06703348.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601034|gb|EFF45101.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 133

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|193212958|ref|YP_001998911.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobaculum
           parvum NCIB 8327]
 gi|223635436|sp|B3QP58|NUOA_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|193086435|gb|ACF11711.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobaculum
           parvum NCIB 8327]
          Length = 144

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  + VF+ +    V+   ++  ++    P+ EKLSTYECG      A VKF+
Sbjct: 1   MDQTLSNFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNEEKLSTYECGEPAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+       +++F GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGMFALVEVLIFAGILVLGLVYAWVKGDLDW 120


>gi|121602445|ref|YP_989070.1| NADH dehydrogenase subunit A [Bartonella bacilliformis KC583]
 gi|120614622|gb|ABM45223.1| NADH dehydrogenase (quinone), A subunit [Bartonella bacilliformis
           KC583]
          Length = 121

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL SY P+LVF+ +++ IV VL++ P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTHLLGSYLPVLVFIIVSAVIVGVLLVMPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL IL +GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFHSIGMFGFWSMILFLAILMIGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|190575278|ref|YP_001973123.1| NADH dehydrogenase subunit A [Stenotrophomonas maltophilia K279a]
 gi|190013200|emb|CAQ46833.1| putative NADH dehydrogenase I chain A [Stenotrophomonas maltophilia
           K279a]
          Length = 134

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 17  VLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 76

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 77  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 134


>gi|114569905|ref|YP_756585.1| NADH dehydrogenase subunit A [Maricaulis maris MCS10]
 gi|114340367|gb|ABI65647.1| NADH dehydrogenase subunit A [Maricaulis maris MCS10]
          Length = 122

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 74/122 (60%), Positives = 96/122 (78%), Gaps = 1/122 (0%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+F AIA+ I I  M++ F++A   PDPEK+STYECGF+ FDDAR+KFD
Sbjct: 1   MDALLLEYLPILIFFAIAAVIGIGFMVAAFVIAPSRPDPEKVSTYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           +RF LV++LF+IFDLE+AFLFPWAV  ++ +    F SMMVFL +LT+GF+YE KKGAL+
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVTLREHLGQFEFWSMMVFLTVLTIGFVYELKKGALD 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|91789116|ref|YP_550068.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Polaromonas
           sp. JS666]
 gi|91698341|gb|ABE45170.1| NADH dehydrogenase subunit A [Polaromonas sp. JS666]
          Length = 119

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   + +V  +   ++    PD EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGVGVGVVPQVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLEIAFLFPWAV  K++  +GF S+M+FLGIL VGF+YEWKKGAL+W+
Sbjct: 63  LIAILFILFDLEIAFLFPWAVALKEVGSVGFWSVMIFLGILVVGFVYEWKKGALDWE 119


>gi|15892408|ref|NP_360122.1| NADH dehydrogenase subunit A [Rickettsia conorii str. Malish 7]
 gi|34580590|ref|ZP_00142070.1| NADH dehydrogenase I chain A [Rickettsia sibirica 246]
 gi|229586624|ref|YP_002845125.1| NADH dehydrogenase subunit A [Rickettsia africae ESF-5]
 gi|15619559|gb|AAL03023.1| NADH dehydrogenase I chain A [Rickettsia conorii str. Malish 7]
 gi|28261975|gb|EAA25479.1| NADH dehydrogenase I chain A [Rickettsia sibirica 246]
 gi|228021674|gb|ACP53382.1| NADH dehydrogenase I chain A [Rickettsia africae ESF-5]
          Length = 132

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 86/119 (72%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 14  SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 73

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 74  CFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 132


>gi|260219922|emb|CBA26938.1| NADH-quinone oxidoreductase subunit A [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 130

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+A+  A+ ++  ++ +I+    PDP K S YECGF+PF DAR++F++RF 
Sbjct: 13  LEQYLPVLLFIAVGLAVGVLPQLAGYILGPSRPDPAKGSAYECGFEPFGDARMQFNVRFY 72

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWA+  K+I   GF + MVFLGIL +GF YEW KGA++W+
Sbjct: 73  LVAILFIIFDLEIAFLFPWALALKEIGLPGFIAGMVFLGILCIGFAYEWAKGAMDWE 129


>gi|165933067|ref|YP_001649856.1| NADH:ubiquinone oxidoreductase subunit A [Rickettsia rickettsii
           str. Iowa]
 gi|165908154|gb|ABY72450.1| NADH-quinone oxidoreductase chain A [Rickettsia rickettsii str.
           Iowa]
          Length = 177

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI 
Sbjct: 60  ELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIC 119

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 120 FYLVAILFIIFDLEIAFLVPWAISLNTIGQIGFFSMMFFLFVLIIGFIYEWKKGALDW 177


>gi|319638814|ref|ZP_07993572.1| NADH-quinone oxidoreductase subunit [Neisseria mucosa C102]
 gi|317399718|gb|EFV80381.1| NADH-quinone oxidoreductase subunit [Neisseria mucosa C102]
          Length = 118

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKHHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGTYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|148259932|ref|YP_001234059.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Acidiphilium
           cryptum JF-5]
 gi|326403114|ref|YP_004283195.1| NADH-quinone oxidoreductase subunit A [Acidiphilium multivorum
           AIU301]
 gi|146401613|gb|ABQ30140.1| NADH dehydrogenase subunit A [Acidiphilium cryptum JF-5]
 gi|325049975|dbj|BAJ80313.1| NADH-quinone oxidoreductase subunit A [Acidiphilium multivorum
           AIU301]
          Length = 121

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ Y PILVF+ IA+ +    +I   +VA ++P  EKLS YECGF PF DAR KFD
Sbjct: 1   MQSDLSVYFPILVFIGIAALLGAAFIIGSLVVARQNPYGEKLSAYECGFAPFSDARRKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ LV++LF+IFD+EIAFLFPWAV   +I  LGF SMM FL IL VGFIYEW+KGAL+W
Sbjct: 61  VRYYLVAILFIIFDVEIAFLFPWAVSLSRIGALGFWSMMGFLAILVVGFIYEWRKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|154248552|ref|YP_001419510.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xanthobacter
           autotrophicus Py2]
 gi|154162637|gb|ABS69853.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xanthobacter
           autotrophicus Py2]
          Length = 121

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 76/121 (62%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y P+++F+ ++  I + L++SPF+VA+++PDPEKLS YECGF+ FDDAR+ FD
Sbjct: 1   MNALLMDYLPVVIFIGVSLVIGLALLVSPFLVAYQNPDPEKLSAYECGFNAFDDARMTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            RF LV++LF+IFDLE+AFLFPWA+ F  +  LGF SMM FLG+LTVGFIYEW+KGALEW
Sbjct: 61  ARFYLVAILFIIFDLEVAFLFPWAIMFGGLGDLGFWSMMTFLGVLTVGFIYEWRKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|294677054|ref|YP_003577669.1| NADH-quinone oxidoreductase subunit A [Rhodobacter capsulatus SB
           1003]
 gi|294475874|gb|ADE85262.1| NADH-quinone oxidoreductase, A subunit [Rhodobacter capsulatus SB
           1003]
          Length = 126

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 72/117 (61%), Positives = 93/117 (79%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILV +A+A  + ++L+    I+A+++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 9   MLREYLPILVLLAMAIGLALILIPPAAIIAYRNPDPEKVSAYECGFNAFDDARMKFDVRF 68

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+I DLE+AFLFPWAV F  ++   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 69  YLVSILFIISDLEVAFLFPWAVAFGDMSMTAFWSMMVFLSVLTVGFAYEWKKGALEW 125


>gi|149202674|ref|ZP_01879646.1| NADH dehydrogenase subunit A [Roseovarius sp. TM1035]
 gi|149143956|gb|EDM31990.1| NADH dehydrogenase subunit A [Roseovarius sp. TM1035]
          Length = 118

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 71/117 (60%), Positives = 95/117 (81%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAIGLGLVLILAAVVLAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+IFDLEIA LFPWAV F+ ++   F SMMVFL +LT GF YEW+KGA+EW
Sbjct: 61  YLVSILFIIFDLEIALLFPWAVAFQDLSMTAFWSMMVFLAVLTAGFAYEWRKGAMEW 117


>gi|319404259|emb|CBI77852.1| NADH dehydrogenase I chain A [Bartonella rochalimae ATCC BAA-1498]
          Length = 121

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL SY P+L+F+ ++  I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLNSYLPVLIFIIVSVIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFSSIGIFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|194366604|ref|YP_002029214.1| NADH dehydrogenase subunit A [Stenotrophomonas maltophilia R551-3]
 gi|194349408|gb|ACF52531.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Stenotrophomonas maltophilia R551-3]
          Length = 134

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 17  VLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 76

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 77  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLITMGLFVGMLFLGFIYVWKKGALEWE 134


>gi|163868373|ref|YP_001609582.1| NADH dehydrogenase subunit A [Bartonella tribocorum CIP 105476]
 gi|161018029|emb|CAK01587.1| NADH dehydrogenase I chain A [Bartonella tribocorum CIP 105476]
          Length = 121

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 83/121 (68%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I  VL+I+P+IVA++SPDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MAYLLSSYLPVLIFIIVSAVIAGVLLITPYIVAYRSPDPEKLSAYECGFNSFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV FK I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFKSIGMFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|78048409|ref|YP_364584.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294666777|ref|ZP_06732011.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|78036839|emb|CAJ24532.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|292603438|gb|EFF46855.1| NADH dehydrogenase alpha subunit [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 133

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|121634113|ref|YP_974358.1| NADH dehydrogenase I chain A [Neisseria meningitidis FAM18]
 gi|120865819|emb|CAM09551.1| NADH dehydrogenase I chain A [Neisseria meningitidis FAM18]
 gi|308388461|gb|ADO30781.1| NADH dehydrogenase I chain A [Neisseria meningitidis alpha710]
          Length = 118

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAASVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|113170489|ref|YP_717280.1| nad3/ndhC [Ostreococcus tauri]
 gi|112806896|emb|CAL36402.1| unnamed protein product [Ostreococcus tauri]
          Length = 117

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y PIL+++ +++ +  V++   F+VA +  DPEK S YECGFDPF+DAR +FDIRF 
Sbjct: 1   MIEYLPILLYICVSALLSGVILSLSFLVATQKADPEKTSAYECGFDPFEDARARFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWA+  + I   GF +MMVFL ILTVGF+YEW+KGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAISLRHIDLFGFWTMMVFLIILTVGFVYEWRKGALEWE 117


>gi|332285017|ref|YP_004416928.1| NADH dehydrogenase I chain A [Pusillimonas sp. T7-7]
 gi|330428970|gb|AEC20304.1| NADH dehydrogenase I chain A [Pusillimonas sp. T7-7]
          Length = 119

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+  A+ I   L+ +  ++    P  EKLS YECGF+ F D+R+KFD+R+ 
Sbjct: 3   LQQYFPVLLFIIFATCIGFALLGAGRLLGPHRPYDEKLSQYECGFEAFGDSRMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWA+    I  +GF +++VFL ILTVGFIYEWKKGAL+W+
Sbjct: 63  LVAILFIMFDLEIAFLFPWAMANGTIGMVGFWTVLVFLAILTVGFIYEWKKGALDWE 119


>gi|189346373|ref|YP_001942902.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           limicola DSM 245]
 gi|223635435|sp|B3EI93|NUOA_CHLL2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189340520|gb|ACD89923.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           limicola DSM 245]
          Length = 143

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+A+    V    ++  ++    P+PEK STYECG +    A VKF+
Sbjct: 1   MDQTLSGFGNVFVFLALGIVFVAGGYLTARMLRPSRPNPEKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALFEALVFAGILILGLAYAWVKGDLDW 120


>gi|325130969|gb|EGC53696.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           OX99.30304]
 gi|325145305|gb|EGC67583.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240013]
 gi|325205326|gb|ADZ00779.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M04-240196]
          Length = 118

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGVYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|254805717|ref|YP_003083938.1| NADH-ubiquinone oxidoreductase chain 3 [Neisseria meningitidis
           alpha14]
 gi|254669259|emb|CBA08157.1| NADH-ubiquinone oxidoreductase chain 3 [Neisseria meningitidis
           alpha14]
          Length = 118

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK++   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKELGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|161870823|ref|YP_001599996.1| NADH dehydrogenase I chain A [Neisseria meningitidis 053442]
 gi|194099647|ref|YP_002002778.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae NCCP11945]
 gi|218767069|ref|YP_002341581.1| NADH dehydrogenase I chain A [Neisseria meningitidis Z2491]
 gi|239999844|ref|ZP_04719768.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae 35/02]
 gi|240015003|ref|ZP_04721916.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae DGI18]
 gi|240017451|ref|ZP_04723991.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA6140]
 gi|240081590|ref|ZP_04726133.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA19]
 gi|240113872|ref|ZP_04728362.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae MS11]
 gi|240116603|ref|ZP_04730665.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID18]
 gi|240118827|ref|ZP_04732889.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID1]
 gi|240122072|ref|ZP_04735034.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID24-1]
 gi|240124366|ref|ZP_04737322.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae PID332]
 gi|240126578|ref|ZP_04739464.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae SK-92-679]
 gi|240129043|ref|ZP_04741704.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae SK-93-1035]
 gi|254494627|ref|ZP_05107798.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 1291]
 gi|260439636|ref|ZP_05793452.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae DGI2]
 gi|261378540|ref|ZP_05983113.1| NADH dehydrogenase, A subunit [Neisseria cinerea ATCC 14685]
 gi|268595654|ref|ZP_06129821.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 35/02]
 gi|268597686|ref|ZP_06131853.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae FA19]
 gi|268599938|ref|ZP_06134105.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae MS11]
 gi|268602272|ref|ZP_06136439.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID18]
 gi|268604538|ref|ZP_06138705.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID1]
 gi|268682993|ref|ZP_06149855.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID332]
 gi|268685158|ref|ZP_06152020.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-92-679]
 gi|268687421|ref|ZP_06154283.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-93-1035]
 gi|291042876|ref|ZP_06568617.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae DGI2]
 gi|293398112|ref|ZP_06642317.1| NADH dehydrogenase I subunit A [Neisseria gonorrhoeae F62]
 gi|296313747|ref|ZP_06863688.1| NADH dehydrogenase, A subunit [Neisseria polysaccharea ATCC 43768]
 gi|121051077|emb|CAM07347.1| NADH dehydrogenase I chain A [Neisseria meningitidis Z2491]
 gi|161596376|gb|ABX74036.1| NADH dehydrogenase I chain A [Neisseria meningitidis 053442]
 gi|193934937|gb|ACF30761.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae NCCP11945]
 gi|226513667|gb|EEH63012.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 1291]
 gi|254674104|emb|CBA09888.1| probable NADH-ubiquinone oxidoreductase chain 3 [Neisseria
           meningitidis alpha275]
 gi|261391773|emb|CAX49228.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A;
           NDH-1, chain A) [Neisseria meningitidis 8013]
 gi|268549043|gb|EEZ44461.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae 35/02]
 gi|268551474|gb|EEZ46493.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae FA19]
 gi|268584069|gb|EEZ48745.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae MS11]
 gi|268586403|gb|EEZ51079.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID18]
 gi|268588669|gb|EEZ53345.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID1]
 gi|268623277|gb|EEZ55677.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae PID332]
 gi|268625442|gb|EEZ57842.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-92-679]
 gi|268627705|gb|EEZ60105.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae SK-93-1035]
 gi|269145090|gb|EEZ71508.1| NADH dehydrogenase, A subunit [Neisseria cinerea ATCC 14685]
 gi|291013310|gb|EFE05276.1| NADH dehydrogenase subunit I A [Neisseria gonorrhoeae DGI2]
 gi|291611375|gb|EFF40445.1| NADH dehydrogenase I subunit A [Neisseria gonorrhoeae F62]
 gi|296839670|gb|EFH23608.1| NADH dehydrogenase, A subunit [Neisseria polysaccharea ATCC 43768]
 gi|317165132|gb|ADV08673.1| NADH dehydrogenase I chain A [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319411276|emb|CBY91683.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A;
           NDH-1, chain A) [Neisseria meningitidis WUE 2594]
 gi|325129039|gb|EGC51889.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           N1568]
 gi|325137068|gb|EGC59664.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M0579]
 gi|325202930|gb|ADY98384.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240149]
 gi|325203358|gb|ADY98811.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M01-240355]
 gi|325207272|gb|ADZ02724.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 118

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|327188487|gb|EGE55701.1| NADH ubiquinone oxidoreductase chain A [Rhizobium etli CNPAF512]
          Length = 124

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 4   MTELLSSYIPIAIFIGIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 64  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|167646798|ref|YP_001684461.1| NADH dehydrogenase subunit A [Caulobacter sp. K31]
 gi|167349228|gb|ABZ71963.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Caulobacter
           sp. K31]
          Length = 125

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+ I IV +++  ++A ++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLQYLPIVIFLGIAAVIGIVFLLAAAVLAPRAPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITW----LGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV   ++        F SM+VFLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVALMKLPHDVAAFAFWSMLVFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|15676165|ref|NP_273297.1| NADH dehydrogenase I chain A [Neisseria meningitidis MC58]
 gi|7225463|gb|AAF40695.1| NADH dehydrogenase I, A subunit [Neisseria meningitidis MC58]
 gi|316985169|gb|EFV64121.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis
           H44/76]
 gi|325141077|gb|EGC63580.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           CU385]
 gi|325199444|gb|ADY94899.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           H44/76]
          Length = 118

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ I  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILIGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|319943347|ref|ZP_08017629.1| threonine synthase [Lautropia mirabilis ATCC 51599]
 gi|319743162|gb|EFV95567.1| threonine synthase [Lautropia mirabilis ATCC 51599]
          Length = 119

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + S + I  M+   ++    PDPEKLS YECGF+ F DAR++ DIR+ 
Sbjct: 3   LNNYLPVLLFLFVGSLVGIGPMVIGKLLGPSRPDPEKLSAYECGFEAFGDARMQVDIRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV    I ++GF SMMVFLGIL +GFIYEW KGAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVSLGTIGFIGFMSMMVFLGILVIGFIYEWGKGALDWE 119


>gi|304389066|ref|ZP_07371110.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis ATCC
           13091]
 gi|254670953|emb|CBA07615.1| probable NADH-ubiquinone oxidoreductase chain 3 [Neisseria
           meningitidis alpha153]
 gi|304336939|gb|EFM03129.1| NADH-quinone oxidoreductase subunit A [Neisseria meningitidis ATCC
           13091]
 gi|325131613|gb|EGC54320.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           M6190]
          Length = 118

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|222085575|ref|YP_002544105.1| NADH-ubiquinone oxidoreductase chain A protein [Agrobacterium
           radiobacter K84]
 gi|221723023|gb|ACM26179.1| NADH-ubiquinone oxidoreductase chain A protein [Agrobacterium
           radiobacter K84]
          Length = 122

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY PI +F+ IA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTGLLSSYIPIAIFIGIAVVIGLALLITPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I WLGF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFSAIGWLGFWSMMVFLAVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|240850583|ref|YP_002971983.1| NADH dehydrogenase I subunit A [Bartonella grahamii as4aup]
 gi|240267706|gb|ACS51294.1| NADH dehydrogenase I subunit A [Bartonella grahamii as4aup]
          Length = 121

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 104/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL+SY P+L+F+ +++ I  VL+I+P+IVA++SPDPEKLS YECGF+ F DAR+KFD
Sbjct: 1   MAYLLSSYLPVLIFIIVSAVIAGVLLITPYIVAYRSPDPEKLSAYECGFNSFSDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F+ I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFESIGMFGFWSMIVFLAILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|319898882|ref|YP_004158975.1| NADH dehydrogenase I chain A [Bartonella clarridgeiae 73]
 gi|319402846|emb|CBI76397.1| NADH dehydrogenase I chain A [Bartonella clarridgeiae 73]
          Length = 121

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL+SY P+L+F+ +++ I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIDLLSSYLPVLIFITVSAIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM++FL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASIGIFGFWSMILFLVILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|74317160|ref|YP_314900.1| NADH dehydrogenase I subunit A [Thiobacillus denitrificans ATCC
           25259]
 gi|74056655|gb|AAZ97095.1| NADH dehydrogenase I chain A [Thiobacillus denitrificans ATCC
           25259]
          Length = 118

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A  I  +++  ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYLPILLFILVGLAFGIGPIVAGGLLAPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  ++I   GF +MMVFLGIL VGFIYEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLEEIGMAGFLAMMVFLGILVVGFIYEWMKGALEWE 118


>gi|91205213|ref|YP_537568.1| NADH dehydrogenase subunit A [Rickettsia bellii RML369-C]
 gi|157827449|ref|YP_001496513.1| NADH dehydrogenase subunit A [Rickettsia bellii OSU 85-389]
 gi|122064632|sp|Q1RJI5|NUOA_RICBR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|91068757|gb|ABE04479.1| NADH dehydrogenase I chain A [Rickettsia bellii RML369-C]
 gi|157802753|gb|ABV79476.1| NADH dehydrogenase I chain A [Rickettsia bellii OSU 85-389]
          Length = 124

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 69/120 (57%), Positives = 90/120 (75%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA+ +  ++MI P ++A K  + +KL  YECGF+PFDDAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIATLVSSLIMILPNLLATKKYNKDKLEPYECGFEPFDDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +LT+GF+YEWKKGAL+W+
Sbjct: 65  RFYLVAILFIIFDLEITFLVPWAISLGTIGKIGFFSMMFFLFVLTIGFVYEWKKGALDWE 124


>gi|58582859|ref|YP_201875.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58427453|gb|AAW76490.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 152

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 35  VLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 94

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+ +L +GF+Y WKKGALEW+
Sbjct: 95  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVCMLFLGFVYVWKKGALEWE 152


>gi|327195236|ref|YP_004339018.1| NADH dehydrogenase subunit 3 [Coccomyxa sp. C-169]
 gi|325070732|gb|ADY75460.1| NADH dehydrogenase subunit 3 [Coccomyxa sp. C-169]
          Length = 117

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 88/116 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  I ++  IA+ + I+L+   F+ + + PDPEK+S YECGFDPFDDAR +FD++F 
Sbjct: 1   MVEYLAIFIYFLIATGLAIILLGVSFLASTRKPDPEKISAYECGFDPFDDARSRFDVQFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+IFDLE+ FLFPWA+   ++   GF SMM FL ILT+GF+YEW+KGAL+W
Sbjct: 61  LVAILFIIFDLEVTFLFPWALVLNRVGLFGFWSMMAFLLILTIGFVYEWRKGALDW 116


>gi|85703213|ref|ZP_01034317.1| NADH dehydrogenase alpha subunit [Roseovarius sp. 217]
 gi|85672141|gb|EAQ26998.1| NADH dehydrogenase alpha subunit [Roseovarius sp. 217]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 96/117 (82%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILVF+A+A  + +VL+++  I+A ++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 1   MLREYLPILVFLAVAIGLGLVLILAAVILAVRNPDPEKVSAYECGFNAFDDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+IFDLEIA LFPWAV F+ ++   F SMMVFLG+LT GF YEW+KGA+EW
Sbjct: 61  YLVSILFIIFDLEIAMLFPWAVAFQDLSMAAFWSMMVFLGVLTAGFAYEWRKGAMEW 117


>gi|78186618|ref|YP_374661.1| NADH dehydrogenase I, subunit 3 [Chlorobium luteolum DSM 273]
 gi|123583246|sp|Q3B4W3|NUOA_PELLD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|78166520|gb|ABB23618.1| NADH dehydrogenase subunit A [Chlorobium luteolum DSM 273]
          Length = 143

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 72/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V    ++  ++    P+P K STYECG +    + VKF+
Sbjct: 1   MDQTLSDFGNVFVFLLLGVVFVAGGYLTARMLRPSRPNPVKNSTYECGEEAVGSSWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  F+Q+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALIEALVFAGILILGLVYAWVKGDLDW 120


>gi|241760630|ref|ZP_04758722.1| NADH-quinone oxidoreductase subunit a [Neisseria flavescens SK114]
 gi|261379580|ref|ZP_05984153.1| NADH dehydrogenase, A subunit [Neisseria subflava NJ9703]
 gi|241318811|gb|EER55337.1| NADH-quinone oxidoreductase subunit a [Neisseria flavescens SK114]
 gi|284798054|gb|EFC53401.1| NADH dehydrogenase, A subunit [Neisseria subflava NJ9703]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKRHYAEKDAAYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|209363823|ref|YP_001423956.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii Dugway
           5J108-111]
 gi|212212182|ref|YP_002303118.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuG_Q212]
 gi|212218212|ref|YP_002304999.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuK_Q154]
 gi|215919185|ref|NP_820431.2| NADH dehydrogenase (ubiquinone), A subunit [Coxiella burnetii RSA
           493]
 gi|223635535|sp|Q83BQ5|NUOA_COXBU RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635536|sp|A9KBK4|NUOA_COXBN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|206584069|gb|AAO90945.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii RSA 493]
 gi|207081756|gb|ABS77261.2| NADH-quinone oxidoreductase chain A [Coxiella burnetii Dugway
           5J108-111]
 gi|212010592|gb|ACJ17973.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuG_Q212]
 gi|212012474|gb|ACJ19854.1| NADH-quinone oxidoreductase chain A [Coxiella burnetii CbuK_Q154]
          Length = 120

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+ I+  I ++ +   +    + PD  KLS YECGF+ F DAR+ FD+RF
Sbjct: 3   VLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I W GF +MMVFL IL VGFIYEWK+GALEW+
Sbjct: 63  YLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE 120


>gi|224824823|ref|ZP_03697930.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Lutiella
           nitroferrum 2002]
 gi|224603316|gb|EEG09492.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Lutiella
           nitroferrum 2002]
          Length = 118

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 91/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++  ++VA   PDPEKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLQNYFPILLFVIVGLLVGVGPILLGWLVAPNRPDPEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEI FLFPWAV  K++   GFG M+ F+ +LT+GF+Y WKKGALEW+
Sbjct: 61  YLVAILFILFDLEITFLFPWAVVLKELGAFGFGVMVEFIAVLTLGFVYMWKKGALEWE 118


>gi|193216262|ref|YP_001997461.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
 gi|223635401|sp|B3QY48|NUOA2_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|193089739|gb|ACF15014.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
          Length = 152

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   ++ +  + +F+      VI   +S  ++    P+ EKL++YECG +    A V+F+
Sbjct: 1   MDYTISEFGKVFLFLLFGVVFVIGGYVSSRMLRPHRPNDEKLTSYECGEEAVGSAWVQFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        ++F+ ILT+G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVLFLFPWATVFKQLGGFALFEAVIFVTILTLGLVYAWVKGDLDW 120


>gi|220934162|ref|YP_002513061.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995472|gb|ACL72074.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 118

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + I+ +    ++    PD  K S YECGF+ F+D+R+KFD+RF
Sbjct: 1   MLENYLPILIFIGVGLLVGIIPLALGMVIGPHRPDGAKNSPYECGFEAFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I   G  +M +FLGIL +GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALDSIGLFGLLAMALFLGILVIGFIYEWKKGALEWE 118


>gi|291613538|ref|YP_003523695.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sideroxydans
           lithotrophicus ES-1]
 gi|291583650|gb|ADE11308.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sideroxydans
           lithotrophicus ES-1]
          Length = 118

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ IA  + I+ +    ++    PD +KLS YECGF+ F+DAR+KFD+RF
Sbjct: 1   MLENYFPVLLFIGIALVMGILPLALGKLLGPNRPDEKKLSPYECGFEAFEDARMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+  K+I   GF SMM+FL IL VGFIYEW KGALEW+
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLKEIGTFGFVSMMIFLAILVVGFIYEWMKGALEWE 118


>gi|194333675|ref|YP_002015535.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Prosthecochloris aestuarii DSM 271]
 gi|223635472|sp|B4S751|NUOA_PROA2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|194311493|gb|ACF45888.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Prosthecochloris aestuarii DSM 271]
          Length = 138

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ + +  V+   ++  ++    P+PEKL+ YECG D    + VKF+
Sbjct: 1   MDQTLSDFGAVFVFLLLGTVFVVGGYLTARLLRPSRPNPEKLAVYECGEDAVGTSWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILIIGLAYAWVKGDLDW 120


>gi|78188612|ref|YP_378950.1| NADH dehydrogenase I, subunit 3 [Chlorobium chlorochromatii CaD3]
 gi|123580177|sp|Q3ASW8|NUOA_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|78170811|gb|ABB27907.1| NADH dehydrogenase subunit A [Chlorobium chlorochromatii CaD3]
          Length = 146

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   LT +  + VF+ +    V+   ++  ++    P+P+K STYECG +    A VKF+
Sbjct: 1   MDQTLTQFGSVFVFLLLGVIFVVGGYLTSRLLRPSRPNPQKNSTYECGEEAIGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FK +       ++VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKPLGTFALIEVLVFAGILILGLAYAWVKGDLDW 120


>gi|85374166|ref|YP_458228.1| NADH dehydrogenase I chain A [Erythrobacter litoralis HTCC2594]
 gi|84787249|gb|ABC63431.1| NADH Dehydrogenase I Chain A [Erythrobacter litoralis HTCC2594]
          Length = 124

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 66/121 (54%), Positives = 85/121 (70%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L+ Y PIL+F+ IA  +  +     M    +    +P+ EKLS YECGF  F+DAR +FD
Sbjct: 4   LSQYLPILIFLFIAVGLSALFVFLPMGVSRLTGAHNPNAEKLSEYECGFPAFEDARSRFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV      W+G+  MM+FL ILTVGF YEWKKGALEW
Sbjct: 64  VRFYLVAILFIIFDLEVAFLFPWAVSLDHSGWIGWIGMMIFLVILTVGFAYEWKKGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|82702220|ref|YP_411786.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosospira
           multiformis ATCC 25196]
 gi|82410285|gb|ABB74394.1| NADH dehydrogenase subunit A [Nitrosospira multiformis ATCC 25196]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  AI  + M   ++     PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFILLGLAIGALAMGFGWLFGPNRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV   +I   GF +MMVFLGIL VGFIYEW KGALEWD
Sbjct: 61  YLVAILFILFDLEIAFLFPWAVVLNEIGLFGFIAMMVFLGILVVGFIYEWTKGALEWD 118


>gi|87200317|ref|YP_497574.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135998|gb|ABD26740.1| NADH dehydrogenase subunit A [Novosphingobium aromaticivorans DSM
           12444]
          Length = 128

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 83/124 (66%), Gaps = 4/124 (3%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           +  L  Y PIL+F+ IA A+        M    +    +P  EKLS YECGF  F+D R 
Sbjct: 5   ASYLAQYLPILIFLGIALALSAAFVFLPMGVARLTGAHNPTAEKLSEYECGFPAFEDPRS 64

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +FD+RF LV++LF+IFDLE AFLFPWAV  K+  W G+ +MMVFLG L +GFIY WKKGA
Sbjct: 65  QFDVRFYLVAILFIIFDLEAAFLFPWAVSLKETGWAGWTTMMVFLGELVIGFIYAWKKGA 124

Query: 118 LEWD 121
           L+W+
Sbjct: 125 LDWE 128


>gi|258542722|ref|YP_003188155.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633800|dbj|BAH99775.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636859|dbj|BAI02828.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639912|dbj|BAI05874.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642968|dbj|BAI08923.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646023|dbj|BAI11971.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649076|dbj|BAI15017.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652063|dbj|BAI17997.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655120|dbj|BAI21047.1| NADH-quinone oxidoreductase chain A [Acetobacter pasteurianus IFO
           3283-12]
          Length = 121

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 62/121 (51%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +L  YAP+LVF  ++  I   ++    +   + P  EKL+ YECGF+ FDDAR +FD
Sbjct: 1   MQSVLGDYAPVLVFGGMSVIIAAAMLGMALLSGHQKPYSEKLTAYECGFEAFDDARRRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWA+   +I   GF SM+ FL +L +GF+YEW+KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAISLGRIGLFGFLSMLGFLAVLGIGFLYEWRKGALDW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|34496396|ref|NP_900611.1| NADH-ubiquinone oxidoreductase, chain A [Chromobacterium violaceum
           ATCC 12472]
 gi|34102249|gb|AAQ58615.1| NADH-ubiquinone oxidoreductase, chain A [Chromobacterium violaceum
           ATCC 12472]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +  ++   ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLQNYFPILMFVIVGLLVGVGPIVLGKLLAPNRPDAEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FDLEIAFLFPWAV  K +   G G M+ FL +LT+GF+Y WKKGALEW+
Sbjct: 61  YLIAILFILFDLEIAFLFPWAVVLKDLGVYGLGVMVEFLAVLTLGFVYMWKKGALEWE 118


>gi|119356789|ref|YP_911433.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           phaeobacteroides DSM 266]
 gi|223635446|sp|A1BF32|NUOA_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|119354138|gb|ABL65009.1| NADH dehydrogenase subunit A [Chlorobium phaeobacteroides DSM 266]
          Length = 143

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 73/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+S+  +  F+A+    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSSFGNVFAFLALGIVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FK +       ++VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKSLGVFALVEVLVFAGILILGLVYAWVKGDLDW 120


>gi|296536156|ref|ZP_06898284.1| NADH-quinone oxidoreductase subunit A [Roseomonas cervicalis ATCC
           49957]
 gi|296263527|gb|EFH10024.1| NADH-quinone oxidoreductase subunit A [Roseomonas cervicalis ATCC
           49957]
          Length = 122

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 74/118 (62%), Positives = 94/118 (79%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL +Y PILVF+AIA+AI + ++    + A + P  EK+S YECGF+PFDD R +FD+RF
Sbjct: 5   LLANYFPILVFLAIAAAIAVAMVGGSVLAARQKPYAEKVSAYECGFEPFDDTRRRFDVRF 64

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+AFLFPWAV   QI W GF SMM FLG+LTVGFIYEW+KGAL+W+
Sbjct: 65  YLVAILFIIFDLEVAFLFPWAVSLGQIGWFGFLSMMGFLGVLTVGFIYEWRKGALDWE 122


>gi|262277301|ref|ZP_06055094.1| NADH-quinone oxidoreductase subunit a (nadhdehydrogenase i subunit
           a) (ndh-1 subunit a) [alpha proteobacterium HIMB114]
 gi|262224404|gb|EEY74863.1| NADH-quinone oxidoreductase subunit a (nadhdehydrogenase i subunit
           a) (ndh-1 subunit a) [alpha proteobacterium HIMB114]
          Length = 122

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 91/119 (76%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           D L  YA IL+F+ I+  +    +I  F+ +  +PDPEKLS YECGF+ FDDAR+KFD+R
Sbjct: 4   DFLRDYATILIFLFISIGLGFAFIIVNFLFSPSNPDPEKLSAYECGFEAFDDARMKFDVR 63

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LV++LF+IFDLE+AFLFPWAV    I  LGF SMM FL ILTVGFIYEWKKGAL+W+
Sbjct: 64  FYLVAILFIIFDLEVAFLFPWAVSLGNIGLLGFWSMMFFLFILTVGFIYEWKKGALDWE 122


>gi|188991029|ref|YP_001903039.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167732789|emb|CAP50983.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris]
          Length = 133

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 16  VLAEYLPSLLFLVVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 75

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 76  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 133


>gi|255067281|ref|ZP_05319136.1| NADH dehydrogenase, A subunit [Neisseria sicca ATCC 29256]
 gi|261364347|ref|ZP_05977230.1| NADH dehydrogenase, A subunit [Neisseria mucosa ATCC 25996]
 gi|298370384|ref|ZP_06981700.1| NADH dehydrogenase (ubiquinone), A subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|255048432|gb|EET43896.1| NADH dehydrogenase, A subunit [Neisseria sicca ATCC 29256]
 gi|288567611|gb|EFC89171.1| NADH dehydrogenase, A subunit [Neisseria mucosa ATCC 25996]
 gi|298281844|gb|EFI23333.1| NADH dehydrogenase (ubiquinone), A subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 118

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+LVF+ +  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLASYFPVLVFILVGLAAGVLFILLGTILGPKHHYAEKDAAYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|30249737|ref|NP_841807.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           europaea ATCC 19718]
 gi|81722162|sp|Q82TU3|NUOA_NITEU RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|30180774|emb|CAD85688.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           europaea ATCC 19718]
          Length = 122

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 97/121 (80%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++ +L +Y PIL+F+ +  AI ++ M++ +++A   PD EKLS YECGF  F+DAR+KFD
Sbjct: 2   LNTMLGNYFPILLFILVGLAIGVLSMLAGWLLAPNKPDAEKLSPYECGFGAFEDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +R+ L+++LF++FDLEIAFLFPWAV  K+I W GF +M+VFLG+L VGFIYEW KGALEW
Sbjct: 62  VRYYLIAILFILFDLEIAFLFPWAVVLKEIGWFGFVAMLVFLGLLVVGFIYEWVKGALEW 121

Query: 121 D 121
           D
Sbjct: 122 D 122


>gi|83858415|ref|ZP_00951937.1| NADH dehydrogenase alpha subunit [Oceanicaulis alexandrii HTCC2633]
 gi|83853238|gb|EAP91090.1| NADH dehydrogenase alpha subunit [Oceanicaulis alexandrii HTCC2633]
          Length = 121

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 96/121 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ LL  Y PIL+F+ IA+ + +V +++ F++A   PDPEK+STYECGF+ FDDAR+KFD
Sbjct: 1   MNALLLEYLPILIFLGIAAGLGLVFILAAFVLAPSDPDPEKVSTYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPW       +   F SMMVFLG+LTVGF+YEW+KGAL+W
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWLFPIFDGSVAAFWSMMVFLGVLTVGFLYEWRKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|260223142|emb|CBA33410.1| NADH-quinone oxidoreductase subunit A [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 119

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y P+L+F+ +   I +V  +  +I+    PD  K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LDQYLPVLLFILVGIGIGVVPQVLGYILGPNKPDAAKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE AFLFPWAV  K++   GF   + F+ ILT+GF+Y WKKGAL+W+
Sbjct: 63  LVAILFILFDLETAFLFPWAVSLKELGLFGFLIGVEFVVILTIGFVYMWKKGALDWE 119


>gi|59802072|ref|YP_208784.1| hypothetical protein NGO1751 [Neisseria gonorrhoeae FA 1090]
 gi|59718967|gb|AAW90372.1| putative NADH dehydrogenase I chain A [Neisseria gonorrhoeae FA
           1090]
          Length = 118

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ +  A  ++ ++   I+  K    EK + Y+CGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYKCGFESFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGF+YEWKKGALEW+
Sbjct: 61  YLVDILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE 118


>gi|295676037|ref|YP_003604561.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1002]
 gi|295435880|gb|ADG15050.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1002]
          Length = 133

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLLFLIVGTGLGVALVSIGKLLGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDIGWAGFTAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|325983289|ref|YP_004295691.1| NAD(P)H-quinone oxidoreductase subunit 3 [Nitrosomonas sp. AL212]
 gi|325532808|gb|ADZ27529.1| NAD(P)H-quinone oxidoreductase subunit 3 [Nitrosomonas sp. AL212]
          Length = 118

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 92/118 (77%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   + +V M+  +++A  +PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPILLFLIVGFMVGVVPMLCGWLLAPNNPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWA+   +I   GF +MMVFL IL VGF+YEW KGALEWD
Sbjct: 61  YLVAILFILFDLEIAFLFPWAIVLDEIGLFGFVAMMVFLSILVVGFVYEWMKGALEWD 118


>gi|329889332|ref|ZP_08267675.1| NADH-quinone oxidoreductase chain 7 [Brevundimonas diminuta ATCC
           11568]
 gi|328844633|gb|EGF94197.1| NADH-quinone oxidoreductase chain 7 [Brevundimonas diminuta ATCC
           11568]
          Length = 125

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 76/124 (61%), Positives = 95/124 (76%), Gaps = 4/124 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++ L  Y PI+VF+ IA  +    M++ +++A K+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNEFLLEYLPIVVFLGIAIVLGAGFMLAAWVLAPKNPDTEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT----WLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLEIAFLFPWAV    ++       F SMMVFLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVSMFDLSHGGMVFAFWSMMVFLGVLTVGFIYEWKKG 120

Query: 117 ALEW 120
           ALEW
Sbjct: 121 ALEW 124


>gi|325139132|gb|EGC61678.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           ES14902]
 gi|325143082|gb|EGC65429.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           961-5945]
 gi|325143152|gb|EGC65498.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           961-5945]
 gi|325197527|gb|ADY92983.1| NADH:ubiquinone dehydrogenase, A subunit [Neisseria meningitidis
           G2136]
          Length = 118

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 89/118 (75%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ VF+ I  A  ++ ++   I+  K    EK + YECGF+ F++AR+KFD+R+
Sbjct: 1   MLSAYFPVFVFILIGLAAGVLFILLGTILGSKRHYAEKDAPYECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+ PWAV FK +   GF SM+VF+ +LTVGFIYEWKKGALEW+
Sbjct: 61  YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFIYEWKKGALEWE 118


>gi|253996973|ref|YP_003049037.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           mobilis JLW8]
 gi|253983652|gb|ACT48510.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           mobilis JLW8]
          Length = 120

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +  A+ +  +I   +V+   PD  K S YECGF+ F+DAR+KFD+R+
Sbjct: 3   VLENYFPILLFILVGLAVGVGPLILSKLVSPSRPDSAKNSPYECGFEAFEDARMKFDVRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAFLFPWAV  ++I   GF +MMVFLG+L +GFIYEW KGALEWD
Sbjct: 63  YLVAILFILFDLEIAFLFPWAVVLREIGLFGFLAMMVFLGVLVIGFIYEWMKGALEWD 120


>gi|124008474|ref|ZP_01693167.1| NAD(P)H-quinone oxidoreductase chain 3 (NAD(P)Hdehydrogenase I,
           chain 3) [Microscilla marina ATCC 23134]
 gi|123985982|gb|EAY25832.1| NAD(P)H-quinone oxidoreductase chain 3 (NAD(P)Hdehydrogenase I,
           chain 3) [Microscilla marina ATCC 23134]
          Length = 166

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 73/126 (57%), Gaps = 10/126 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  IL+F+    A V V  +  +++  K P+PEKL+TYECG D   +    F+IRF 
Sbjct: 6   IQEFGIILLFIIGGVAFVSVTFLISYLLRPKRPNPEKLTTYECGEDAVGNVWGHFNIRFY 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYF----------KQITWLGFGSMMVFLGILTVGFIYEWK 114
           LV++LFV+F++EI FLFPWA  F           Q  W     +++F+GIL +G  Y W 
Sbjct: 66  LVALLFVLFEVEILFLFPWATVFGQKELIEGTQGQWGWFALIEVIIFVGILVLGLAYAWA 125

Query: 115 KGALEW 120
           KG L+W
Sbjct: 126 KGYLDW 131


>gi|254294104|ref|YP_003060127.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hirschia
           baltica ATCC 49814]
 gi|254042635|gb|ACT59430.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Hirschia
           baltica ATCC 49814]
          Length = 124

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 65/121 (53%), Positives = 90/121 (74%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           +  L+ +Y P+++F A+  A+ +  +++  +++  +PDPEK S YECGF+PFDDAR+KFD
Sbjct: 4   VQSLVLNYLPVVIFFALGLALCLAFLVASAVLSPNNPDPEKNSAYECGFNPFDDARMKFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLE+AFLFPW           F SMMVFLG+LT+GFIYEW  GALEW
Sbjct: 64  IRFYLVAILFIIFDLEVAFLFPWIFQVDAGNIAAFWSMMVFLGVLTIGFIYEWSSGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|145219900|ref|YP_001130609.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Prosthecochloris vibrioformis DSM 265]
 gi|223635474|sp|A4SF48|NUOA_PROVI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145206064|gb|ABP37107.1| NADH dehydrogenase subunit A [Chlorobium phaeovibrioides DSM 265]
          Length = 143

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 71/120 (59%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF  +    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSEFGNVFVFFLLGVVFVAGGYLTARMLRPSRPNPVKTSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  F+Q+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDW 120


>gi|103486797|ref|YP_616358.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingopyxis
           alaskensis RB2256]
 gi|98976874|gb|ABF53025.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingopyxis
           alaskensis RB2256]
          Length = 124

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 65/121 (53%), Positives = 82/121 (67%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           LT Y PIL+F+ IA  +        M    +     PDP KLS YECGF  F+DAR +FD
Sbjct: 4   LTQYLPILIFLVIAVGLSAAFVFLPMGVARLTGAHKPDPAKLSEYECGFPAFEDARSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV  ++I W G+ +MMVFL  L +G IY WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLEEIGWAGWVTMMVFLAELAIGLIYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|319787443|ref|YP_004146918.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465955|gb|ADV27687.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 118

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I + L+I   ++  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAQYLPTLLFLIVATGIGVALIIVGRVLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW + F+ +      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTLVFQDLGPRALVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|194336922|ref|YP_002018716.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|223635468|sp|B4SBZ3|NUOA_PELPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|194309399|gb|ACF44099.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 143

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 72/120 (60%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  +  F+A+    V    ++  ++    P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSNFGNVFAFLALGVVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FL+PWA  FKQ+        +VF GIL +G  Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALIEALVFAGILVLGLAYAWVKGDLDW 120


>gi|209518515|ref|ZP_03267336.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. H160]
 gi|209501060|gb|EEA01095.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. H160]
          Length = 133

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + + W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDVGWAGFIAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|319407267|emb|CBI80906.1| NADH dehydrogenase I chain A [Bartonella sp. 1-1C]
          Length = 121

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL SY P+L+F+ I+  I  VL+I P+IVA+++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLNSYLPVLIFIIISVIIAGVLLIIPYIVAYRAPDPEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILTVGFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFSSIGIFGFWSMIVFLAILTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|302383045|ref|YP_003818868.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193673|gb|ADL01245.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 125

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 73/124 (58%), Positives = 93/124 (75%), Gaps = 4/124 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+ + I  M++ +++A  +PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLQYLPIVIFLGIATVLGIGFMVAAWVLAPSNPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT----WLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV    +        F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSIFDLGQGAMVFAFWSMMAFLGVLTVGFIYEWKKG 120

Query: 117 ALEW 120
           ALEW
Sbjct: 121 ALEW 124


>gi|186476764|ref|YP_001858234.1| NADH dehydrogenase subunit A [Burkholderia phymatum STM815]
 gi|223635431|sp|B2JDM8|NUOA_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|184193223|gb|ACC71188.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           phymatum STM815]
          Length = 123

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 7   LAAYFPVLMFLLVGTGLGVALVSIGKILGPNRPDTEKNAPYECGFEAFEDARMKFDVRYY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF SMM+FL    +GF Y WKKG L+W+
Sbjct: 67  LVAILFIIFDLETAFLFPWGVALRDIGWPGFISMMIFLLEFLLGFAYIWKKGGLDWE 123


>gi|238028143|ref|YP_002912374.1| NADH dehydrogenase subunit A [Burkholderia glumae BGR1]
 gi|237877337|gb|ACR29670.1| Putative transmembrane NADH dehydrogenase I(chain A), NuoA
           [Burkholderia glumae BGR1]
          Length = 119

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + L+    I+    P+ EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLIVGVGLGVALVGIGKILGPSKPNNEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y W+KG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWRKGGLDWE 119


>gi|167836049|ref|ZP_02462932.1| NADH dehydrogenase subunit A [Burkholderia thailandensis MSMB43]
          Length = 119

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFVAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|269469168|gb|EEZ80710.1| NADH dehydrogenase I chain A [uncultured SUP05 cluster bacterium]
          Length = 118

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI+VF+ +  A  +  M+  +++    PD EK S +ECGF  FDD+R+ F++R+
Sbjct: 1   MLENYLPIMVFIFLGVAFGVGPMLIGYLLGPSKPDEEKNSQFECGFPAFDDSRMYFNVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV    + W GF +M +FL +L VGFI+EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSDLGWFGFIAMSIFLFLLVVGFIFEWKNGALEWE 118


>gi|189500539|ref|YP_001960009.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           phaeobacteroides BS1]
 gi|223635437|sp|B3EKA1|NUOA_CHLPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189495980|gb|ACE04528.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chlorobium
           phaeobacteroides BS1]
          Length = 142

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+ +  + VF+ +    V+   ++  ++    P+PEKL+ YECG +    A VKF+
Sbjct: 1   MDQTLSDFGTVFVFLLLGIIFVVGGYLTARLLRPSRPNPEKLAIYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        +VF GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILVIGLVYAWVKGDLDW 120


>gi|170696399|ref|ZP_02887528.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           graminis C4D1M]
 gi|170138727|gb|EDT06926.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           graminis C4D1M]
          Length = 133

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 17  LAAYFPVLMFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 76

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 77  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 133


>gi|159472440|ref|XP_001694359.1| NADH:ubiquinone oxidoreductase ND3 subunit [Chlamydomonas
           reinhardtii]
 gi|33943533|gb|AAQ55461.1| putative NADH dehydrogenase subunit 3 precursor [Chlamydomonas
           reinhardtii]
 gi|33943535|gb|AAQ55462.1| putative NADH:ubiquinone oxidoreductase subunit 3 precursor
           [Chlamydomonas reinhardtii]
 gi|158277022|gb|EDP02792.1| NADH:ubiquinone oxidoreductase ND3 subunit [Chlamydomonas
           reinhardtii]
          Length = 279

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/114 (43%), Positives = 74/114 (64%), Gaps = 2/114 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           S+ P ++   IA+AI  V +++P ++A    D +K S YECGFD F +AR  F + F LV
Sbjct: 166 SFYPYVIATVIATAISTVFIVAPLVIAPSRVDLDKSSAYECGFDAFGEARQTFSVSFYLV 225

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           S+++++FD+EIA+LFP+A+    +      +M +FL IL  GF YEW  GALEW
Sbjct: 226 SIMYLLFDIEIAYLFPYAMTHASLPMY--WTMNLFLAILVAGFAYEWGMGALEW 277


>gi|182679353|ref|YP_001833499.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182635236|gb|ACB96010.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 121

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +L   Y P++VF  +A+ I   L+I+PF+VAFKSPDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MLNLFDQYLPLVVFAGVAAFIAAALLIAPFLVAFKSPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF++FDLE+AFLFPWA+ F+ I  LGF SM++FLGILTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVALLFIVFDLEVAFLFPWAIAFRTIGDLGFWSMIIFLGILTVGFIYEWKKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|52842987|ref|YP_096786.1| NADH dehydrogenase I, A subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295618|ref|YP_128033.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Lens]
 gi|52630098|gb|AAU28839.1| NADH dehydrogenase I, A subunit [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53755450|emb|CAH16946.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Lens]
 gi|307611659|emb|CBX01350.1| NADH dehydrogenase I chain A [Legionella pneumophila 130b]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ +A  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIVALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|77463070|ref|YP_352574.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides 2.4.1]
 gi|126461942|ref|YP_001043056.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides ATCC 17029]
 gi|221638926|ref|YP_002525188.1| NADH dehydrogenase subunit A [Rhodobacter sphaeroides KD131]
 gi|332557943|ref|ZP_08412265.1| NADH:ubiquinone oxidoreductase subunit A [Rhodobacter sphaeroides
           WS8N]
 gi|77387488|gb|ABA78673.1| NADH dehydrogenase-ubiquinone oxidoreductase, chain A [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103606|gb|ABN76284.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221159707|gb|ACM00687.1| NADH-quinone oxidoreductase subunit [Rhodobacter sphaeroides KD131]
 gi|332275655|gb|EGJ20970.1| NADH:ubiquinone oxidoreductase subunit A [Rhodobacter sphaeroides
           WS8N]
          Length = 121

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 76/120 (63%), Positives = 95/120 (79%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  + PI++   +A  + ++LM+S  IVA + PDPEK+S YECGF+ FDDAR+KF+
Sbjct: 1   MDDLLREFLPIVILTVLAGGLGLLLMLSAVIVAVRRPDPEKVSAYECGFNAFDDARMKFE 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMMVFLG+LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMVFLGVLTVGFAYEWKKGALEW 120


>gi|229315930|ref|YP_002860156.1| NADH dehydrogenase subunit 3 [Micromonas sp. RCC299]
 gi|226431215|gb|ACO55620.1| NADH dehydrogenase subunit 3 [Micromonas sp. RCC299]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y P+LV++ I+  + ++++   F+ + +  DPEK+S YECGFDPFDDAR +FDIRF 
Sbjct: 1   MSEYVPLLVYLVISMVLSMLILSLSFVFSTQKADPEKVSAYECGFDPFDDARARFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWA+    I   GF +M+VFL ILT+GF+YEW+KGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAISLHTIQLTGFWTMVVFLLILTIGFVYEWRKGALEWE 117


>gi|307730340|ref|YP_003907564.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1003]
 gi|307584875|gb|ADN58273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1003]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|11466536|ref|NP_044785.1| NADH dehydrogenase subunit 3 [Reclinomonas americana]
 gi|6647606|sp|O21273|NU3M_RECAM RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|2258366|gb|AAD11900.1| NADH dehydrogenase subunit 3 [Reclinomonas americana]
          Length = 122

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 64/120 (53%), Positives = 90/120 (75%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + +L+ Y  +L+F   +  +  +++   +++A ++ D EKLS YECGF+PFDDAR  FD+
Sbjct: 3   TMILSEYLSVLIFFIFSFGLSCIILGLSYVLATQNADTEKLSPYECGFNPFDDARGAFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLE+AFLFPWAV    +T  GF +M +FL ILTVGFIYEWKKGAL+W+
Sbjct: 63  RFYLVAILFIIFDLEVAFLFPWAVALSDVTIFGFWTMFIFLLILTVGFIYEWKKGALDWE 122


>gi|110598467|ref|ZP_01386738.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           ferrooxidans DSM 13031]
 gi|110339917|gb|EAT58421.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Chlorobium
           ferrooxidans DSM 13031]
          Length = 143

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 75/120 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L+++  + VF+A+    V    ++  ++  + P+P K STYECG +    A VKF+
Sbjct: 1   MDQTLSNFGNVFVFLALGIVFVAGGFLTARMLRPQRPNPAKNSTYECGEEAVGSAWVKFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF +V+++F+IFD+E+ FLFPWA  FKQ+        ++F GIL +G +Y W KG L+W
Sbjct: 61  IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALVEALLFAGILVLGLVYAWVKGDLDW 120


>gi|187923340|ref|YP_001894982.1| NADH dehydrogenase subunit A [Burkholderia phytofirmans PsJN]
 gi|223635432|sp|B2T2E7|NUOA_BURPP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|187714534|gb|ACD15758.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           phytofirmans PsJN]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFLAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|53718847|ref|YP_107833.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei K96243]
 gi|53725825|ref|YP_103434.1| NADH dehydrogenase subunit A [Burkholderia mallei ATCC 23344]
 gi|67642192|ref|ZP_00440952.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Burkholderia mallei GB8 horse 4]
 gi|76809619|ref|YP_332844.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710b]
 gi|83720995|ref|YP_441614.1| NADH dehydrogenase subunit A [Burkholderia thailandensis E264]
 gi|121599834|ref|YP_992469.1| NADH dehydrogenase subunit A [Burkholderia mallei SAVP1]
 gi|124386231|ref|YP_001026728.1| NADH dehydrogenase subunit A [Burkholderia mallei NCTC 10229]
 gi|126438518|ref|YP_001058338.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 668]
 gi|126448156|ref|YP_001079987.1| NADH dehydrogenase subunit A [Burkholderia mallei NCTC 10247]
 gi|126452694|ref|YP_001065577.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1106a]
 gi|167000368|ref|ZP_02266186.1| NADH dehydrogenase I, A subunit [Burkholderia mallei PRL-20]
 gi|167580422|ref|ZP_02373296.1| NADH dehydrogenase subunit A [Burkholderia thailandensis TXDOH]
 gi|167618531|ref|ZP_02387162.1| NADH dehydrogenase subunit A [Burkholderia thailandensis Bt4]
 gi|167718843|ref|ZP_02402079.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei DM98]
 gi|167737852|ref|ZP_02410626.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 14]
 gi|167815036|ref|ZP_02446716.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 91]
 gi|167823452|ref|ZP_02454923.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 9]
 gi|167845004|ref|ZP_02470512.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei B7210]
 gi|167893545|ref|ZP_02480947.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 7894]
 gi|167901991|ref|ZP_02489196.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei NCTC 13177]
 gi|167910227|ref|ZP_02497318.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 112]
 gi|167918260|ref|ZP_02505351.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei BCC215]
 gi|217419865|ref|ZP_03451371.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 576]
 gi|237811582|ref|YP_002896033.1| NADH-quinone oxidoreductase subunit a (NADH dehydrogenase i subunit
           a) (ndh-1 subunit a) [Burkholderia pseudomallei MSHR346]
 gi|242317948|ref|ZP_04816964.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106b]
 gi|254175758|ref|ZP_04882418.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 10399]
 gi|254190550|ref|ZP_04897057.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195198|ref|ZP_04901627.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           S13]
 gi|254202110|ref|ZP_04908473.1| NADH dehydrogenase I, A subunit [Burkholderia mallei FMH]
 gi|254207440|ref|ZP_04913790.1| NADH dehydrogenase I, A subunit [Burkholderia mallei JHU]
 gi|254258663|ref|ZP_04949717.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710a]
 gi|254298533|ref|ZP_04965985.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           406e]
 gi|254359862|ref|ZP_04976132.1| NADH dehydrogenase I, A subunit [Burkholderia mallei 2002721280]
 gi|257139690|ref|ZP_05587952.1| NADH dehydrogenase subunit A [Burkholderia thailandensis E264]
 gi|81685034|sp|Q62IN5|NUOA_BURMA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81690416|sp|Q63VN3|NUOA_BURPS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123537639|sp|Q2SZN5|NUOA_BURTA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123599741|sp|Q3JUA9|NUOA_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635426|sp|A3MIA1|NUOA_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635427|sp|A2S459|NUOA_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635428|sp|A1V2L6|NUOA_BURMS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635429|sp|A3NTA6|NUOA_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635430|sp|A3N7L7|NUOA_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|52209261|emb|CAH35206.1| NADH dehydrogenase I chain A [Burkholderia pseudomallei K96243]
 gi|52429248|gb|AAU49841.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 23344]
 gi|76579072|gb|ABA48547.1| NADH dehydrogenase I chain A [Burkholderia pseudomallei 1710b]
 gi|83654820|gb|ABC38883.1| NADH dehydrogenase I, A subunit [Burkholderia thailandensis E264]
 gi|121228644|gb|ABM51162.1| NADH dehydrogenase I, A subunit [Burkholderia mallei SAVP1]
 gi|124294251|gb|ABN03520.1| NADH dehydrogenase I, A subunit [Burkholderia mallei NCTC 10229]
 gi|126218011|gb|ABN81517.1| NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit
           [Burkholderia pseudomallei 668]
 gi|126226336|gb|ABN89876.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106a]
 gi|126241026|gb|ABO04119.1| NADH dehydrogenase I, A subunit [Burkholderia mallei NCTC 10247]
 gi|147746357|gb|EDK53434.1| NADH dehydrogenase I, A subunit [Burkholderia mallei FMH]
 gi|147751334|gb|EDK58401.1| NADH dehydrogenase I, A subunit [Burkholderia mallei JHU]
 gi|148029102|gb|EDK87007.1| NADH dehydrogenase I, A subunit [Burkholderia mallei 2002721280]
 gi|157808206|gb|EDO85376.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           406e]
 gi|157938225|gb|EDO93895.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696802|gb|EDP86772.1| NADH dehydrogenase I, A subunit [Burkholderia mallei ATCC 10399]
 gi|169651946|gb|EDS84639.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           S13]
 gi|217397169|gb|EEC37185.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 576]
 gi|237502777|gb|ACQ95095.1| NADH-quinone oxidoreductase subunit a (NADH dehydrogenase i subunit
           a) (ndh-1 subunit a) [Burkholderia pseudomallei MSHR346]
 gi|238523288|gb|EEP86727.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Burkholderia mallei GB8 horse 4]
 gi|242141187|gb|EES27589.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 1106b]
 gi|243063702|gb|EES45888.1| NADH dehydrogenase I, A subunit [Burkholderia mallei PRL-20]
 gi|254217352|gb|EET06736.1| NADH dehydrogenase subunit A [Burkholderia pseudomallei 1710a]
          Length = 119

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|296108432|ref|YP_003620133.1| NADH dehydrogenase I chain A [Legionella pneumophila 2300/99 Alcoy]
 gi|295650334|gb|ADG26181.1| NADH dehydrogenase I chain A [Legionella pneumophila 2300/99 Alcoy]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ IA  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIIALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|254181187|ref|ZP_04887784.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           1655]
 gi|184211725|gb|EDU08768.1| NADH-quinone oxidoreductase, A subunit [Burkholderia pseudomallei
           1655]
          Length = 119

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +M++FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMVIFLLEFLLGFAYIWKKGGLDWE 119


>gi|319405698|emb|CBI79321.1| NADH dehydrogenase I chain A [Bartonella sp. AR 15-3]
          Length = 121

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 82/121 (67%), Positives = 101/121 (83%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL+SY PIL+F+AI+  I  VL+I P++VA+++PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MIHLLSSYLPILIFIAISVIITGVLLIIPYMVAYRAPDAEKLSAYECGFNSFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I   GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSFASIGIFGFLSMIVFLTILTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|326387462|ref|ZP_08209071.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208118|gb|EGD58926.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 128

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 84/124 (67%), Gaps = 4/124 (3%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           +  L  Y PIL+F+ IA A+        + +  +    +P+ EKLS YECGF  F+D R 
Sbjct: 5   TSYLAGYLPILIFLGIALALSTAFVFLPIGASRLTGTYNPNTEKLSEYECGFPAFEDPRS 64

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +FD+RF LV++LF+IFDLE AFLFPWAV  K+  W G+ +MM+FL  L +GFIY WKKGA
Sbjct: 65  QFDVRFYLVAILFIIFDLEAAFLFPWAVSLKETQWAGWATMMLFLFELVIGFIYAWKKGA 124

Query: 118 LEWD 121
           L+W+
Sbjct: 125 LDWE 128


>gi|261856550|ref|YP_003263833.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Halothiobacillus neapolitanus c2]
 gi|261837019|gb|ACX96786.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Halothiobacillus neapolitanus c2]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F  +A    + L+    ++A   PD  K + YECGF  F+DAR+KFD+R+
Sbjct: 1   MLEGYLPILIFFGVAVLFSLGLLFGGKLLAPFRPDSSKNAPYECGFAAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV   QI   G  +M +FLG+L VGF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVALDQIGHFGLIAMAIFLGVLVVGFVYEWKKGALEWE 118


>gi|291334202|gb|ADD93869.1| NADH ubiquinone/plastoquinone oxidoreductase chain 3 [uncultured
           marine bacterium MedDCM-OCT-S08-C1340]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ IA     V+M + F     +PD EK S YECGF+PF+D+R+KFD+RF
Sbjct: 1   MLFEYLPILIFLFIALIFASVMMTAGFFFGGSNPDSEKNSPYECGFEPFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV    I + GF +M VFL IL +GFIYEWKKGALEWD
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVLDHIGYEGFLAMAVFLFILLIGFIYEWKKGALEWD 118


>gi|294011307|ref|YP_003544767.1| NADH dehydrogenase I chain A [Sphingobium japonicum UT26S]
 gi|292674637|dbj|BAI96155.1| NADH dehydrogenase I chain A [Sphingobium japonicum UT26S]
          Length = 124

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/121 (49%), Positives = 81/121 (66%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA  +    +  P +V        PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAEYLPILIFLGIALLLSSAFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFL+PWAV   QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLYPWAVSLDQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|149914577|ref|ZP_01903107.1| NADH dehydrogenase subunit A [Roseobacter sp. AzwK-3b]
 gi|149811370|gb|EDM71205.1| NADH dehydrogenase subunit A [Roseobacter sp. AzwK-3b]
          Length = 121

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 95/121 (78%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M ++L  Y PILV +A+A  + +VL+++  + A ++PDPEKLS YECGF+ FDDAR+KFD
Sbjct: 1   MEEMLREYLPILVLLAVAIGLGLVLLLAAIVAAVRNPDPEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIA LFPWAV F+ I+   F SMM FL +LT GF YEW+KGA+EW
Sbjct: 61  VRFYLVSILFIIFDLEIAMLFPWAVAFQDISMTAFWSMMAFLAVLTAGFAYEWRKGAMEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|149927541|ref|ZP_01915795.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Limnobacter
           sp. MED105]
 gi|149823814|gb|EDM83040.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Limnobacter
           sp. MED105]
          Length = 119

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 91/117 (77%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L SY P+L+F+ +   +    M+   ++A   PD +KLS YECGF+ F+DAR++FD+R+ 
Sbjct: 3   LESYFPVLMFILVGIGVGGGAMLVGRVLAPHRPDGQKLSPYECGFEAFEDARMQFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLEIAFLFPWAV +++I  +GF +MM+FLG+L VGFIYEW +GAL+W+
Sbjct: 63  LVAILFILFDLEIAFLFPWAVAYREIGPVGFWAMMIFLGVLVVGFIYEWTRGALDWE 119


>gi|84686427|ref|ZP_01014321.1| NADH dehydrogenase alpha subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665610|gb|EAQ12086.1| NADH dehydrogenase alpha subunit [Rhodobacterales bacterium
           HTCC2654]
          Length = 121

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 77/121 (63%), Positives = 100/121 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M DLL  Y PI++F+A+A  + +VL+++  ++A + PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MEDLLREYLPIVIFLAVAVGLGLVLVLAAAVLAVRHPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLEIAFLFPWAV FK +  +GF SMMVFL +LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEIAFLFPWAVAFKDVGMIGFWSMMVFLAVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|83746297|ref|ZP_00943350.1| NADH-quinone oxidoreductase chain A [Ralstonia solanacearum UW551]
 gi|207723873|ref|YP_002254271.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum MolK2]
 gi|207742735|ref|YP_002259127.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum IPO1609]
 gi|300703642|ref|YP_003745244.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CFBP2957]
 gi|83727047|gb|EAP74172.1| NADH-quinone oxidoreductase chain A [Ralstonia solanacearum UW551]
 gi|206589078|emb|CAQ36040.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum MolK2]
 gi|206594129|emb|CAQ61056.1| transmembrane nadh dehydrogenaseI(chain a) protein [Ralstonia
           solanacearum IPO1609]
 gi|299071305|emb|CBJ42623.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CFBP2957]
          Length = 119

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDPEKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVIGVGLGLALMSIGRILGPNNPDPEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|114330925|ref|YP_747147.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nitrosomonas
           eutropha C91]
 gi|114307939|gb|ABI59182.1| NADH dehydrogenase subunit A [Nitrosomonas eutropha C91]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 93/118 (78%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F+ +   +  + +++ +++A   PD EKLSTYECGF  F+DAR+KFD+R+
Sbjct: 1   MLGNYFPILLFILVGLLVGTLCLVAGWLLAPNKPDAEKLSTYECGFGAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FDLEIAFLFPWAV  K++   GF +M+VFLG+L VGFIYEW KGALEWD
Sbjct: 61  YLIAILFILFDLEIAFLFPWAVALKEVGLFGFIAMLVFLGLLVVGFIYEWAKGALEWD 118


>gi|91782612|ref|YP_557818.1| NADH dehydrogenase subunit A [Burkholderia xenovorans LB400]
 gi|296160629|ref|ZP_06843444.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. Ch1-1]
 gi|123168725|sp|Q142H3|NUOA_BURXL RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|91686566|gb|ABE29766.1| NADH dehydrogenase subunit A [Burkholderia xenovorans LB400]
 gi|295889155|gb|EFG68958.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. Ch1-1]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|167585971|ref|ZP_02378359.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ubonensis Bu]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNRPDVEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|187929293|ref|YP_001899780.1| NADH dehydrogenase subunit A [Ralstonia pickettii 12J]
 gi|309781852|ref|ZP_07676585.1| threonine synthase [Ralstonia sp. 5_7_47FAA]
 gi|223635480|sp|B2U7R1|NUOA_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|187726183|gb|ACD27348.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ralstonia
           pickettii 12J]
 gi|308919493|gb|EFP65157.1| threonine synthase [Ralstonia sp. 5_7_47FAA]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + LM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|197105268|ref|YP_002130645.1| NADH dehydrogenase I, A subunit [Phenylobacterium zucineum HLK1]
 gi|196478688|gb|ACG78216.1| NADH dehydrogenase I, A subunit [Phenylobacterium zucineum HLK1]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 77/125 (61%), Positives = 97/125 (77%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y PI++F+ IA+A+ I  +++  I A K+PDPEKLS+YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLEYLPIVIFLGIAAALGIAFILAAAIFAPKAPDPEKLSSYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITW----LGFGSMMVFLGILTVGFIYEWKKG 116
           IRF LVS+LF+IFDLE+AFLFPWAV   ++        F SMM FLG+LTVGFIYEWKKG
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVTLMKLPPEASQFAFWSMMTFLGVLTVGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|194595688|gb|ACF77131.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Azospirillum
           brasilense]
          Length = 97

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 82/97 (84%)

Query: 25  LMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWA 84
           ++ + +I++ K+PD EKLS YECGF+PF+DAR KFD+RF LVS+LF+IFDLE+AFLFPWA
Sbjct: 1   MVGASYIISPKNPDSEKLSPYECGFEPFEDARTKFDVRFYLVSILFIIFDLEVAFLFPWA 60

Query: 85  VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V    I   GF SM+VFLGILT+GFIYEWKKGALEW+
Sbjct: 61  VALGDIGLFGFWSMIVFLGILTIGFIYEWKKGALEWE 97


>gi|323525436|ref|YP_004227589.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1001]
 gi|323382438|gb|ADX54529.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           sp. CCGE1001]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + + L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLLVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|315499788|ref|YP_004088591.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Asticcacaulis
           excentricus CB 48]
 gi|315417800|gb|ADU14440.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Asticcacaulis
           excentricus CB 48]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PI++F  IA  + +  +I+  ++A K+PD EKLS YECGF+ FD AR KFD
Sbjct: 1   MEALLIKYLPIVIFFGIALVLGLGFIIAALVLAPKAPDTEKLSAYECGFNAFDSARQKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV    +        F SMMVFLG+LTVGFIYEW KG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSMFDLPQAGMQFAFWSMMVFLGVLTVGFIYEWNKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|23464620|ref|NP_696988.1| NADH dehydrogenase subunit 9 [Monosiga brevicollis ATCC 50154]
 gi|23344083|gb|AAN28359.1| NADH dehydrogenase subunit 9 [Monosiga brevicollis]
          Length = 118

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y+ +L+F+ +A A+  VL+ + ++++ K+PD EK+  YECGF+PF D+R  F++RF
Sbjct: 1   MLFEYSAVLIFLIVALALSCVLLGASYLLSNKNPDYEKVQQYECGFNPFSDSRQPFEVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW++    I   G+ +M+ FLGILT+G +YEW KG LEW+
Sbjct: 61  FLVGILFIIFDLEISFLFPWSLVLSDIHVFGYWTMVTFLGILTIGLVYEWLKGGLEWE 118


>gi|54298772|ref|YP_125141.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Paris]
 gi|53752557|emb|CAH13989.1| NADH dehydrogenase I chain A [Legionella pneumophila str. Paris]
          Length = 118

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 88/118 (74%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ +A  +  V++ +  +++  SP+  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIVALILGAVMIGAGSLLSKHSPNSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|238651034|ref|YP_002916891.1| NADH dehydrogenase subunit A [Rickettsia peacockii str. Rustic]
 gi|20139042|sp|Q92ID5|NUOA_RICCN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|238625132|gb|ACR47838.1| NADH dehydrogenase subunit A [Rickettsia peacockii str. Rustic]
          Length = 123

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 86/119 (72%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 65  CFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 123


>gi|221103087|ref|XP_002161534.1| PREDICTED: similar to NADH dehydrogenase (ubiquinone), subunit 3
           [Hydra magnipapillata]
          Length = 123

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 62/120 (51%), Positives = 88/120 (73%), Gaps = 4/120 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD----DARVKFD 60
           L +Y  ILVF+A+A     +L+   ++   ++P  +K + YECGFD FD    +AR +FD
Sbjct: 3   LEAYFSILVFLAVAFGFAALLLGLSWLRGKQNPYKQKEAPYECGFDAFDLPTQNARKQFD 62

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF+IFDLEIAFLFPWA+  + I W GF SM++FL +LTVGF+YEW+KGAL+W
Sbjct: 63  VQFYLVAILFIIFDLEIAFLFPWAISLETIGWQGFWSMLIFLSVLTVGFVYEWRKGALDW 122


>gi|330817792|ref|YP_004361497.1| Putative transmembrane NADH dehydrogenase I, NuoA [Burkholderia
           gladioli BSR3]
 gi|327370185|gb|AEA61541.1| Putative transmembrane NADH dehydrogenase I, NuoA [Burkholderia
           gladioli BSR3]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + L+    ++    P+ EK S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLIVGVGLGVALVGIGKVLGPNKPNSEKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V F+ I W GF +MM+FL     GF Y W+KG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVAFRDIGWPGFMAMMIFLLEFLFGFAYIWRKGGLDWE 119


>gi|85708755|ref|ZP_01039821.1| NADH Dehydrogenase I Chain A [Erythrobacter sp. NAP1]
 gi|85690289|gb|EAQ30292.1| NADH Dehydrogenase I Chain A [Erythrobacter sp. NAP1]
          Length = 124

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 82/121 (67%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA  + ++     M    +    +PD EKLS YECGF  F+DAR +FD
Sbjct: 4   LAQYLPILLFIFIAFGLSVLFVFLPMGVSRLTGAHNPDAEKLSEYECGFPAFEDARSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++ F+IFDLE AFLFPWAV   +  W+G+  MM FLGIL +G  YEWKKGAL+W
Sbjct: 64  VRFYLVAISFIIFDLEAAFLFPWAVSLGETGWVGWIGMMTFLGILAIGLAYEWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|167562177|ref|ZP_02355093.1| NADH dehydrogenase subunit A [Burkholderia oklahomensis EO147]
 gi|167569422|ref|ZP_02362296.1| NADH dehydrogenase subunit A [Burkholderia oklahomensis C6786]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    I+    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|254251861|ref|ZP_04945179.1| NADH dehydrogenase alpha subunit [Burkholderia dolosa AUO158]
 gi|124894470|gb|EAY68350.1| NADH dehydrogenase alpha subunit [Burkholderia dolosa AUO158]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVGIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|78067046|ref|YP_369815.1| NADH dehydrogenase subunit A [Burkholderia sp. 383]
 gi|107023188|ref|YP_621515.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia AU 1054]
 gi|115352338|ref|YP_774177.1| NADH dehydrogenase subunit A [Burkholderia ambifaria AMMD]
 gi|116690270|ref|YP_835893.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia HI2424]
 gi|161524204|ref|YP_001579216.1| NADH dehydrogenase subunit A [Burkholderia multivorans ATCC 17616]
 gi|170698109|ref|ZP_02889189.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria IOP40-10]
 gi|170733609|ref|YP_001765556.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia MC0-3]
 gi|171316303|ref|ZP_02905524.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MEX-5]
 gi|172061209|ref|YP_001808861.1| NADH dehydrogenase subunit A [Burkholderia ambifaria MC40-6]
 gi|189351039|ref|YP_001946667.1| NADH dehydrogenase subunit A [Burkholderia multivorans ATCC 17616]
 gi|206560703|ref|YP_002231468.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia J2315]
 gi|221199656|ref|ZP_03572700.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2M]
 gi|221205444|ref|ZP_03578459.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2]
 gi|221211735|ref|ZP_03584714.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD1]
 gi|254247657|ref|ZP_04940978.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Burkholderia
           cenocepacia PC184]
 gi|122322641|sp|Q0BDD0|NUOA_BURCM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123244855|sp|Q1BV13|NUOA_BURCA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123568004|sp|Q39EE5|NUOA_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635421|sp|B1YTQ7|NUOA_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635422|sp|B1JVP1|NUOA_BURCC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635423|sp|B4E5M2|NUOA_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635425|sp|A9AJP4|NUOA_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635445|sp|A0K923|NUOA_BURCH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|77967791|gb|ABB09171.1| NADH dehydrogenase subunit A [Burkholderia sp. 383]
 gi|105893377|gb|ABF76542.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia AU 1054]
 gi|115282326|gb|ABI87843.1| NADH dehydrogenase subunit A [Burkholderia ambifaria AMMD]
 gi|116648359|gb|ABK09000.1| NADH dehydrogenase subunit A [Burkholderia cenocepacia HI2424]
 gi|124872433|gb|EAY64149.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Burkholderia
           cenocepacia PC184]
 gi|160341633|gb|ABX14719.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           multivorans ATCC 17616]
 gi|169816851|gb|ACA91434.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           cenocepacia MC0-3]
 gi|170136967|gb|EDT05215.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria IOP40-10]
 gi|171098529|gb|EDT43330.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MEX-5]
 gi|171993726|gb|ACB64645.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Burkholderia
           ambifaria MC40-6]
 gi|189335061|dbj|BAG44131.1| NADH dehydrogenase I chain A [Burkholderia multivorans ATCC 17616]
 gi|198036745|emb|CAR52645.1| NADH dehydrogenase I chain A [Burkholderia cenocepacia J2315]
 gi|221169096|gb|EEE01564.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD1]
 gi|221174282|gb|EEE06714.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2]
 gi|221180941|gb|EEE13344.1| NADH dehydrogenase I, A subunit [Burkholderia multivorans CGD2M]
 gi|325520397|gb|EGC99515.1| NADH:ubiquinone oxidoreductase subunit A [Burkholderia sp. TJI49]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD EK + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|300691025|ref|YP_003752020.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           PSI07]
 gi|299078085|emb|CBJ50728.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           PSI07]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +VLM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIVGVGLGLVLMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|241663484|ref|YP_002981844.1| NADH dehydrogenase subunit A [Ralstonia pickettii 12D]
 gi|240865511|gb|ACS63172.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Ralstonia
           pickettii 12D]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + + LM    ++   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+S+LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LISILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|260574758|ref|ZP_05842761.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodobacter
           sp. SW2]
 gi|259023175|gb|EEW26468.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodobacter
           sp. SW2]
          Length = 121

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 77/120 (64%), Positives = 99/120 (82%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  LL  Y PIL+ +A+A  + +VL+++  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MDALLREYLPILILLALAIGLGLVLILAAVVLAIRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F QI+ LGF SMM+FL +LTVGF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGQISMLGFWSMMIFLTVLTVGFAYEWKKGALEW 120


>gi|299066333|emb|CBJ37517.1| NADH-quinone oxidoreductase subunit A [Ralstonia solanacearum
           CMR15]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|312886636|ref|ZP_07746243.1| NADH dehydrogenase subunit A [Mucilaginibacter paludis DSM 18603]
 gi|311300738|gb|EFQ77800.1| NADH dehydrogenase subunit A [Mucilaginibacter paludis DSM 18603]
          Length = 200

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 75/125 (60%), Gaps = 9/125 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ +  IL+F+     +V + +    ++A  +P PEKL++YECG +P  ++ ++F+ +F 
Sbjct: 7   ISEFGKILIFLITGFLLVGITLFVNRLIAPHNPTPEKLTSYECGEEPEGNSWIQFNPKFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQ---------ITWLGFGSMMVFLGILTVGFIYEWKK 115
           +++++F++FD+E+ F+FPWA  F             W     M +F+GIL +G +Y W K
Sbjct: 67  VIALVFLLFDVEMVFIFPWATVFGNHEIIKATPTWGWFSLAEMFIFIGILILGLVYVWVK 126

Query: 116 GALEW 120
           G L+W
Sbjct: 127 GDLDW 131


>gi|67458959|ref|YP_246583.1| NADH dehydrogenase subunit A [Rickettsia felis URRWXCal2]
 gi|75536603|sp|Q4UM05|NUOA_RICFE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|67004492|gb|AAY61418.1| NADH dehydrogenase I chain A [Rickettsia felis URRWXCal2]
          Length = 123

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 88/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 123


>gi|17546781|ref|NP_520183.1| NADH dehydrogenase subunit A [Ralstonia solanacearum GMI1000]
 gi|81768558|sp|Q8XXQ1|NUOA_RALSO RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|17429081|emb|CAD15769.1| probable transmembrane nadh dehydrogenaseI(chain a) oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 119

 Score =  107 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ I   + + LM    I+   +PDP+KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE 119


>gi|134296433|ref|YP_001120168.1| NADH dehydrogenase subunit A [Burkholderia vietnamiensis G4]
 gi|223635433|sp|A4JGD0|NUOA_BURVG RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|134139590|gb|ABO55333.1| NADH dehydrogenase subunit A [Burkholderia vietnamiensis G4]
          Length = 119

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ + + + I L+    ++    PD +K + YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFSAMMIFLLEFLLGFAYIWKKGGLDWE 119


>gi|307293270|ref|ZP_07573116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphingobium
           chlorophenolicum L-1]
 gi|306881336|gb|EFN12552.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphingobium
           chlorophenolicum L-1]
          Length = 124

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 81/121 (66%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA  +    +  P +V        PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAEYLPILIFLGIALLLSSAFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV   QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|156742063|ref|YP_001432192.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
 gi|223635482|sp|A7NL04|NUOA_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|156233391|gb|ABU58174.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 118

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I VF   A    +V +++ + +  K P P KL TYECG +   D RV+F I++
Sbjct: 1   MLADYAFIGVFFIGAVIFPLVPLVAAYFLGPKRPTPIKLDTYECGLEAVGDIRVQFKIQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV + QI      +M +FL IL  G +YEWKKGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAYGQIGLFALIAMAIFLVILVGGLVYEWKKGALEW 117


>gi|300311095|ref|YP_003775187.1| transmembrane NADH dehydrogenase I subunit A [Herbaspirillum
           seropedicae SmR1]
 gi|300073880|gb|ADJ63279.1| transmembrane NADH dehydrogenase I (Chain A) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 119

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +   +   ++    PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LENYFPVLLFILVGIGVGVAPQLLGRLLGPHKPDAQKTSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AF FPW V  +++ W GF +MMVF+    VGF Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFFFPWGVSMRELGWQGFVTMMVFIAEFVVGFWYIWKKGALDWE 119


>gi|197120287|ref|YP_002140714.1| NADH dehydrogenase I subunit A [Geobacter bemidjiensis Bem]
 gi|253702595|ref|YP_003023784.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M21]
 gi|223635402|sp|B5EFG3|NUOA2_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|197089647|gb|ACH40918.1| NADH dehydrogenase I, A subunit [Geobacter bemidjiensis Bem]
 gi|251777445|gb|ACT20026.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M21]
          Length = 118

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV + IA    +  +I   ++  K P   KL+ YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPILVLVVIAVLFGLGSVIFSSLIGQKKPSTVKLAPYECGCEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E  FL+PWAV FK++   G   M VF+ IL VG++Y WKKGALEW+
Sbjct: 61  YLIAMLFILFDIEAVFLYPWAVLFKRLGMFGLIEMGVFIVILFVGYVYVWKKGALEWE 118


>gi|157825618|ref|YP_001493338.1| NADH dehydrogenase subunit A [Rickettsia akari str. Hartford]
 gi|157799576|gb|ABV74830.1| NADH dehydrogenase subunit A [Rickettsia akari str. Hartford]
          Length = 123

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI VF  IA  +  ++MI P +++ K  + +KL  YECGF PF DAR KFDI
Sbjct: 5   SELLQEYLPIAVFFGIAVLVSGLIMILPNLLSTKHYNKDKLEPYECGFKPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFD+EIAFL PWA+    I  +GF SM+ FL +LT+GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDIEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW 123


>gi|115494870|ref|YP_778640.1| NADH dehydrogenase subunit 3 [Chrysopathes formosa]
 gi|82792231|gb|ABB90980.1| NADH dehydrogenase subunit 3 [Chrysopathes formosa]
          Length = 118

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F +RF
Sbjct: 1   MLTEFYGILVLLIFSVILSAIISGASYILGVKQPDREKVSAYECGFDPFRTPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF+IFDLEI+FLFPW V + Q++ +GF +M+VFL ILT+G IYEW KG LEW+
Sbjct: 61  FLIAILFLIFDLEISFLFPWCVIYNQVSPVGFWTMVVFLIILTLGLIYEWIKGGLEWE 118


>gi|157803901|ref|YP_001492450.1| NADH dehydrogenase subunit A [Rickettsia canadensis str. McKiel]
 gi|157785164|gb|ABV73665.1| NADH dehydrogenase alpha subunit [Rickettsia canadensis str.
           McKiel]
          Length = 123

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 85/119 (71%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+ L  Y PI +F  IA  +  ++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SEFLQEYLPIAIFCIIAVLVSSLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +L +GFIYEWKKGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIVFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW 123


>gi|315465329|emb|CBQ72564.1| NADH:ubiquinone oxidoreductase subunit 3 / LA GLIDADG endonuclease
           [Sporisorium reilianum]
          Length = 274

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGF-DPFDDARVKFDIRFCLVSV 68
            I +F      + ++L+ +  ++A   PD EK++ YECGF   +   R  F I+F LV +
Sbjct: 3   TITLFFIFIPILAVILLFANLLLAVHRPDSEKVTPYECGFSPVYGQTRNPFSIQFYLVGI 62

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           LF++FD+E+   +P+AV   Q +  GF   ++F  +LT+GF+YE+  GAL
Sbjct: 63  LFLVFDIELLMTYPFAVNLYQTSAYGFWIFVIFFLVLTIGFVYEFGTGAL 112


>gi|84516743|ref|ZP_01004101.1| NADH dehydrogenase alpha subunit [Loktanella vestfoldensis SKA53]
 gi|84509211|gb|EAQ05670.1| NADH dehydrogenase alpha subunit [Loktanella vestfoldensis SKA53]
          Length = 121

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 102/121 (84%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M D++++Y PI++F+ +A A+ ++L+I+  ++A ++PDPEK+S YECGF+ FDDAR+KFD
Sbjct: 1   MPDIVSNYLPIMIFLGLAIALGLLLIIAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWAV F  I+   F SMM+FLG+LT+GF YEWKKGALEW
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVAFGDISMTAFWSMMIFLGVLTIGFAYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|325267310|ref|ZP_08133972.1| NADH-quinone oxidoreductase subunit A [Kingella denitrificans ATCC
           33394]
 gi|324981247|gb|EGC16897.1| NADH-quinone oxidoreductase subunit A [Kingella denitrificans ATCC
           33394]
          Length = 122

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F  I     IV ++    +  K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVLIFAIIGLIAGIVFILLGTFLGPKRHYAEKDTPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K +        F SM+VF+ +LTVGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMVPWAVVYKDLMADTGAYAFWSMLVFIVVLTVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|296116535|ref|ZP_06835145.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976747|gb|EFG83515.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 121

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  ++  Y P+L+F AIA  I   ++ S  +  ++ P  EK S YECGF+PFDD R +FD
Sbjct: 1   MHSVIADYFPVLIFGAIAVVIAAAMLGSSLLFGWQKPYSEKTSAYECGFEPFDDTRRRFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE+AFLFPWAV   +I W GF SMM FL +LTVGFIYEW KGALEW
Sbjct: 61  VRFYLVAILFIIFDLEVAFLFPWAVSLSRIGWFGFLSMMGFLAVLTVGFIYEWCKGALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|322421850|ref|YP_004201073.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M18]
 gi|320128237|gb|ADW15797.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           M18]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV + IA    +  +I   ++  K P   KL+ YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPILVLVVIAVLFGMGSVIFSSLIGQKKPSQVKLAPYECGCEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E  FL+PWAV FK++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YMVAMLFILFDIEAVFLYPWAVLFKRLGMFGLVEMGLFIVILFVGYIYVWKKGALEWE 118


>gi|260751303|gb|ACX48925.1| NADH dehydrogenase subunit 3 [Leiopathes glaberrima]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F +RF
Sbjct: 1   MLTEFYGILVLLIFSVILSAIISGASYILGVKQPDREKVSAYECGFDPFGTPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF+IFDLEI+FLFPW V + QI+ +GF +M+VFL ILT+G IYEW KG LEW+
Sbjct: 61  FLIAILFLIFDLEISFLFPWCVIYNQISPVGFWTMVVFLIILTLGLIYEWIKGGLEWE 118


>gi|114321119|ref|YP_742802.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227513|gb|ABI57312.1| NADH dehydrogenase subunit A [Alkalilimnicola ehrlichii MLHE-1]
          Length = 118

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILVF+       +V +   F++A   PD EKLS YECGF+ F+D+R+KFD+R+
Sbjct: 1   MLENYLPILVFIIFGLLFGMVFLAVGFLLAPSKPDAEKLSPYECGFEAFEDSRMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWA+    I   G  +M +F+G+L +GF+YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAIVLDDIGMFGILAMALFIGLLLIGFLYEWKKGALEWE 118


>gi|90417844|ref|ZP_01225756.1| NADH-ubiquinone oxidoreductase chain 7 [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337516|gb|EAS51167.1| NADH-ubiquinone oxidoreductase chain 7 [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 117

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 99/121 (81%), Gaps = 4/121 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL SY PI++F+ +A  I + L++SPF++AFK+PD EKL    CGFD FDD+R+KFD
Sbjct: 1   MPELLASYLPIVIFVGVALLIGLALLVSPFLLAFKAPDDEKL----CGFDAFDDSRMKFD 56

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LVS+LF+IFDLE+AFLFPWA  F  + W GF SMMVFLG+LTVGFIYEWKKGALEW
Sbjct: 57  VRFYLVSILFIIFDLEVAFLFPWAATFGTLGWFGFWSMMVFLGVLTVGFIYEWKKGALEW 116

Query: 121 D 121
           D
Sbjct: 117 D 117


>gi|239811633|gb|ACS27120.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
 gi|239811673|gb|ACS27159.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
 gi|288871930|dbj|BAI70616.1| NADH dehydrogenase subunit 3 [Heterosigma akashiwo]
          Length = 122

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 85/120 (70%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S  +  Y+P+L+F+ I+  +  V+    +++A   PD EKLS YECGFDP++DAR  FD+
Sbjct: 3   SLFIQEYSPVLIFLGISIVLSGVIFGLSYVLAIHKPDTEKLSPYECGFDPYEDARQAFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF+IFDLE  +LFPWA+   QI  +GF +M+ FL  L +GF+Y W+ GALEW+
Sbjct: 63  RFYLVAILFIIFDLEAMYLFPWAISLNQIGSMGFWTMLDFLVELGIGFVYAWRVGALEWE 122


>gi|329118898|ref|ZP_08247593.1| NADH-quinone oxidoreductase subunit A [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464926|gb|EGF11216.1| NADH-quinone oxidoreductase subunit A [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 135

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L++Y P+ +FM +  A  ++ +    ++       EK + +ECGF+ F++AR+KFD+R+
Sbjct: 18  MLSNYFPVFIFMLVGLAAGVLFIALGLLLGPNRHYAEKDTPFECGFEAFENARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEIAF+ PWAV FK++       M+VF+ +L +GF+YEWKKGALEW+
Sbjct: 78  YLVAILFILFDLEIAFVIPWAVVFKELGAPALWPMLVFIVVLGIGFVYEWKKGALEWE 135


>gi|94496482|ref|ZP_01303059.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           sp. SKA58]
 gi|94424228|gb|EAT09252.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           sp. SKA58]
          Length = 124

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 82/121 (67%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAF----KSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA  +    +  P +V        PDP KLS YECGF  F++ R +FD
Sbjct: 4   LAQYLPILIFLGIALLLSGTFVFLPMLVGRLTGAHQPDPAKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV  +QI W G+ +MM+F+  L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLEQIGWAGWATMMIFIAELVLGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|3122487|sp|Q36518|NU3M_PLASU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|633586|emb|CAA87750.1| NADH dehydrogenase subunit 3 [Platymonas subcordiformis]
          Length = 117

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  +L++   + A+  +++   FI A + PDPEK+S YECGFDPFDDAR KFDIRF 
Sbjct: 1   MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE+ FLFPWAV   +I + GF +MM FL ILT+GFIYEWKKGALEW+
Sbjct: 61  LVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE 117


>gi|295697745|ref|YP_003590983.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
 gi|295413347|gb|ADG07839.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
          Length = 121

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 74/120 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+    SY  +++F+ +A A+ +V +     +    P  EKL  YE G +P  DARV+++
Sbjct: 1   MTAYWNSYLFVVIFVVLAIALAVVALTLGKWLRPAHPSREKLEPYESGVEPVGDARVQYN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            R+ L ++LFV+FD+EI FL+PWAV F ++   G    ++F+ +L +G +Y W+K  LEW
Sbjct: 61  ARYYLFALLFVVFDVEILFLYPWAVAFHELGLFGLVEALIFMAMLVIGLVYAWRKKVLEW 120


>gi|294788084|ref|ZP_06753328.1| NADH dehydrogenase (ubiquinone), A subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294484377|gb|EFG32060.1| NADH dehydrogenase (ubiquinone), A subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 122

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F  +     IV ++   I+  K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVLIFAIVGLIAGIVFILLGTILGPKRHYAEKDTPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K +        F SM+VF+ +LTVGFIYEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVYKDLMAQTGAYAFWSMLVFIVVLTVGFIYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|304413371|ref|ZP_07394844.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Candidatus
           Regiella insecticola LSR1]
 gi|304284214|gb|EFL92607.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Candidatus
           Regiella insecticola LSR1]
          Length = 271

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +   ++++ F +  K+    K   YE G D    A+++   
Sbjct: 130 TEVIAHHWAFAVFIISAIGLCGFMLLAAFFLGGKARARAKHIPYESGIDSVGSAQMRLSA 189

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  WLGF    +F+ +L  G +Y  + GAL W
Sbjct: 190 KFYLVAMFFVIFDVEALYLYAWSVSIRENGWLGFIEASIFIFVLLAGLVYLVRIGALNW 248


>gi|257095319|ref|YP_003168960.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257047843|gb|ACV37031.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 124

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+ VF+ +  A     +++  IVA   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLESYFPVFVFILVGVAFGFAPVLTGLIVAPHRPDSEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGA 117
            L++++F++FDLE+AFL PWA  FK+I       W GF  M+VF+ IL VG++Y W KGA
Sbjct: 61  YLIAIIFILFDLEVAFLLPWATIFKEIVHTDSVRWFGFIEMLVFIAILVVGYVYAWAKGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|6137790|ref|NP_009260.1| NADH dehydrogenase subunit 3 [Metridium senile]
 gi|3122484|sp|Q35100|NU3M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1353407|gb|AAC47101.1| NADH dehydrogenase subunit 3 [Metridium senile]
 gi|2920992|gb|AAC04637.1| NADH dehydrogenase subunit 3 [Metridium senile]
          Length = 118

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  ILV +  +  +  ++  + +I+  K PD EK+S YECGFDPF      F IRF
Sbjct: 1   MYTEFYGILVLLIFSVVLSAIISGASYILGDKQPDREKVSAYECGFDPFGTPGRPFSIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW V   Q+   G+ +M+VFL +LT+G +YEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWCVVCNQVFPFGYWTMIVFLAVLTLGLVYEWLKGGLEWE 118


>gi|15604225|ref|NP_220741.1| NADH dehydrogenase subunit A [Rickettsia prowazekii str. Madrid E]
 gi|6647677|sp|Q9ZDH1|NUOA_RICPR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|3860917|emb|CAA14817.1| NADH DEHYDROGENASE I CHAIN A (nuoA) [Rickettsia prowazekii]
 gi|292571966|gb|ADE29881.1| NADH dehydrogenase I chain A [Rickettsia prowazekii Rp22]
          Length = 123

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  + +++MI P +++ K  + +KL  YECGF+PF DAR KFDI
Sbjct: 5   SELLQEYLPIAIFFGIAVLLSVLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEIAFL PWA+    I  +GF SMM FL +L +GFIYEW KGAL+W
Sbjct: 65  RFYLVAILFIIFDLEIAFLVPWAISLNTIGKMGFFSMMFFLFVLIIGFIYEWTKGALDW 123


>gi|11465631|ref|NP_049302.1| NADH dehydrogenase subunit 3 [Porphyra purpurea]
 gi|6647616|sp|O99978|NU3M_PORPU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|4106938|gb|AAD03105.1| NADH dehydrogenase subunit 3 [Porphyra purpurea]
          Length = 121

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 91/121 (75%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ L   Y+ IL F AI+ +I  +++   + +  +  D EK+S YECGF+PFDDAR  FD
Sbjct: 1   MNVLYNEYSAILTFFAISFSISTLILALSYFLNPQPSDQEKVSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPW++   Q++  GF SM+VFL ILT+GFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFLIFDLEISFLFPWSLVLGQLSIFGFWSMIVFLIILTLGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|15836908|ref|NP_297596.1| NADH dehydrogenase subunit A [Xylella fastidiosa 9a5c]
 gi|9105128|gb|AAF83116.1|AE003884_1 NADH-ubiquinone oxidoreductase, NQO7 subunit [Xylella fastidiosa
           9a5c]
          Length = 135

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|20198300|gb|AAM15514.1| hypothetical protein [Arabidopsis thaliana]
          Length = 477

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 62/115 (53%), Positives = 83/115 (72%), Gaps = 1/115 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +++ +API +++ I+  + ++L+  PF   +  S  PEKLS YECGFDP  DAR +FDIR
Sbjct: 359 MMSEFAPISIYLVISLLVSLILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIR 418

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           F LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 419 FYLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 473


>gi|71275690|ref|ZP_00651975.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Dixon]
 gi|71897854|ref|ZP_00680080.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|170729489|ref|YP_001774922.1| NADH dehydrogenase subunit A [Xylella fastidiosa M12]
 gi|182680805|ref|YP_001828965.1| NADH dehydrogenase subunit A [Xylella fastidiosa M23]
 gi|71163581|gb|EAO13298.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Dixon]
 gi|71732409|gb|EAO34463.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|167964282|gb|ACA11292.1| NADH-ubiquinone oxidoreductase, NQO7 subunit [Xylella fastidiosa
           M12]
 gi|182630915|gb|ACB91691.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xylella
           fastidiosa M23]
          Length = 135

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|222053570|ref|YP_002535932.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           FRC-32]
 gi|221562859|gb|ACM18831.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter sp.
           FRC-32]
          Length = 118

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI++ +A+A A  +  +I   ++  K P   KLS YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPIILLVAVAVAFGLGSIIFSSLIGPKKPSEVKLSPYECGVEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  FL+PWAV FK++   G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|238794607|ref|ZP_04638214.1| NADH dehydrogenase I chain A [Yersinia intermedia ATCC 29909]
 gi|238726093|gb|EEQ17640.1| NADH dehydrogenase I chain A [Yersinia intermedia ATCC 29909]
          Length = 167

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWVGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|6647657|sp|O84969|NUOA_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|3282559|gb|AAC24985.1| NUOA [Rhodobacter capsulatus]
          Length = 126

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 95/117 (81%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILV +A+A  + ++L+ +  I+A+++PDPEK+S YECGF+ FDDAR+KFD+RF
Sbjct: 9   MLREYLPILVLLAMAIGLGLILIAAAAIIAYRNPDPEKVSAYECGFNAFDDARMKFDVRF 68

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LVS+LF+IFDLE+AFLFPWAV F  ++   F SMMVFL +LTVGF YEWKKGALEW
Sbjct: 69  YLVSILFIIFDLEVAFLFPWAVAFGDMSMTAFWSMMVFLSVLTVGFAYEWKKGALEW 125


>gi|227112327|ref|ZP_03825983.1| NADH dehydrogenase subunit A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227326167|ref|ZP_03830191.1| NADH dehydrogenase subunit A [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|6647660|sp|O85273|NUOA_PECCC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|3273735|gb|AAC38640.1| NADH dehydrogenase chain A [Pectobacterium carotovorum subsp.
           carotovorum]
          Length = 146

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ IA  + + ++   F++  ++    K   YE G D    AR++   
Sbjct: 5   TEILAHHWAFGLFLIIAVGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  W+GF    +F+ +L  G IY  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGALDW 123


>gi|302035991|ref|YP_003796313.1| NADH-quinone oxidoreductase membrane subunit A [Candidatus
           Nitrospira defluvii]
 gi|300604055|emb|CBK40387.1| NADH-quinone oxidoreductase, membrane subunit A [Candidatus
           Nitrospira defluvii]
          Length = 123

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y PIL+F+ IA A   V ++   IV    P   KL+ YE G   F DARV+F IR+ ++
Sbjct: 9   NYIPILIFIVIAFAFGAVQILLGRIVRPSRPYRAKLAPYESGSPLFSDARVQFPIRYYII 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+EI F+FPWAV FK++  +G   M+VF+ IL VGF Y WKKGALEWD
Sbjct: 69  AMLFVIFDIEIVFMFPWAVAFKKLGLVGLVEMVVFIAILIVGFWYAWKKGALEWD 123


>gi|21243432|ref|NP_643014.1| NADH dehydrogenase subunit A [Xanthomonas axonopodis pv. citri str.
           306]
 gi|325924675|ref|ZP_08186113.1| NADH dehydrogenase subunit A [Xanthomonas perforans 91-118]
 gi|21108985|gb|AAM37550.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|325544881|gb|EGD16226.1| NADH dehydrogenase subunit A [Xanthomonas perforans 91-118]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +  +SPDP KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLVGRFLGPRSPDPRKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|238759962|ref|ZP_04621115.1| NADH dehydrogenase I chain A [Yersinia aldovae ATCC 35236]
 gi|238701789|gb|EEP94353.1| NADH dehydrogenase I chain A [Yersinia aldovae ATCC 35236]
          Length = 163

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWVGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|194289159|ref|YP_002005066.1| NADH dehydrogenase subunit a [Cupriavidus taiwanensis LMG 19424]
 gi|193222994|emb|CAQ68999.1| NADH:ubiquinone oxidoreductase complex I, membrane subunit A
           [Cupriavidus taiwanensis LMG 19424]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGVALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  K I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALKDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|289065171|ref|YP_003434223.1| NADH dehydrogenase subunit 3 [Chattonella marina]
 gi|288871883|dbj|BAI70570.1| NADH dehydrogenase subunit 3 [Chattonella marina]
          Length = 122

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 83/120 (69%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S  L +Y+PIL+F+ ++  +  ++    + +A   PD EKLS YECGFDP++DAR  FD+
Sbjct: 3   SLFLQNYSPILIFLGLSIILSGIIFGLSYFLAIHKPDTEKLSPYECGFDPYEDARQAFDV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           RF LV++LF++FDLE  +LFPWAV   Q   +GF SM+ FL  L +GF+Y W+ G LEW+
Sbjct: 63  RFYLVAILFILFDLEAMYLFPWAVSLNQTGVMGFWSMVDFLVELGIGFVYAWRIGGLEWE 122


>gi|270158114|ref|ZP_06186771.1| NADH-quinone oxidoreductase A subunit [Legionella longbeachae
           D-4968]
 gi|289163621|ref|YP_003453759.1| NADH dehydrogenase I chain A [Legionella longbeachae NSW150]
 gi|269990139|gb|EEZ96393.1| NADH-quinone oxidoreductase A subunit [Legionella longbeachae
           D-4968]
 gi|288856794|emb|CBJ10605.1| NADH dehydrogenase I chain A [Legionella longbeachae NSW150]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+L+F+ I  A+ + ++ +  + +   PD  K + YECGF  F++A + FD+RF
Sbjct: 1   MLSQYFPVLIFIIIGVALGLAMIGAGSLFSKHMPDNAKNAPYECGFGAFENAHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF  MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALVLRKIGWFGFAGMMLFLGLLVIGFIYEWKRGALEWE 118


>gi|145589234|ref|YP_001155831.1| NADH dehydrogenase subunit A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|223635471|sp|A4SXQ3|NUOA_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145047640|gb|ABP34267.1| NADH dehydrogenase subunit A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 85/117 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V M    I+A   PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W G+ SM++FL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWFGYASMVIFLLEFIVGFVYIWKKGALDWE 119


>gi|113867070|ref|YP_725559.1| NADH dehydrogenase subunit A [Ralstonia eutropha H16]
 gi|113525846|emb|CAJ92191.1| NADH dehydrogenase chain A [Ralstonia eutropha H16]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGVALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|309792518|ref|ZP_07686981.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Oscillochloris trichoides DG6]
 gi|308225421|gb|EFO79186.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Oscillochloris trichoides DG6]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I VF   A +  ++ ++  F +  K P P KLSTYECG +   D RV+F +++
Sbjct: 1   MLANYAFIGVFFVAALSFPVIPLLLAFFLRPKRPAPLKLSTYECGLEAIGDIRVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F ++   GF + MVFL +L  G IYEW+KGALEW
Sbjct: 61  YLYALAFVIFDVEVVFLYPWAVAFNKVGLYGFTAAMVFLAMLFAGLIYEWRKGALEW 117


>gi|218661623|ref|ZP_03517553.1| NADH dehydrogenase subunit A [Rhizobium etli IE4771]
          Length = 121

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|171463526|ref|YP_001797639.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|223635470|sp|B1XUJ8|NUOA_POLNS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|171193064|gb|ACB44025.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 119

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V M    I+A   PD EKLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  + I WLG+ SM++FL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALRDIGWLGYASMVIFLLEFIVGFVYIWKKGALDWE 119


>gi|148361102|ref|YP_001252309.1| NADH dehydrogenase I subunit A [Legionella pneumophila str. Corby]
 gi|148282875|gb|ABQ56963.1| NADH dehydrogenase I, A subunit [Legionella pneumophila str. Corby]
          Length = 118

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 87/118 (73%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y P+LVF+ IA  +  V++ +  +++  SPD  K S YECGF  F+ + + FD+RF
Sbjct: 1   MLSQYLPVLVFIIIALILGAVMIGAGSLLSKHSPDSAKNSPYECGFGAFESSHIPFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AF FPWA+  ++I W GF +MM+FLG+L +GFIYEWK+ ALEW+
Sbjct: 61  YLVAILFIIFDLETAFFFPWALALRKIGWFGFYAMMLFLGLLVIGFIYEWKRSALEWE 118


>gi|294669092|ref|ZP_06734178.1| NADH dehydrogenase, A subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309084|gb|EFE50327.1| NADH dehydrogenase, A subunit [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 122

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     I+ ++   ++  K    EK   +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYLPVLIFLIVGLLAGILFILLGTVLGPKRHYAEKDQPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV FK +        F SM VF+ +L VGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVFKNLLAQSGQFAFWSMFVFIVVLGVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|28198171|ref|NP_778485.1| NADH dehydrogenase subunit A [Xylella fastidiosa Temecula1]
 gi|28056241|gb|AAO28134.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xylella fastidiosa
           Temecula1]
 gi|307579273|gb|ADN63242.1| NADH dehydrogenase subunit A [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 118

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 1   MLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|73666918|ref|YP_302934.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           canis str. Jake]
 gi|72394059|gb|AAZ68336.1| NADH dehydrogenase subunit A [Ehrlichia canis str. Jake]
          Length = 123

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 88/123 (71%), Gaps = 2/123 (1%)

Query: 1   MSDLLT--SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVK 58
           M+ +L    Y P+L+F+A+A  I  +  + P ++A  +PD EKLS YECGF P   +R  
Sbjct: 1   MTQMLNIAEYVPVLIFLAVAGFISFLFAVLPMLLAKCNPDLEKLSPYECGFAPLGSSRKI 60

Query: 59  FDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           FD+RF LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL ILTVGFIYEW KGAL
Sbjct: 61  FDVRFYLVAILFIIFDLEIAFLFPWSICLSDIGVNGFWSMMIFLAILTVGFIYEWSKGAL 120

Query: 119 EWD 121
           EW+
Sbjct: 121 EWE 123


>gi|95928443|ref|ZP_01311191.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135714|gb|EAT17365.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Desulfuromonas acetoxidans DSM 684]
          Length = 118

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PILV + +A    +  +   F+   K P   KL+ YECG      AR +F ++F
Sbjct: 1   MLESYLPILVLITVALLFALGSVTFSFLFGPKKPSAVKLAPYECGMPLIGTARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E  FL+PWAV FK++   GF  M VF+ IL VG++Y WKKGALEW+
Sbjct: 61  YIVAMLFILFDIEAVFLYPWAVVFKRLGMFGFIEMGVFIVILLVGYVYVWKKGALEWE 118


>gi|254419969|ref|ZP_05033693.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Brevundimonas sp. BAL3]
 gi|196186146|gb|EDX81122.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Brevundimonas sp. BAL3]
          Length = 125

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L  Y P+++F  IA+ I ++ +  P ++A KSPD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MNAFLLEYLPVIIFAGIAAFIGVLFIALPMLLAPKSPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQIT----WLGFGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF+IFDLE+AFLFPWAV    ++       F SMMVFLG+LT+GFIYEWKKG
Sbjct: 61  VRFYLVSILFIIFDLEVAFLFPWAVSMFDLSHAGMIFAFWSMMVFLGVLTIGFIYEWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|86357236|ref|YP_469128.1| NADH dehydrogenase subunit A [Rhizobium etli CFN 42]
 gi|86281338|gb|ABC90401.1| NADH-ubiquinone oxidoreductase chain A protein [Rhizobium etli CFN
           42]
          Length = 121

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 1   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 61  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLFVLTIGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254491806|ref|ZP_05104985.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Methylophaga thiooxidans DMS010]
 gi|224463284|gb|EEF79554.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Methylophaga thiooxydans DMS010]
          Length = 117

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y PIL+F+ I     ++ +++ FI+  + PD EK S YECGF+PF+D+ +KFD+R+ 
Sbjct: 1   MENYLPILLFIIIGIGFGVMPLLAGFILGPRHPDDEKRSAYECGFEPFEDSHMKFDVRYY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWA+    I   G  SM +FL IL VGF+YEWKKGALEW+
Sbjct: 61  LVAILFIIFDLEIAFLFPWAIVLDDIGVFGLLSMFLFLAILVVGFVYEWKKGALEWE 117


>gi|332968235|gb|EGK07312.1| NADH-quinone oxidoreductase subunit A [Kingella kingae ATCC 23330]
          Length = 122

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F  +     I+ +    +   K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLENYFPVLIFAIVGLIAGILFIGLGTLFGPKRHYAEKDAPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K +        F SM+VF+ +LTVGFIYEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVYKDLMAETGAFAFWSMLVFIVVLTVGFIYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|302842767|ref|XP_002952926.1| NADH:ubiquinone oxidoreductase ND3 subunit [Volvox carteri f.
           nagariensis]
 gi|300261637|gb|EFJ45848.1| NADH:ubiquinone oxidoreductase ND3 subunit [Volvox carteri f.
           nagariensis]
          Length = 271

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 2/114 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           S+ P ++  AI++ I  V ++ P +VA    D +K S YECGFD F +AR  F + F LV
Sbjct: 158 SFYPYVIATAISTVIATVFIVVPLVVAPSRVDLDKSSAYECGFDAFGEARQTFSVSFYLV 217

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           S+++++FD+EIA+LFP+A+    +      +M +FL IL  GF YEW  GALEW
Sbjct: 218 SIMYLLFDIEIAYLFPYAMSHASLPMY--WTMNLFLAILVAGFAYEWGMGALEW 269


>gi|256821515|ref|YP_003145478.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Kangiella
           koreensis DSM 16069]
 gi|256795054|gb|ACV25710.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Kangiella
           koreensis DSM 16069]
          Length = 118

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  YAPILVF+ I       L++  +  +  +PDPEK   +ECGFD F+D+R+KFD+RF
Sbjct: 1   MIEQYAPILVFIIIGLLFGTGLLLVGYFASPTNPDPEKEKAFECGFDAFEDSRMKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEIAFLFPWAV F  + W G  SM VFL +L +GF YEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEIAFLFPWAVVFDDLGWFGVVSMGVFLLLLLIGFAYEWKKGALEWE 118


>gi|71906588|ref|YP_284175.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Dechloromonas aromatica RCB]
 gi|71846209|gb|AAZ45705.1| NADH dehydrogenase subunit A [Dechloromonas aromatica RCB]
          Length = 124

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +Y PIL+F+ +  AI ++ +   FI+A   PDPEKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MMENYFPILMFVLVGVAIGVLPVAMGFILAPSRPDPEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLE+AFLFPWA  FK       I   GF  M+VF+ IL +G+IY W KGA
Sbjct: 61  YLIAILFILFDLEVAFLFPWATIFKDIVATESIKMFGFVEMLVFVAILVLGYIYAWAKGA 120

Query: 118 LEWD 121
           LEW+
Sbjct: 121 LEWE 124


>gi|71897766|ref|ZP_00679992.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
 gi|71732321|gb|EAO34375.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Xylella
           fastidiosa Ann-1]
          Length = 135

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+ +A+ I + L++    +    PD EKLS+YECGF  F+DAR+KFD+R+
Sbjct: 18  VLAEYLPILIFLVVATGIGLALILIGRFLGPHRPDSEKLSSYECGFSAFEDARMKFDVRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 78  YLIAIQFIVFDLEIIFIVPWTQVFMDIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 135


>gi|261820792|ref|YP_003258898.1| NADH dehydrogenase subunit A [Pectobacterium wasabiae WPP163]
 gi|261604805|gb|ACX87291.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pectobacterium wasabiae WPP163]
          Length = 146

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ IA  + + ++   F++  ++    K   YE G D    AR++   
Sbjct: 5   TEILAHHWAFALFLIIAIGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLVYLVRVGALDW 123


>gi|109156559|ref|YP_654369.1| NADH dehydrogenase subunit 3 [Nematostella sp. JVK-2006]
 gi|156320442|ref|XP_001618182.1| hypothetical protein NEMVEDRAFT_v1g225413 [Nematostella vectensis]
 gi|108744122|gb|ABG02343.1| NADH dehydrogenase subunit 3 [Nematostella sp. JVK-2006]
 gi|156197894|gb|EDO26082.1| predicted protein [Nematostella vectensis]
          Length = 118

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  +LV +  +  +  V+  + +I+  K PD EK+S YECGFDPF      F IRF
Sbjct: 1   MYTEFYGLLVLIIFSVILSAVISGASYILGDKQPDREKVSAYECGFDPFGAPGRPFSIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+F+FPW V + QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFIFPWCVVYNQISPFGYWTMILFLVILTLGLVYEWLKGGLEWE 118


>gi|50121951|ref|YP_051118.1| NADH dehydrogenase subunit A [Pectobacterium atrosepticum SCRI1043]
 gi|81693180|sp|Q6D2R7|NUOA_ERWCT RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|49612477|emb|CAG75927.1| NADH-quinone oxidoreductase chain A [Pectobacterium atrosepticum
           SCRI1043]
          Length = 146

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ IA  + + ++   F++  ++    K   YE G D    AR++   
Sbjct: 5   TEILAHHWAFALFLIIAIGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  W+GF    +F+ +L  G IY  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGALDW 123


>gi|114777361|ref|ZP_01452358.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Mariprofundus ferrooxydans PV-1]
 gi|114552143|gb|EAU54645.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Mariprofundus ferrooxydans PV-1]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             YAPI +F+ IA  +    +   +++A + P+ EK S YECGF+ F+DAR++FD+RF L
Sbjct: 8   NEYAPIFIFIIIAFVMGAAPLALTYLLAEQRPNAEKRSAYECGFEAFEDARMQFDVRFYL 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LFV+FDLE AFLFPWAV   +I   GF  MM+FL IL VG+IY WKKGAL+W+
Sbjct: 68  VAILFVVFDLESAFLFPWAVVLNKIGLFGFVEMMMFLVILLVGYIYAWKKGALQWE 123


>gi|162448792|ref|YP_001611159.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
 gi|161159374|emb|CAN90679.1| NADH dehydrogenase (ubiquinone) [Sorangium cellulosum 'So ce 56']
          Length = 118

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 71/117 (60%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +Y P+ +   +A+ I + +     ++  ++P PEK+  YECG D      VK  ++F 
Sbjct: 1   MATYIPLFLLFLVAAIIALAMFTLTSLLGPRNPTPEKMIPYECGSDSTGGRFVKPSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L ++LFV+FD+E   ++PW+V F+ + W G  +M  F+ +L V  +Y WKKGALEW+
Sbjct: 61  LTAILFVVFDIEAVLIYPWSVQFRNLGWTGLATMSSFVALLVVALVYVWKKGALEWE 117


>gi|194033229|ref|YP_002000566.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|60498743|dbj|BAC19871.2| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
          Length = 155

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 1/121 (0%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFD 60
           S  L+ +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FD
Sbjct: 35  SAFLSEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFD 94

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W
Sbjct: 95  IRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDW 154

Query: 121 D 121
           +
Sbjct: 155 E 155


>gi|73540664|ref|YP_295184.1| NADH dehydrogenase subunit A [Ralstonia eutropha JMP134]
 gi|123625485|sp|Q473U3|NUOA_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|72118077|gb|AAZ60340.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ralstonia
           eutropha JMP134]
          Length = 119

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + I LM    I+    PDP KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIIFGVVLGIALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  ++I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALREIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|150406499|ref|YP_001315092.1| NADH dehydrogenase subunit 3 [Chlorokybus atmophyticus]
 gi|126507736|gb|ABO15133.1| NADH dehydrogenase subunit 3 [Chlorokybus atmophyticus]
          Length = 118

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  Y  IL+++ ++  + +V++   F +      DPEK+S YECGFDPFDDAR +FD+RF
Sbjct: 1   MIEYLSILIYLIVSLILSLVILALSFFLGSSYKADPEKISAYECGFDPFDDARNRFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+ FLFPWAV   ++  LGF +MMVFL ILT+GFIYEWKKGALEW+
Sbjct: 61  YLVAILFIIFDLEVTFLFPWAVTLNRLNLLGFWTMMVFLIILTIGFIYEWKKGALEWE 118


>gi|110225667|ref|YP_665673.1| NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
 gi|6066182|gb|AAF03200.1|AF110138_32 NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
          Length = 118

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVA-FKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  Y  ILV++ I+  +  +++   F+V   +  DPEKLS YECGFDPF+DAR +FDIRF
Sbjct: 1   MLEYISILVYLIISLGLAGLILGLSFLVGTPQKADPEKLSAYECGFDPFEDARGRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE+ FLFPWAV   +    GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 61  YLVAILFIIFDLEVTFLFPWAVTLSKQGLFGFWSMMVFLMILTIGFVYEWKKGALDWE 118


>gi|285017792|ref|YP_003375503.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenaseI chain a)
           (ndh-1, chain a) (nuo1) oxidoreductase [Xanthomonas
           albilineans GPE PC73]
 gi|283473010|emb|CBA15515.1| probable nadh-quinone oxidoreductase chain a (nadh dehydrogenaseI
           chain a) (ndh-1, chain a) (nuo1). oxidoreductase protein
           [Xanthomonas albilineans]
          Length = 118

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I + LM+    +  + PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPTLLFLIVATGIGVALMLIGRFLGPRRPDLKKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F  +      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMDLGARSLVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|148244389|ref|YP_001219083.1| NADH dehydrogenase I chain A [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326216|dbj|BAF61359.1| NADH dehydrogenase I chain A [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 118

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI+VF+ +     I  M+  +++    P+ EK + +ECGF  F+D+R  F+IR+
Sbjct: 1   MLENYLPIVVFIFLGLFFGIGPMLIGYLLGPSKPNEEKNTQFECGFPAFNDSRTYFNIRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV   Q+ W GF  M +FL +L VGF++EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSQLGWFGFVVMSIFLFLLIVGFVFEWKNGALEWE 118


>gi|254521491|ref|ZP_05133546.1| NADH-ubiquinone oxidoreductase Nqo7 subunit [Stenotrophomonas sp.
           SKA14]
 gi|219719082|gb|EED37607.1| NADH-ubiquinone oxidoreductase Nqo7 subunit [Stenotrophomonas sp.
           SKA14]
          Length = 118

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  + PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGITLMLVGRFLGPRRPDLEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F ++      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMELGARSLITMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|2499257|sp|Q36664|NU3M_PINSY RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 118

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ A   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVCLIPLGVPFLFASNGSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|253689148|ref|YP_003018338.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251755726|gb|ACT13802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 146

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ IA  + + ++   F++  ++    K   YE G D    AR++   
Sbjct: 5   TEILAHHWAFGLFLIIAVGLCVFMLTGGFLLGGRARARAKNVPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  W+GF    +F+ +L  G IY  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGALDW 123


>gi|116251466|ref|YP_767304.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241204086|ref|YP_002975182.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|115256114|emb|CAK07195.1| putative transmembrane NADH-quinone oxidoreductase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240857976|gb|ACS55643.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 122

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLLVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|296140851|ref|YP_003648094.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Tsukamurella
           paurometabola DSM 20162]
 gi|296028985|gb|ADG79755.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Tsukamurella
           paurometabola DSM 20162]
          Length = 119

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PILV  AIA+A  +  +     V  +  +  KL  YECG DP        +F ++
Sbjct: 1   MNPYVPILVLGAIATAFAVFSVGVAQYVGPRRRNRAKLEAYECGIDPSPHPTGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F L ++LF+IFD+EI FL+PWAV+F  +   G  +M +FL  +TV + YEW++G LEWD
Sbjct: 61  FYLTAMLFIIFDIEIVFLYPWAVHFDVLGAYGLAAMALFLVNVTVAYAYEWRRGGLEWD 119


>gi|148657098|ref|YP_001277303.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
 gi|223635483|sp|A5UXK0|NUOA_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|148569208|gb|ABQ91353.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
          Length = 118

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I VF   A    I+ + + + +  K P P KL TYECG +   D RV+F I++
Sbjct: 1   MLANYAFIGVFFIGAIIFPIIPLAAAYFLGPKRPTPIKLDTYECGLEAIGDIRVQFKIQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV + Q+    F +M +FL IL  G +YEWKKGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAYGQLGLFAFIAMAIFLIILIGGLVYEWKKGALEW 117


>gi|78224545|ref|YP_386292.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Geobacter
           metallireducens GS-15]
 gi|123570770|sp|Q39QA7|NUOA2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|78195800|gb|ABB33567.1| NADH dehydrogenase subunit A [Geobacter metallireducens GS-15]
          Length = 118

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PILV +AIA    +  ++   ++  K P   KL+ YECG +P   AR +F ++F
Sbjct: 1   MLGAYLPILVLVAIAVIFGLCSLVFSSLIGQKKPSVVKLAPYECGCEPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  FL+PW+V FK++   G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFLYPWSVLFKRLGMFGVMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|317492623|ref|ZP_07951050.1| NADH-ubiquinone/plastoquinone oxidoreductase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919373|gb|EFV40705.1| NADH-ubiquinone/plastoquinone oxidoreductase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 146

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +  V+++  + +  ++    K + YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFIIVALGLCGVMLLGAYALGGRARARAKNTPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSIRESGWVGFIEAAIFILVLLAGLFYLVRIGALDW 123


>gi|329850729|ref|ZP_08265574.1| NADH-quinone oxidoreductase chain 7 [Asticcacaulis biprosthecum
           C19]
 gi|328841044|gb|EGF90615.1| NADH-quinone oxidoreductase chain 7 [Asticcacaulis biprosthecum
           C19]
          Length = 125

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L +Y P+++F  IA+A+ +  +I+  ++A K+PD EKLS YECGF  FD AR KFD
Sbjct: 1   MAKFLLNYLPVIIFFGIATALGLGFLIAALVMAPKAPDTEKLSAYECGFPAFDSARQKFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLG----FGSMMVFLGILTVGFIYEWKKG 116
           +RF LVS+LF++FD+E AFLFPWAV    +T  G    F +MM+FL  L +G++Y WKKG
Sbjct: 61  VRFYLVSILFIVFDIEAAFLFPWAVSLFDMTPSGMQYAFWTMMIFLAELALGYVYVWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|209548862|ref|YP_002280779.1| NADH dehydrogenase subunit A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534618|gb|ACI54553.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 122

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 103/121 (85%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++LL+SY PI +F+AIA  I + L+I+PF VAFK+PD EKLS YECGF+ FDDAR+KFD
Sbjct: 2   MTELLSSYIPIAIFIAIALVIGLALLIAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LVS+LF+IFDLE+AFLFPWAV F  I W GF SMMVFL +LT+GFIYEWKKGALEW
Sbjct: 62  IRFYLVSILFIIFDLEVAFLFPWAVSFGAIGWFGFWSMMVFLFVLTIGFIYEWKKGALEW 121

Query: 121 D 121
           +
Sbjct: 122 E 122


>gi|160872304|ref|ZP_02062436.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Rickettsiella grylli]
 gi|159121103|gb|EDP46441.1| NADH-quinone oxidoreductase chain a (nadh dehydrogenasei, chain a)
           (ndh-1, chain a) [Rickettsiella grylli]
          Length = 118

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL+F+     + +  +   ++   + PD  KLS YECGF    DAR+ FD+R+
Sbjct: 1   MLQQYFPILIFIVFGLFLGVAALSMGYLTGLQRPDWAKLSPYECGFPGMSDARLPFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE AFLFPWAV  + I   G  +M +FL +L +GF+YEWKKGAL+W+
Sbjct: 61  YLVAILFIIFDLETAFLFPWAVSLRHIGLPGLLAMGIFLSLLLLGFVYEWKKGALQWE 118


>gi|170676856|ref|YP_001742099.1| NADH dehydrogenase subunit 3 [Suberites domuncula]
 gi|170649722|emb|CAM84214.1| NADH dehydrogenase subunit 3 [Suberites domuncula]
          Length = 118

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 81/118 (68%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  I + +  +  +  ++  + +IV  K PD EK+S YECGFDPF  +RV F ++F
Sbjct: 1   MSTEFLGIFILILFSITLSTIISGASYIVGVKHPDSEKVSVYECGFDPFGSSRVPFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI  LGF +M +FL ILTVG IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVVYNQIGLLGFWTMYIFLVILTVGLIYEWAKGGLEWE 118


>gi|332162389|ref|YP_004298966.1| NADH dehydrogenase subunit A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606468|emb|CBY27966.1| NADH ubiquinone oxidoreductase chain A [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325666619|gb|ADZ43263.1| NADH dehydrogenase subunit A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860336|emb|CBX70649.1| NADH-quinone oxidoreductase subunit A [Yersinia enterocolitica
           W22703]
          Length = 163

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 7   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEATIFILVLLAGLVYLVRIGALDW 125


>gi|221633753|ref|YP_002522979.1| NADH ubiquinone oxidoreductase subunit A [Thermomicrobium roseum
           DSM 5159]
 gi|221156542|gb|ACM05669.1| nadh ubiquinone oxidoreductase chain a [Thermomicrobium roseum DSM
           5159]
          Length = 119

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 70/116 (60%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  YA I + +  ++ +  VL++    V  + P+P KL  YE G       R +F  RF 
Sbjct: 3   LIDYAVIGLLIITSTVMGTVLILLGHFVRPRKPNPAKLQPYESGVPDVSPPRGRFTPRFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LFV+FD+E  FL+PWAV F  +   G+    +F+GIL +G +YEW+KGALEW
Sbjct: 63  LVALLFVVFDVEAIFLYPWAVAFDALALYGYVQAALFVGILLLGLLYEWRKGALEW 118


>gi|222839816|ref|YP_002587030.1| NADH dehydrogenase subunit 3/LAGLIDADG endonuclease [Glomus
           intraradices]
 gi|306960128|ref|YP_003875544.1| NADH dehydrogenase subunit 3 [Glomus irregulare]
 gi|222136778|gb|ACM45010.1| NADH dehydrogenase subunit 3/LAGLIDADG endonuclease [Glomus
           intraradices]
 gi|306490558|gb|ADM94799.1| NADH dehydrogenase subunit 3 [Glomus irregulare]
          Length = 296

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 69/109 (63%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           ++ F+      V++L+    +VA  +PD  K++ YECG  P  DAR KF I F LV++LF
Sbjct: 2   LVFFLLFVPLFVLILLGVNMLVATNNPDSAKMAPYECGMPPASDARHKFQISFFLVAILF 61

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           ++FD EI FL+P  V    I+  GF   MVF+ +LT+GF+YE  KGAL+
Sbjct: 62  LVFDCEILFLYPLVVSLYHISSFGFWVAMVFILLLTIGFVYELGKGALD 110


>gi|302035623|ref|YP_003795945.1| NADH-quinone oxidoreductase membrane subunit A [Candidatus
           Nitrospira defluvii]
 gi|300603687|emb|CBK40018.1| NADH-quinone oxidoreductase, membrane subunit A [Candidatus
           Nitrospira defluvii]
          Length = 127

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 85/119 (71%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           + L+ Y PILVF+ +A A     ++  + V  K P+PEKLSTYECG +PF DAR+ F +R
Sbjct: 9   EYLSRYFPILVFVFVALAFGAGTLLISYFVQPKYPEPEKLSTYECGSEPFSDARMPFPVR 68

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + ++LFVIFD+E+ FL+PWA+ F +I  +G   M++F+G+  V ++Y W+KGALEWD
Sbjct: 69  YYIFAMLFVIFDVEVIFLYPWAIVFNKIGLIGLIEMLIFIGLFLVAYVYAWRKGALEWD 127


>gi|170581931|ref|XP_001895903.1| NADH dehydrogenase I, A subunit  [Brugia malayi]
 gi|158597003|gb|EDP35244.1| NADH dehydrogenase I, A subunit , putative [Brugia malayi]
          Length = 172

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 65/116 (56%), Positives = 84/116 (72%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I +F+ ++  + + L + P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLAIAIFICVSIILSLALGVLPMFLAISKPDSEKLSTYECGFNPLSRARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LVS LF+IFDLEIAFLFP A+   +I++ GF SMM+FL ILTVGFI+EW KGALEW
Sbjct: 61  LVSXLFMIFDLEIAFLFPCAISLSKISYCGFWSMMIFLAILTVGFIHEWCKGALEW 116


>gi|291280357|ref|YP_003497192.1| NADH-quinone oxidoreductase subunit A [Deferribacter desulfuricans
           SSM1]
 gi|290755059|dbj|BAI81436.1| NADH-quinone oxidoreductase, A subunit [Deferribacter desulfuricans
           SSM1]
          Length = 117

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI + + I++ I  + +    +V  K P+  KLS YECG   F DAR ++ ++F 
Sbjct: 1   MSPYLPIALMLIISALIGAITITVGVLVRPKKPEKVKLSVYECGMPEFSDARKRYSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  I   G   M++F+ IL  G+ Y W+KGALEW
Sbjct: 61  IIAMLFVIFDVETVFLFPWAVAFDMIGLFGLVEMIIFIIILVFGYFYAWRKGALEW 116


>gi|51473551|ref|YP_067308.1| NADH dehydrogenase subunit A [Rickettsia typhi str. Wilmington]
 gi|81692303|sp|Q68X16|NUOA_RICTY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|51459863|gb|AAU03826.1| NADH dehydrogenase (ubiquinone) subunit A [Rickettsia typhi str.
           Wilmington]
          Length = 123

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 84/119 (70%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+LL  Y PI +F  IA  +  ++M+ P +++ K  + +KL  YECGF PF DAR KFDI
Sbjct: 5   SELLHEYLPIAIFFGIAVLVSGLIMMLPNLLSTKKYNKDKLEPYECGFAPFSDARSKFDI 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++LF+IFDLEI FL PWA+    I  +GF SMM FL +L +GFIYEW KGAL+W
Sbjct: 65  RFYLVAILFIIFDLEITFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWTKGALDW 123


>gi|39995447|ref|NP_951398.1| NADH dehydrogenase I subunit A [Geobacter sulfurreducens PCA]
 gi|81703478|sp|Q74GA8|NUOA1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|39982210|gb|AAR33671.1| NADH dehydrogenase I, A subunit [Geobacter sulfurreducens PCA]
 gi|298504446|gb|ADI83169.1| NADH dehydrogenase I, A subunit [Geobacter sulfurreducens KN400]
          Length = 118

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PI+V +A+A    +  +    ++  K P   KL+ YECG +P   AR +F ++F
Sbjct: 1   MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECGCEPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  F++PW+V FK++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFVGYIYVWKKGALEWE 118


>gi|21231960|ref|NP_637877.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767913|ref|YP_242675.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21113691|gb|AAM41801.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66573245|gb|AAY48655.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas campestris
           pv. campestris str. 8004]
          Length = 118

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLVVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|149365539|ref|ZP_01887574.1| NADH dehydrogenase I chain A [Yersinia pestis CA88-4125]
 gi|166008302|ref|ZP_02229200.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|218929641|ref|YP_002347516.1| NADH dehydrogenase subunit A [Yersinia pestis CO92]
 gi|294504369|ref|YP_003568431.1| NADH dehydrogenase alpha subunit [Yersinia pestis Z176003]
 gi|115348252|emb|CAL21180.1| NADH dehydrogenase I chain A [Yersinia pestis CO92]
 gi|149291952|gb|EDM42026.1| NADH dehydrogenase I chain A [Yersinia pestis CA88-4125]
 gi|165992684|gb|EDR44985.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|262366271|gb|ACY62828.1| NADH dehydrogenase alpha subunit [Yersinia pestis D182038]
 gi|294354828|gb|ADE65169.1| NADH dehydrogenase alpha subunit [Yersinia pestis Z176003]
          Length = 164

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  + +  ++    K   YE G D    AR++   
Sbjct: 5   TEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDW 123


>gi|332185806|ref|ZP_08387553.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Sphingomonas sp. S17]
 gi|332014164|gb|EGI56222.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Sphingomonas sp. S17]
          Length = 124

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 58/121 (47%), Positives = 82/121 (67%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L+ Y PIL+F+ +A A+        M+   +     P+ +KLS YECGF  F+D R +FD
Sbjct: 4   LSQYLPILLFLGVALALSTAFVFLPMLVARLTGAHQPNEQKLSEYECGFPAFEDPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFL+PWAV    I W+ + SMM+F+G L +G +Y WKKGAL+W
Sbjct: 64  VRFYLVAILFIIFDLEAAFLYPWAVSVFSIGWVAWISMMIFIGELALGLVYAWKKGALDW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|111220499|ref|YP_711293.1| NADH dehydrogenase subunit A [Frankia alni ACN14a]
 gi|111148031|emb|CAJ59697.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [Frankia alni ACN14a]
          Length = 144

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +L++Y PILV +AIA+   +  + +  ++  +  +  K+  YECG +P        +F +
Sbjct: 25  MLSNYVPILVLLAIATLFAVGSVAAGALIGPRRFNRAKIDAYECGIEPSPAPAGPQRFPV 84

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++   ++LF++FD+EI FLFPWAV F  +   G G+M +F+  + V + YEW++G LEWD
Sbjct: 85  KYYNTAMLFIVFDIEIIFLFPWAVAFDSLKVFGLGAMALFMATIFVAYAYEWRRGGLEWD 144


>gi|238788654|ref|ZP_04632446.1| NADH dehydrogenase I chain A [Yersinia frederiksenii ATCC 33641]
 gi|238723249|gb|EEQ14897.1| NADH dehydrogenase I chain A [Yersinia frederiksenii ATCC 33641]
          Length = 152

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWVGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|329901006|ref|ZP_08272667.1| NADH ubiquinone oxidoreductase chain A [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549294|gb|EGF33869.1| NADH ubiquinone oxidoreductase chain A [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 119

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + +V  +   ++A   PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LETYFPVLLFILVGIGVGVVPQLLGRVLAPFKPDSQKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF++FDLE AF FPW V  + + W GF +M+VF+    VGF Y WKKGAL+W+
Sbjct: 63  LVAILFILFDLETAFFFPWGVAMRDLGWAGFVTMLVFIAEFAVGFWYIWKKGALDWE 119


>gi|186895987|ref|YP_001873099.1| NADH dehydrogenase subunit A [Yersinia pseudotuberculosis PB1/+]
 gi|223635517|sp|B2K821|NUOA_YERPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|186699013|gb|ACC89642.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Yersinia
           pseudotuberculosis PB1/+]
          Length = 166

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  + +  ++    K   YE G D    AR++   
Sbjct: 7   TEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF   ++F+ +L  G  Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAVIFILVLLAGLFYLVRIGALDW 125


>gi|111074958|gb|ABH04820.1| NAD(P)H-quinone oxidoreductase subunit 3 [Heliobacillus mobilis]
          Length = 118

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 64/117 (54%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  I +F+A    I I   +   +   +     K   YECG +   D  V+F   +
Sbjct: 1   MLKEYLGISLFLAAGFVIPIAAFLVSRLFQTRRTSRVKADPYECGMETIGDTWVQFKSNY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L +++FV FD+E  FL+PWAV F+Q+    F  M +F+ IL VGF Y WK+GALEW
Sbjct: 61  FLYALVFVAFDVETVFLYPWAVKFQQLGTFAFVEMFIFIAILVVGFWYAWKEGALEW 117


>gi|94309872|ref|YP_583082.1| NADH dehydrogenase subunit A [Cupriavidus metallidurans CH34]
 gi|93353724|gb|ABF07813.1| NADH dehydrogenase chain A [Cupriavidus metallidurans CH34]
          Length = 119

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+     + + LM    I+    PD  KLS YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LEAYFPVLIFIVFGVVLGVALMAIGRILGPYKPDAAKLSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPW V  K I W GF +M VFL    VGF+Y WKKGAL+W+
Sbjct: 63  LIAILFILFDLETAFLFPWGVALKDIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE 119


>gi|118602275|ref|YP_903490.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gi|118567214|gb|ABL02019.1| NADH dehydrogenase subunit A [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 118

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P++VF+ +  A  +  M+  +++    P  EK + +ECGF  FDD+R+ F++R+
Sbjct: 1   MLESYIPVIVFIFLGLAFGVGPMLIGYLLGPSKPYEEKNTQFECGFPAFDDSRMYFNVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLE+AF+FPWAV   Q+ W GF ++ +FL +L VGFI+EWK GALEW+
Sbjct: 61  YLVAILFILFDLEVAFVFPWAVVQSQLGWFGFIAISIFLFLLAVGFIFEWKNGALEWE 118


>gi|22125525|ref|NP_668948.1| NADH dehydrogenase subunit A [Yersinia pestis KIM 10]
 gi|45442155|ref|NP_993694.1| NADH dehydrogenase subunit A [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596906|ref|YP_071097.1| NADH dehydrogenase subunit A [Yersinia pseudotuberculosis IP 32953]
 gi|108808042|ref|YP_651958.1| NADH dehydrogenase subunit A [Yersinia pestis Antiqua]
 gi|108812312|ref|YP_648079.1| NADH dehydrogenase subunit A [Yersinia pestis Nepal516]
 gi|145599245|ref|YP_001163321.1| NADH dehydrogenase subunit A [Yersinia pestis Pestoides F]
 gi|153947088|ref|YP_001400433.1| NADH dehydrogenase subunit A [Yersinia pseudotuberculosis IP 31758]
 gi|162420042|ref|YP_001606304.1| NADH dehydrogenase subunit A [Yersinia pestis Angola]
 gi|165925566|ref|ZP_02221398.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937712|ref|ZP_02226274.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166213780|ref|ZP_02239815.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399190|ref|ZP_02304714.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422316|ref|ZP_02314069.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424650|ref|ZP_02316403.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170023801|ref|YP_001720306.1| NADH dehydrogenase subunit A [Yersinia pseudotuberculosis YPIII]
 gi|229838097|ref|ZP_04458256.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229895296|ref|ZP_04510470.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           Pestoides A]
 gi|229898657|ref|ZP_04513802.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229902656|ref|ZP_04517773.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           Nepal516]
 gi|270490162|ref|ZP_06207236.1| NADH dehydrogenase I subunit A [Yersinia pestis KIM D27]
 gi|81691720|sp|Q669A0|NUOA_YERPS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|122979537|sp|Q1C6A9|NUOA_YERPA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|122980103|sp|Q1CHQ1|NUOA_YERPN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635497|sp|A9R6M0|NUOA_YERPG RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635498|sp|A4TM36|NUOA_YERPP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635499|sp|B1JGL3|NUOA_YERPY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635516|sp|A7FGQ5|NUOA_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635531|sp|Q0WDX2|NUOA_YERPE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|21958424|gb|AAM85199.1|AE013766_2 NADH dehydrogenase I chain A [Yersinia pestis KIM 10]
 gi|45437019|gb|AAS62571.1| NADH dehydrogenase I chain A [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590188|emb|CAH21825.1| NADH dehydrogenase I chain A [Yersinia pseudotuberculosis IP 32953]
 gi|108775960|gb|ABG18479.1| NADH dehydrogenase I chain A [Yersinia pestis Nepal516]
 gi|108779955|gb|ABG14013.1| NADH dehydrogenase I chain A [Yersinia pestis Antiqua]
 gi|145210941|gb|ABP40348.1| NADH dehydrogenase I chain A [Yersinia pestis Pestoides F]
 gi|152958583|gb|ABS46044.1| NADH-quinone oxidoreductase, A subunit [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352857|gb|ABX86805.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis Angola]
 gi|165914462|gb|EDR33077.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922675|gb|EDR39826.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|166204954|gb|EDR49434.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958822|gb|EDR55843.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051694|gb|EDR63102.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056532|gb|EDR66301.1| NADH-quinone oxidoreductase, A subunit [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750335|gb|ACA67853.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Yersinia
           pseudotuberculosis YPIII]
 gi|229680103|gb|EEO76202.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           Nepal516]
 gi|229688205|gb|EEO80276.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229694463|gb|EEO84510.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229701782|gb|EEO89807.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           Pestoides A]
 gi|262362642|gb|ACY59363.1| NADH dehydrogenase alpha subunit [Yersinia pestis D106004]
 gi|270338666|gb|EFA49443.1| NADH dehydrogenase I subunit A [Yersinia pestis KIM D27]
 gi|320014607|gb|ADV98178.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 166

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  + +  ++    K   YE G D    AR++   
Sbjct: 7   TEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDW 125


>gi|297538956|ref|YP_003674725.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           sp. 301]
 gi|297258303|gb|ADI30148.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Methylotenera
           sp. 301]
          Length = 109

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 83/109 (76%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
           +F+ +  A+ +  ++   +V+   PD  K S YECGF+ F+DAR++FD+R+ LV++LF++
Sbjct: 1   MFILVGLAVGVGPLVLGLLVSPHKPDSAKNSPYECGFEAFEDARMRFDVRYYLVAILFIL 60

Query: 73  FDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           FDLEIAFLFPWAV  ++I   GF +MM+FLG+L +GFIYEW KGALEWD
Sbjct: 61  FDLEIAFLFPWAVVLQEIGLFGFIAMMIFLGVLVIGFIYEWMKGALEWD 109


>gi|317130744|ref|YP_004097026.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475692|gb|ADU32295.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           cellulosilyticus DSM 2522]
          Length = 123

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
              +Y  +L+FM +  A+ +V +    ++   +P  +KL TYE G +P  DA+V++ + +
Sbjct: 6   YFDNYIYVLIFMVLGVALPVVALTFGRLLRPNNPYSKKLQTYESGIEPTGDAQVRYHVAY 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++ FVIFD+E  FL+PWAV   Q+ W+G  +M++F+ IL +G  Y WKK  LEW+
Sbjct: 66  YIVALEFVIFDIETVFLYPWAVALGQLGWVGLNAMLIFIAILGLGLAYSWKKKVLEWN 123


>gi|325921411|ref|ZP_08183268.1| NADH dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
 gi|325548169|gb|EGD19166.1| NADH dehydrogenase subunit A [Xanthomonas gardneri ATCC 19865]
          Length = 118

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I I LM+    +  +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGITLMLIGRFLGPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|148555889|ref|YP_001263471.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           wittichii RW1]
 gi|148501079|gb|ABQ69333.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Sphingomonas
           wittichii RW1]
          Length = 125

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 61/125 (48%), Positives = 85/125 (68%), Gaps = 4/125 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDAR 56
           M+ +   Y PIL+F+ +A  +        M+   +     P+PEKL+ YECGF  F+D+R
Sbjct: 1   MASVAAGYLPILLFLGVALVLSSAFVFLPMLVGRLTGTHQPNPEKLAEYECGFPAFEDSR 60

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +FD+RF L+++LF+IFDLE AFL+PWAV    I ++G+ SMM+FL  L VGFIY WKKG
Sbjct: 61  AQFDVRFYLIAILFIIFDLEAAFLYPWAVSLGGIGFVGWLSMMIFLVELAVGFIYAWKKG 120

Query: 117 ALEWD 121
           ALEW+
Sbjct: 121 ALEWE 125


>gi|58698295|ref|ZP_00373212.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630975|ref|YP_002727766.1| NADH dehydrogenase I, A subunit [Wolbachia sp. wRi]
 gi|58535168|gb|EAL59250.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592956|gb|ACN95975.1| NADH dehydrogenase I, A subunit [Wolbachia sp. wRi]
          Length = 117

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 70/117 (59%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I++F+ ++  +  VL I P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTIVIFICVSIVVSFVLGILPMFLAVSKPDSEKLSTYECGFNPLSSARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWAV   +I++ GF SMMVFL ILT+GFIYEW KGALEW+
Sbjct: 61  LVSILFIIFDLEIAFLFPWAVSLSKISYGGFWSMMVFLAILTIGFIYEWCKGALEWE 117


>gi|166712614|ref|ZP_02243821.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 118

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFVYVWKKGALEWE 118


>gi|325915539|ref|ZP_08177850.1| NADH dehydrogenase subunit A [Xanthomonas vesicatoria ATCC 35937]
 gi|325538255|gb|EGD09940.1| NADH dehydrogenase subunit A [Xanthomonas vesicatoria ATCC 35937]
          Length = 118

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A +SPD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRSPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|225024125|ref|ZP_03713317.1| hypothetical protein EIKCOROL_00993 [Eikenella corrodens ATCC
           23834]
 gi|224943150|gb|EEG24359.1| hypothetical protein EIKCOROL_00993 [Eikenella corrodens ATCC
           23834]
          Length = 122

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+ VF+ +     ++ ++   ++  K    EK   +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPVFVFILVGLIAGVLFILLGTLLGSKRHYAEKDQPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK----QITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV FK    Q     F SM VF+ +L VGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMIPWAVVFKDLLAQSGQFAFWSMFVFIVVLGVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|119897687|ref|YP_932900.1| putative NADH-ubiquinone oxidoreductase subunit A [Azoarcus sp.
           BH72]
 gi|119670100|emb|CAL94013.1| putative NADH-ubiquinone oxidoreductase chain A [Azoarcus sp. BH72]
          Length = 124

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 91/124 (73%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +   I +V ++   ++A   PD +KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFILVGLGIGVVPVVLGRVIAPHRPDSQKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      ++ W  FGS+MVFL IL +G+I EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQDFIAAGELAWFVFGSVMVFLAILVIGYIVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|229821709|ref|YP_002883235.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beutenbergia
           cavernae DSM 12333]
 gi|229567622|gb|ACQ81473.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Beutenbergia
           cavernae DSM 12333]
          Length = 120

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 50/120 (41%), Positives = 77/120 (64%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y PIL+ MAIA+ + I  + +  I+  K  +  KL  YECG  P   A    +F++
Sbjct: 1   MTNPYVPILIMMAIAAVMAIGGVATSMIIGPKRYNRAKLEAYECGVQPTPHAVGHGRFNV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           R+ LV++ F+IFD+E+ FL+PWAV F ++   G  +MM FL ++TV F+YEW++G L+WD
Sbjct: 61  RYYLVAMTFIIFDIEVVFLYPWAVAFTELAVFGLVAMMAFLFLITVPFVYEWRRGGLDWD 120


>gi|58584499|ref|YP_198072.1| NADH:ubiquinone oxidoreductase chain A [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58418815|gb|AAW70830.1| NADH:ubiquinone oxidoreductase chain A [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 117

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I +F+ ++  + + L + P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLAIAIFICVSIILSLALGVLPMFLAISKPDSEKLSTYECGFNPLSRARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWA+   +I++ GF SMMVFL ILTVGFIYEW KGALEW+
Sbjct: 61  LVSILFMIFDLEIAFLFPWAISLSKISYCGFWSMMVFLAILTVGFIYEWCKGALEWE 117


>gi|42520928|ref|NP_966843.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99034975|ref|ZP_01314778.1| hypothetical protein Wendoof_01000401 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225631317|ref|ZP_03787992.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|42410669|gb|AAS14777.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|225590992|gb|EEH12199.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 117

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I++F+ ++  +   L I P  +A   PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTIVIFICVSIVVSFALGILPMFLAVSKPDGEKLSTYECGFNPLSSARKNFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLEIAFLFPWAV   +I++ GF SMMVFL ILT+GFIYEW KGALEW+
Sbjct: 61  LVSILFIIFDLEIAFLFPWAVSLSKISYGGFWSMMVFLAILTIGFIYEWCKGALEWE 117


>gi|22550341|ref|NP_689390.1| NADH dehydrogenase subunit 3 [Chaetosphaeridium globosum]
 gi|22417007|gb|AAM96606.1|AF494279_11 NADH dehydrogenase subunit 3 [Chaetosphaeridium globosum]
          Length = 116

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 67/115 (58%), Positives = 89/115 (77%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +API +++ ++  + ++L+   F+ A  +  PEKLS YECGFDPFDDAR +FDIRF LV
Sbjct: 2   EFAPIGLYLIVSLILSLILVSVSFLFASSASYPEKLSAYECGFDPFDDARSRFDIRFYLV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           S+LF+IFDLE+ FLFPWAV   +I   GF SM++FL ILT+GFIYEWKKGAL+W+
Sbjct: 62  SILFIIFDLEVTFLFPWAVSLSKIGLFGFWSMIIFLLILTIGFIYEWKKGALDWE 116


>gi|190571251|ref|YP_001975609.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357523|emb|CAQ54960.1| NADH dehydrogenase I, A subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 117

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 88/117 (75%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  IL+F+ ++  +   L + P  +A  +PD EKLSTYECGF+P   AR  FDI+F 
Sbjct: 1   MSEYLTILIFICVSIVVSFTLGVLPMFLAVSNPDGEKLSTYECGFNPLSRARKSFDIKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPWAV   +I++ GF SMM+FL ILT+GF+YEW KGALEW+
Sbjct: 61  LVAILFIIFDLEIAFLFPWAVSLSKISYCGFWSMMIFLAILTIGFLYEWCKGALEWE 117


>gi|284039942|ref|YP_003389872.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Spirosoma
           linguale DSM 74]
 gi|283819235|gb|ADB41073.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Spirosoma
           linguale DSM 74]
          Length = 123

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/120 (36%), Positives = 71/120 (59%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L   Y P+L+ + +A   ++  MI    +  K    +K   +ECG     DAR    I
Sbjct: 4   TYLPADYIPVLIQLGLALGFIVTTMIVTHSIGPKRNSQKKDDPFECGIPVQGDARTPISI 63

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ L+++LFV+FD+E+ FL+PWAV FK +   GF  M++F+G+L  GF Y  +KG L+W+
Sbjct: 64  KYFLIAILFVLFDVEVIFLYPWAVNFKGLGMTGFIEMVLFMGLLLAGFYYVIRKGVLKWE 123


>gi|255037835|ref|YP_003088456.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dyadobacter
           fermentans DSM 18053]
 gi|254950591|gb|ACT95291.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dyadobacter
           fermentans DSM 18053]
          Length = 124

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 68/116 (58%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           + Y PI+V   +A+  +   MI   ++       +K   +ECG +   DAR    +++ L
Sbjct: 8   SDYLPIIVQFLLAAGFIGGTMIVTHLIGPSRRSKKKDDPFECGIESVGDARTPISVKYFL 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LFV+FD+E+ F++PWAV FK +   GF  M++F+ +L  GF Y  +KG L W+
Sbjct: 68  VAILFVLFDVEVIFMYPWAVNFKGLGMFGFIEMLLFMALLLSGFYYVIRKGVLNWE 123


>gi|296130551|ref|YP_003637801.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           flavigena DSM 20109]
 gi|296022366|gb|ADG75602.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           flavigena DSM 20109]
          Length = 120

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 50/120 (41%), Positives = 76/120 (63%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+LV + IA+ + +  + +  I+  K  +  KL  YECG +P   A    +F I
Sbjct: 1   MSNPYVPLLVMIGIAAVLALGGVGASAILGPKRYNRAKLEAYECGIEPTPHAIGGGRFPI 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ LV++ F++FD+E+ FL+PWAV F ++   G  +MMVFL I+TV F YEWK+G LEWD
Sbjct: 61  KYYLVAMTFIVFDIEVVFLYPWAVGFAELATFGLVAMMVFLLIITVPFAYEWKRGGLEWD 120


>gi|289665173|ref|ZP_06486754.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667380|ref|ZP_06488455.1| NADH dehydrogenase subunit A [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+G+L +GFIY WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVGMLFLGFIYVWKKGALEWE 118


>gi|84624724|ref|YP_452096.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577696|ref|YP_001914625.1| NADH dehydrogenase subunit A [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84368664|dbj|BAE69822.1| NADH-ubiquinone oxidoreductase NQO7 subunit [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188522148|gb|ACD60093.1| NADH-quinone oxidoreductase chain a [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y P L+F+ +A+ I IVLM+    +A ++PD  KLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLAEYLPSLLFLIVATGIGIVLMLIGRFLAPRTPDARKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++ F++FDLEI F+ PW   F +I      +M +F+ +L +GF+Y WKKGALEW+
Sbjct: 61  YLIAIQFIVFDLEIIFIVPWTQVFMEIGARSLVTMGLFVCMLFLGFVYVWKKGALEWE 118


>gi|296283829|ref|ZP_06861827.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Citromicrobium bathyomarinum JL354]
          Length = 124

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ +A AI  V     M    +    +P  EKLS YECGF  F++ R +FD
Sbjct: 4   LGQYLPILLFLGVALAISCVFVFLPMGVSRLTGTHNPTAEKLSEYECGFPAFEEPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV      W G+ +MM+F+G L +G IY WK GALEW
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDFTGWSGWTTMMIFIGELAIGLIYAWKVGALEW 123

Query: 121 D 121
           +
Sbjct: 124 E 124


>gi|124286763|ref|YP_001023657.1| NADH dehydrogenase subunit 3 [Savalia savaglia]
 gi|110083982|gb|ABG49159.1| NADH dehydrogenase subunit 3 [Savalia savaglia]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + T +  ILV +  +  +  ++  + +++  K PD EK+S YECGFD F      F +RF
Sbjct: 1   MYTEFYGILVLLIFSVILSAIISGASYVLGVKQPDREKVSAYECGFDAFGAPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW++ + QI+  GF +M VFL ILT+G IYEW +G LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWSIIYNQISPFGFWTMAVFLVILTLGLIYEWIEGGLEWE 118


>gi|332971178|gb|EGK10142.1| NADH-quinone oxidoreductase subunit A [Psychrobacter sp.
           1501(2011)]
          Length = 211

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 70/120 (58%), Gaps = 2/120 (1%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS         + F+  A  +VI +++ P ++  +S   EK   +E G     +AR++  
Sbjct: 1   MSSAFN--WSAIAFILAAIGLVIFMLVVPRLLGGRSQGTEKEEVFESGVVGAGNARIRMS 58

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +F LV++ FVIFDLE  +L+ +AV  +++ W+GF +  VF+GIL VG +YE K GA+ W
Sbjct: 59  AKFYLVAIFFVIFDLEALYLYAYAVSVREVGWIGFATAAVFIGILFVGLVYELKLGAMNW 118


>gi|159901491|ref|YP_001547738.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|223635467|sp|A9B477|NUOA_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|159894530|gb|ABX07610.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 118

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT+YA I +F   A    ++ ++    +    P P KLSTYECG +   D  V+F +++
Sbjct: 1   MLTNYAFIGIFALAAITFPLLPLVLSAFLRPNRPTPVKLSTYECGLEAIGDIWVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E  FL+PWAV + Q+       M+VFL ILT+G +Y WKKGALEW
Sbjct: 61  YLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEW 117


>gi|227494503|ref|ZP_03924819.1| NADH dehydrogenase (quinone) [Actinomyces coleocanis DSM 15436]
 gi|226832237|gb|EEH64620.1| NADH dehydrogenase (quinone) [Actinomyces coleocanis DSM 15436]
          Length = 120

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+L+    A  + +  + +  I+     +  K S YECG DP        +F +
Sbjct: 1   MNNPYFPLLIMAGTALLVALGGLAASAILGPTKKNTVKYSNYECGVDPIHADAEMGRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ LV++ F++FD+E+ FL+PWAV F Q+   G  +M+ F+ ++TV FIYEW++G LEWD
Sbjct: 61  KYYLVAMAFIVFDIEVVFLYPWAVAFDQLGLFGLTAMLTFITLVTVPFIYEWRRGGLEWD 120


>gi|197285620|ref|YP_002151492.1| NADH-quinone oxidoreductase chain A [Proteus mirabilis HI4320]
 gi|227356123|ref|ZP_03840513.1| NADH-quinone oxidoreductase chain A [Proteus mirabilis ATCC 29906]
 gi|223635473|sp|B4EZD0|NUOA_PROMH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|194683107|emb|CAR43668.1| NADH-quinone oxidoreductase chain A [Proteus mirabilis HI4320]
 gi|227163768|gb|EEI48680.1| NADH-quinone oxidoreductase chain A [Proteus mirabilis ATCC 29906]
          Length = 150

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 64/119 (53%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  Y    VF+  A  +  ++++    +  ++    K   YE G D    AR++   
Sbjct: 7   TEVIAHYWAFAVFLIGALGLCSLMLLGARYLGGRAQARAKHVPYESGLDSVGSARLRMSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ WAV  +++ WLGF    VF+ IL  G  Y  + GAL W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWAVSVREVGWLGFIEAAVFIAILLAGLFYLVRIGALNW 125


>gi|91203914|emb|CAJ71567.1| similar to to proton-translocating NADH dehydrogenase I chain A
           (NuoA) [Candidatus Kuenenia stuttgartiensis]
          Length = 117

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 75/117 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y PIL+   +A    +  +    I+  K P  EKL+ YECG +P   A  +F ++F 
Sbjct: 1   MIQYLPILILFFVALGFALTNVGISEILGRKKPSEEKLTPYECGVEPVGSAHERFSVKFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LFV+FD+E+ F++PWAV FK +   GF  M++F+GIL + ++Y WK+G LEW+
Sbjct: 61  LIAMLFVVFDIEVIFMYPWAVAFKSLKLFGFIEMVIFIGILLICYLYIWKRGGLEWE 117


>gi|238753754|ref|ZP_04615115.1| NADH dehydrogenase I chain A [Yersinia ruckeri ATCC 29473]
 gi|238707990|gb|EEQ00347.1| NADH dehydrogenase I chain A [Yersinia ruckeri ATCC 29473]
          Length = 150

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 64/119 (53%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +   +++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGFMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWTGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|219848535|ref|YP_002462968.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aggregans DSM 9485]
 gi|219542794|gb|ACL24532.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aggregans DSM 9485]
          Length = 118

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I +F+  A +  ++ ++  F +  K P P K STYECG +   D  ++F +++
Sbjct: 1   MLADYALIGIFLIAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHIQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F  I   G  +  +FL +L  G +YEW+KGALEW
Sbjct: 61  YLYALAFVIFDIEVVFLYPWAVAFNSIGLYGLIAATIFLLMLFAGLLYEWRKGALEW 117


>gi|321401336|gb|ADW83091.1| NADH dehydrogenase subunit 3 [Pavlova lutheri]
          Length = 119

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 90/118 (76%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y  +L F+  + A+ +VL +  F +A  S DPEKLS YECGF+PF+DAR +FDIRF
Sbjct: 2   YLQEYFSLLFFVGFSFALSVVLFLLSFFLAVSSNDPEKLSAYECGFNPFEDARSQFDIRF 61

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEI+FLFPWA+  K I   GF SMM+FL ILTVGF+YEW+KGALEW+
Sbjct: 62  YLVAILFIIFDLEISFLFPWALTLKSIESFGFWSMMLFLFILTVGFVYEWQKGALEWE 119


>gi|217970156|ref|YP_002355390.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thauera sp.
           MZ1T]
 gi|217507483|gb|ACK54494.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thauera sp.
           MZ1T]
          Length = 124

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+FM +     +  +I   ++A   PD EK S YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFMLVGLGFGLAPVILGRLLAPYRPDSEKNSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      +I W  FGS+MVFL IL +G+I EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQEFIAAGEIAWFVFGSVMVFLAILVIGYIVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|269836325|ref|YP_003318553.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphaerobacter
           thermophilus DSM 20745]
 gi|269785588|gb|ACZ37731.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sphaerobacter
           thermophilus DSM 20745]
          Length = 118

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 70/117 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I + +  A  +  VL++   ++    P P KL  YE G    D  + ++  RF
Sbjct: 1   MLQGYAVIGLMLITAILMGSVLLLLGRLIRPYRPTPAKLQPYESGIPDVDPPKTRYTPRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +V++LFVIFD+E  FL+PWAV F  +   G+ + +VFL IL  G +YEWKKGALEW
Sbjct: 61  YIVAMLFVIFDIEAIFLYPWAVSFVPLGAYGYVTAVVFLTILLAGLLYEWKKGALEW 117


>gi|328953791|ref|YP_004371125.1| NAD(P)H-quinone oxidoreductase subunit 3 [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454115|gb|AEB09944.1| NAD(P)H-quinone oxidoreductase subunit 3 [Desulfobacca acetoxidans
           DSM 11109]
          Length = 118

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 71/118 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PILV++ IA  + + ++     +  K+    K   YECG  P  DAR ++ ++F
Sbjct: 1   MLIDYLPILVYLVIALGVAVGMVALSEALGKKTHTAVKDLPYECGMIPSGDARSRYSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++ F++FD+E  FL+PWAV ++ +   G   M +F+ +L VG  Y W KGAL+W+
Sbjct: 61  FVIAMFFLVFDIEAIFLYPWAVIYRALGLFGLIEMGIFILVLAVGLAYVWGKGALQWE 118


>gi|149184639|ref|ZP_01862957.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Erythrobacter sp. SD-21]
 gi|148831959|gb|EDL50392.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Erythrobacter sp. SD-21]
          Length = 124

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 75/121 (61%), Gaps = 4/121 (3%)

Query: 5   LTSYAPILVFMAIASAIVIVL----MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           L  Y PIL+F+ IA A+        M    +     P  EK S YECGF  F+D R +FD
Sbjct: 4   LEQYLPILIFLFIAVALSAAFVFLPMGVSRLTGAHQPTAEKYSEYECGFPAFEDPRSQFD 63

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLE AFLFPWAV      W G+ +MMVFL  L VGF Y WK GALEW
Sbjct: 64  VRFYLVAILFIIFDLEAAFLFPWAVSLDLTGWPGWITMMVFLAELIVGFAYAWKVGALEW 123

Query: 121 D 121
           D
Sbjct: 124 D 124


>gi|186920125|ref|YP_001874779.1| NADH dehydrogenase subunit 3 [Hemiselmis andersenii]
 gi|186461071|gb|ACC78233.1| NADH dehydrogenase subunit 3 [Hemiselmis andersenii]
          Length = 121

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 66/121 (54%), Positives = 86/121 (71%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+   + Y  +LVFM ++     +     + VA +  D EKLS YECGFDPF+DAR  FD
Sbjct: 1   MALFFSQYFSLLVFMVLSIVFSCIFFFLSYAVATQKADTEKLSAYECGFDPFNDARNTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPWA+    ++   F SM++FL ILTVGFIYEWKKGALEW
Sbjct: 61  VRFYLVAILFIIFDLEISFLFPWAIALGDLSIFSFWSMIIFLFILTVGFIYEWKKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|269218337|ref|ZP_06162191.1| NADH dehydrogenase I, A subunit [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269212196|gb|EEZ78536.1| NADH dehydrogenase I, A subunit [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 119

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD--DARVKFDIR 62
           + SY P+LV +A A+A+ I  ++    +  K  +  KL  YECG +       R +F I+
Sbjct: 1   MNSYVPLLVMIAAAAALSIGGLVMSSFLGPKRHNRVKLENYECGVEATPAASGRGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++ F++FD+E+ FL+PWAV F ++   G  +M+ F+ ++ V F+YEW++G LEWD
Sbjct: 61  YYLTAMTFIVFDIEVVFLYPWAVSFHKLGLFGVVAMLSFVFLIAVPFVYEWRRGGLEWD 119


>gi|89280722|ref|YP_514649.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|289065031|ref|YP_003433842.1| NADH dehydrogenase subunit 3 [Oryza rufipogon]
 gi|769728|dbj|BAA06832.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|769734|dbj|BAA04794.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|870716|gb|AAA70313.1| Nad3 protein [Oryza sativa]
 gi|74100089|gb|AAZ99253.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|74100144|gb|AAZ99307.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|74100198|gb|AAZ99360.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|285026113|dbj|BAI67946.1| NADH dehydrogenase subunit 3 [Oryza rufipogon]
 gi|285026175|dbj|BAI68007.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
          Length = 155

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 79/117 (67%), Gaps = 1/117 (0%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           S  L+ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDP  DAR +FD
Sbjct: 35  SAFLSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFD 94

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           IRF  V +LF+I DLE+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA
Sbjct: 95  IRFYPVPILFIIPDLEVTFFFPWAVPPNKIDLFGSWSMMAFLLILTIGFLYEWKRGA 151


>gi|9653246|ref|NP_062492.1| NADH dehydrogenase subunit 3 [Chondrus crispus]
 gi|1352557|sp|P48910|NU3M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1334494|emb|CAA87616.1| NADH dehydrogenase (ubiquinone), subunit 3 [Chondrus crispus]
          Length = 121

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 93/121 (76%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y+ IL+F AI+S +  V+ +  + +  + PD EK+S YECGF+PFDDAR  FD
Sbjct: 1   MKLIFTEYSAILIFFAISSLLSSVIFLLSYFLIPQKPDQEKVSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLEI+FLFPW++   +I+ +GF SM+VFL ILT+GFIYEW KGALEW
Sbjct: 61  IRFYLVAILFLIFDLEISFLFPWSLVLGEISIIGFWSMIVFLVILTIGFIYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|157371545|ref|YP_001479534.1| NADH dehydrogenase subunit A [Serratia proteamaculans 568]
 gi|223635494|sp|A8GH16|NUOA_SERP5 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|157323309|gb|ABV42406.1| NADH dehydrogenase (quinone) [Serratia proteamaculans 568]
          Length = 146

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF  +A  +  ++++  F +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFFVVAIGLCCLMLMGAFFLGGRARARAKHTPFESGIDSVGTARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSIRESGWVGFIEAAIFILVLLAGLVYLVRIGALDW 123


>gi|326777318|ref|ZP_08236583.1| NAD(P)H-quinone oxidoreductase subunit 3 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657651|gb|EGE42497.1| NAD(P)H-quinone oxidoreductase subunit 3 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 180

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+   SY+ I +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 59  SEFFQSYSVIGLLALVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 118

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L VG +Y WKKG L 
Sbjct: 119 RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFVFLGFLAVGLLYAWKKGVLA 178

Query: 120 W 120
           W
Sbjct: 179 W 179


>gi|183981498|ref|YP_001849789.1| NADH dehydrogenase I (chain a) NuoA (NADH- ubiquinone
           oxidoreductase chain a) [Mycobacterium marinum M]
 gi|183174824|gb|ACC39934.1| NADH dehydrogenase I (chain a) NuoA (NADH- ubiquinone
           oxidoreductase chain a) [Mycobacterium marinum M]
          Length = 162

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 68/127 (53%), Gaps = 10/127 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------- 55
           L +Y PILV   +A+   +V ++   +V     +  KL+ YECG +P +           
Sbjct: 36  LNAYIPILVLATLAAGFAVVSVVIASLVGPTRFNRSKLAAYECGIEPTEAQAGASGRETA 95

Query: 56  -RVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWK 114
              +F +++ L ++LF++FD+EI FL+PWAV F  +       M +F+  + V + Y W+
Sbjct: 96  SGQRFPVKYYLTAMLFIVFDIEIVFLYPWAVSFDALGTFALVEMAIFMLTVFVAYAYVWR 155

Query: 115 KGALEWD 121
           +G L WD
Sbjct: 156 RGGLTWD 162


>gi|68171629|ref|ZP_00544996.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658152|ref|YP_507584.1| NADH dehydrogenase I, A subunit [Ehrlichia chaffeensis str.
           Arkansas]
 gi|67998950|gb|EAM85634.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599609|gb|ABD45078.1| NADH dehydrogenase I, A subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y P+L+F+A++  I  +  I P ++A +SPD EKLS YECGF P  ++R  FDIRF 
Sbjct: 7   IAEYVPVLIFLAVSGFISFLFCILPMLLANRSPDLEKLSPYECGFAPLGNSRKIFDIRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMMVFL ILTVGFIYEW KGALEW+
Sbjct: 67  LVAILFIIFDLEIAFLFPWSICLSDIGINGFWSMMVFLAILTVGFIYEWSKGALEWE 123


>gi|311278755|ref|YP_003940986.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Enterobacter
           cloacae SCF1]
 gi|308747950|gb|ADO47702.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Enterobacter
           cloacae SCF1]
          Length = 148

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +   +++  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCFMLVGGWFLGGRARARSKNTPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|238751248|ref|ZP_04612742.1| NADH dehydrogenase I chain A [Yersinia rohdei ATCC 43380]
 gi|238710522|gb|EEQ02746.1| NADH dehydrogenase I chain A [Yersinia rohdei ATCC 43380]
          Length = 150

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKHVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWVGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|163848440|ref|YP_001636484.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aurantiacus J-10-fl]
 gi|222526368|ref|YP_002570839.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus sp. Y-400-fl]
 gi|163669729|gb|ABY36095.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aurantiacus J-10-fl]
 gi|222450247|gb|ACM54513.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           sp. Y-400-fl]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+   IA  I   ++    ++  +   P KL+ YE G DP   A  +  ++F
Sbjct: 1   MLESYVPVLILFLIAVFIAAFVITLSALLGPRRSTPRKLAPYESGMDPVGPAIRRIPVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E+ F +P+A+ F+Q+   G  +M VF  +L VGF+YEWKKGAL W+
Sbjct: 61  YVVAMLFIVFDIEVVFFYPFALVFRQLGPAGLAAMGVFFLVLLVGFVYEWKKGALRWE 118


>gi|163847547|ref|YP_001635591.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aurantiacus J-10-fl]
 gi|222525397|ref|YP_002569868.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus sp. Y-400-fl]
 gi|223635434|sp|A9WEE0|NUOA_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|163668836|gb|ABY35202.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449276|gb|ACM53542.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           sp. Y-400-fl]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +YA I +F+  A +  ++ ++  F +  K P P K STYECG +   D  V+F +++
Sbjct: 1   MLANYALIGIFLVAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L ++ FVIFD+E+ FL+PWAV F  +   G  +  +FL +L  G +YEW+KGALEW
Sbjct: 61  YLYALAFVIFDIEVIFLYPWAVAFNAVGLYGLIAATIFLLMLFAGLLYEWRKGALEW 117


>gi|284106846|ref|ZP_06386289.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830025|gb|EFC34301.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 123

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 76/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y PI VF  IA    +V +++ +IV    P   KL  YE G   F DARV+F +R+ ++
Sbjct: 9   NYIPIAVFAVIALGFGVVSLVAGWIVRPSRPYRAKLLPYESGSPLFMDARVQFPMRYYII 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+EI F+FPWAV F ++  LG   M VF+ IL VGF Y WKKGALEWD
Sbjct: 69  AMLFVVFDIEIVFMFPWAVVFHKLGLLGLIEMGVFIAILVVGFWYVWKKGALEWD 123


>gi|189426187|ref|YP_001953364.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter
           lovleyi SZ]
 gi|223635463|sp|B3E9W9|NUOA_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|189422446|gb|ACD96844.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacter
           lovleyi SZ]
          Length = 118

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI++ + +A A  +  ++   ++  K     K++ YECG +P   AR +F I+F
Sbjct: 1   MLGTYLPIMLLILVALAFGLGSVVFSSLIGQKKFSKVKMAPYECGCEPIGTARERFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E  FL+PWAV +K++   G   M +F+ IL VG+IY WKKGALEW+
Sbjct: 61  YLIAMLFILFDIEAVFLYPWAVLYKKLGLFGLVEMGLFVVILFVGYIYVWKKGALEWE 118


>gi|121534362|ref|ZP_01666186.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Thermosinus
           carboxydivorans Nor1]
 gi|121307132|gb|EAX48050.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Thermosinus
           carboxydivorans Nor1]
          Length = 118

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 69/117 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y  I + M +A     + +    ++  K P  EKLSTYECG D      ++F   +
Sbjct: 1   MLTDYGRIGLLMVVALIFPFIPLFVSSLLQTKKPTTEKLSTYECGLDTIGRTWIQFKSSY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L +++FV+FD+E  FL+PWAV ++Q+    F  M +F+ IL +G  Y WKKGALEW
Sbjct: 61  FLYALVFVVFDIETVFLYPWAVKYQQLGTYAFVEMFIFIAILVIGLWYAWKKGALEW 117


>gi|94968315|ref|YP_590363.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550365|gb|ABF40289.1| NADH dehydrogenase subunit A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 118

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +Y PI +F+ +A  I    ++   +     P   KL  YECG DPFD +R ++ IRF
Sbjct: 1   MPQNYVPIFIFLLVAFGIGAGTLMLFKLARPAKPSKVKLMPYECGIDPFDSSRQRYTIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +V++LFV+FD+E  FLFPWAV FK +   G   M++FLGIL  G+ + WKKGALEW
Sbjct: 61  YIVAILFVVFDVETIFLFPWAVQFKALGVFGLVEMLLFLGILIAGYAWVWKKGALEW 117


>gi|226944918|ref|YP_002799991.1| NADH dehydrogenase subunit A [Azotobacter vinelandii DJ]
 gi|226719845|gb|ACO79016.1| NADH-ubiquinone oxidoreductase, chain alpha [Azotobacter vinelandii
           DJ]
          Length = 137

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+      VF+   + +   ++    ++  K+    K   +E G  P   AR++   +F 
Sbjct: 8   LSHNWGFAVFLLGVAGLCAFMLGVSRLLGSKAVGRSKNEPFESGIVPTGGARLRLSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LFVIFD+E  FLF WAV  ++  W G    M+F+ IL  G +Y W+ GAL+W
Sbjct: 68  LVAMLFVIFDVEALFLFAWAVSVRESGWAGLIEAMIFIAILLAGLVYLWRIGALDW 123


>gi|58617037|ref|YP_196236.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Gardel]
 gi|58416649|emb|CAI27762.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Gardel]
          Length = 141

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 25  ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 84

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 85  LVAILFIIFDLEIAFLFPWSICLSDIGVGGFWSMMIFLVILIIGFIYEWSKGALEWE 141


>gi|123441676|ref|YP_001005660.1| NADH dehydrogenase subunit A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|223635515|sp|A1JLG0|NUOA_YERE8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|122088637|emb|CAL11432.1| NADH dehydrogenase I chain A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 150

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|328884312|emb|CCA57551.1| NADH ubiquinone oxidoreductase chain A [Streptomyces venezuelae
           ATCC 10712]
          Length = 153

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 69/118 (58%), Gaps = 2/118 (1%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIRF 63
            +YAP+LV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I++
Sbjct: 36  NAYAPVLVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIKY 95

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 96  YLTAMLFIVFDIEIVFLYPWAVTFDALGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 153


>gi|109156412|ref|YP_654403.1| NADH dehydrogenase subunit 3 [Porites porites]
 gi|108744158|gb|ABG02377.1| NADH dehydrogenase subunit 3 [Porites porites]
          Length = 118

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  + V +  +  +  +   + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MILDYFGLFVLLVFSVVLSALFSGASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG+LT+G +YEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLGVLTLGLLYEWIKGGLEWE 118


>gi|85059579|ref|YP_455281.1| NADH dehydrogenase subunit A [Sodalis glossinidius str.
           'morsitans']
 gi|123519199|sp|Q2NSJ9|NUOA_SODGM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|84780099|dbj|BAE74876.1| NADH dehydrogenase I subunit A [Sodalis glossinidius str.
           'morsitans']
          Length = 145

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++   Y    VF+  A  + + ++   F++  ++    K   +E G DP   AR++   
Sbjct: 5   TEITAHYWAFAVFLLSALGLCVFMLTGGFLLGARARARSKNVPFESGIDPVGTARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WA   ++  W+GF    +F+ IL  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVETLYLYAWATAIREAGWVGFIEATIFILILLAGLVYLVRIGALDW 123


>gi|238785000|ref|ZP_04628998.1| NADH dehydrogenase I chain A [Yersinia bercovieri ATCC 43970]
 gi|238714116|gb|EEQ06130.1| NADH dehydrogenase I chain A [Yersinia bercovieri ATCC 43970]
          Length = 149

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSISIRESGWVGFIEATIFILVLLAGLVYLVRIGALDW 123


>gi|284038504|ref|YP_003388434.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Spirosoma
           linguale DSM 74]
 gi|283817797|gb|ADB39635.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Spirosoma
           linguale DSM 74]
          Length = 157

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 10/127 (7%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ +  IL+F+  A A + +++    ++    P+ EK STYE G +P  +A V+F+IRF
Sbjct: 1   MLSHFGIILLFILAAFAFIAIVLFVARLLRPNRPNIEKNSTYESGEEPIGNANVQFNIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQ----------ITWLGFGSMMVFLGILTVGFIYEW 113
            +V+++FV+FD+E+AFLFPWA  F Q            W      ++F+ +L +G  Y W
Sbjct: 61  YVVALVFVLFDVELAFLFPWATVFGQERLIKATGGLWGWFALTEAILFVVVLGLGLAYVW 120

Query: 114 KKGALEW 120
            KG L+W
Sbjct: 121 AKGHLDW 127


>gi|251799772|ref|YP_003014503.1| NADH dehydrogenase subunit A [Paenibacillus sp. JDR-2]
 gi|247547398|gb|ACT04417.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Paenibacillus
           sp. JDR-2]
          Length = 123

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 70/121 (57%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M + +  Y  + +F+ +   +    +    ++    P+  K +TYE G +P  + +V+F+
Sbjct: 1   MDNYVNQYVVVAIFIFLGILLPAAALTVGRLLRPHKPNDPKQATYESGNEPVGEGQVRFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IR+ + +++FVIFD+E  FL+PWAV +K++       M +F  +L +G +Y WKK  L+W
Sbjct: 61  IRYYIFALMFVIFDVETVFLYPWAVAYKKLGLFVLVEMFIFAAMLFIGLLYAWKKKVLKW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|58578979|ref|YP_197191.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417605|emb|CAI26809.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 141

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 25  ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 84

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 85  LVAILFIIFDLEIAFLFPWSICLSDIGIGGFWSMMIFLVILIIGFIYEWSKGALEWE 141


>gi|304322208|ref|YP_003855851.1| NADH dehydrogenase subunit alpha [Parvularcula bermudensis
           HTCC2503]
 gi|303301110|gb|ADM10709.1| NADH dehydrogenase alpha subunit [Parvularcula bermudensis
           HTCC2503]
          Length = 131

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 86/125 (68%), Gaps = 8/125 (6%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y PI++F  +AS + I+ ++ P ++A   PDPEKLSTYECGF+ F+DAR+KFD++F
Sbjct: 6   FLQDYLPIIIFAGLASVLGILFLVLPVVLAPNEPDPEKLSTYECGFEAFEDARLKFDVQF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITW--------LGFGSMMVFLGILTVGFIYEWKK 115
            +V++LF+I DL++AFLFPWAV                 F SM VFL +  +GF+YEWKK
Sbjct: 66  YIVAILFIIVDLDVAFLFPWAVTLFNPELGMDRGFQIYAFWSMAVFLAVFFIGFLYEWKK 125

Query: 116 GALEW 120
           GALEW
Sbjct: 126 GALEW 130


>gi|304407749|ref|ZP_07389400.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Paenibacillus
           curdlanolyticus YK9]
 gi|304343232|gb|EFM09075.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Paenibacillus
           curdlanolyticus YK9]
          Length = 123

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 69/121 (57%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ +L  Y  +++F+ +   +  V +    ++    P   K  TYE G +P  + +V+F+
Sbjct: 1   MNHVLNQYVVVVIFLLLGILLPAVALTVGRLLRPHKPTEPKEMTYESGNEPVGEGQVRFN 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IR+   +++FVIFD+E  FL+PWAV + ++       M++F G+L +G  Y WKK  L W
Sbjct: 61  IRYYHFALMFVIFDVETVFLYPWAVAYGKLGLFALVEMLIFAGMLVLGLAYAWKKKVLTW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|206575889|ref|YP_002237324.1| NADH-quinone oxidoreductase, A subunit [Klebsiella pneumoniae 342]
 gi|206564947|gb|ACI06723.1| NADH-quinone oxidoreductase, A subunit [Klebsiella pneumoniae 342]
          Length = 146

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ IA  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIIAIGLCCLMLVGGWYLGGRARARSKNTPFESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 123


>gi|289641427|ref|ZP_06473591.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia
           symbiont of Datisca glomerata]
 gi|289508763|gb|EFD29698.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia
           symbiont of Datisca glomerata]
          Length = 120

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +L++Y PILV + IASA  I  +I+  +V  K  +  KL  YECG +P  +     +F +
Sbjct: 1   MLSNYVPILVLLVIASAFAIGSVITGALVGPKRYNRAKLDAYECGIEPPREPVGPHRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +F L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  KFYLTAMLFIVFDIEIIFLYPWAVAFGALGTFGLVEMVLFIATVFVAYAYVWRRGGLEWD 120


>gi|291010620|ref|YP_003495131.1| NADH dehydrogenase subunit 3 [Pycnococcus provasolii]
 gi|258406743|gb|ACV72089.1| NADH dehydrogenase subunit 3 [Pycnococcus provasolii]
          Length = 116

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 63/115 (54%), Positives = 84/115 (73%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           SY PI  FM +++ I   ++   F VA   PD EK+S YECGFDPFDDAR +FD+RF LV
Sbjct: 2   SYPPIAGFMVLSAFIASFILGLSFFVAKLKPDGEKVSAYECGFDPFDDARARFDVRFYLV 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LF+IFDLE+ F FPWA+        GF S++ FLG+LT+GF+YEW+KGAL+W+
Sbjct: 62  AILFIIFDLEVTFCFPWALTLFYSGLFGFYSIVFFLGLLTLGFVYEWQKGALDWE 116


>gi|193215724|ref|YP_001996923.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
 gi|223635395|sp|B3QUX5|NUOA1_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|193089201|gb|ACF14476.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Chloroherpeton thalassium ATCC 35110]
          Length = 121

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 77/119 (64%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PI V ++IA  + +VL+    I+  K  +PEKL+ YE G DP    R +  +RF
Sbjct: 1   MLESYFPIFVVISIAIILAVVLLSIGKIIGPKRNNPEKLTPYESGMDPVGSTRTRVTVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV+++F++FD+E+ F++PWAV F+++  + G   M+ F+ IL  G+ Y  KK AL+WD
Sbjct: 61  YLVAMIFIVFDIEVIFMYPWAVSFRELSGFYGLIPMVTFVLILLAGYYYILKKKALDWD 119


>gi|296112928|ref|YP_003626866.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis RH4]
 gi|295920622|gb|ADG60973.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis RH4]
 gi|326559968|gb|EGE10366.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis
           46P47B1]
 gi|326561152|gb|EGE11517.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis 7169]
 gi|326565207|gb|EGE15393.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis
           103P14B1]
 gi|326567658|gb|EGE17766.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis
           12P80B1]
 gi|326567956|gb|EGE18053.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis BC1]
 gi|326569463|gb|EGE19523.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis BC8]
 gi|326572777|gb|EGE22763.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis BC7]
 gi|326574000|gb|EGE23949.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis CO72]
 gi|326577031|gb|EGE26926.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis
           101P30B1]
          Length = 202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 66/112 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              +V++  +  +V+ +++ P ++  +S   +K   +E G      AR++   +F LV++
Sbjct: 5   WSAIVYLLASLGLVVFMLVVPRLLGGRSSGSQKQENFEAGVVSAGTARIRLSAKFYLVAI 64

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            FVIFDLE  +L+ +AV  +++ W GF S  VF+ IL VG +YE + GA+ W
Sbjct: 65  FFVIFDLEALYLYAYAVSVREVGWAGFASAFVFIAILFVGLVYEMRLGAMNW 116


>gi|238895805|ref|YP_002920541.1| NADH dehydrogenase subunit A [Klebsiella pneumoniae NTUH-K2044]
 gi|262043328|ref|ZP_06016457.1| NADH dehydrogenase I subunit A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288934254|ref|YP_003438313.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Klebsiella
           variicola At-22]
 gi|290508457|ref|ZP_06547828.1| NADH dehydrogenase I subunit A [Klebsiella sp. 1_1_55]
 gi|330003556|ref|ZP_08304671.1| NADH dehydrogenase I subunit A [Klebsiella sp. MS 92-3]
 gi|223635540|sp|A6TBX4|NUOA_KLEP7 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|238548123|dbj|BAH64474.1| NADH dehydrogenase alpha subunit [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259039352|gb|EEW40494.1| NADH dehydrogenase I subunit A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288888983|gb|ADC57301.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Klebsiella
           variicola At-22]
 gi|289777851|gb|EFD85848.1| NADH dehydrogenase I subunit A [Klebsiella sp. 1_1_55]
 gi|328536896|gb|EGF63195.1| NADH dehydrogenase I subunit A [Klebsiella sp. MS 92-3]
          Length = 148

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ IA  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIIAIGLCCLMLVGGWYLGGRARARSKNTPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|284794667|ref|YP_003412025.1| NADH dehydrogenase subunit 3 [Lubomirskia baicalensis]
 gi|284098136|gb|ADB78067.1| NADH dehydrogenase subunit 3 [Lubomirskia baicalensis]
          Length = 118

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + +IV  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFLSIFILLLFSIILSTVISGASYIVGVKQPDSEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI   GF +M  FL ILTVG IYEW KG LEW+
Sbjct: 61  FLVGILFMIFDLEISFLFPWCVVYNQIGLFGFWTMYFFLVILTVGLIYEWIKGGLEWE 118


>gi|326577447|gb|EGE27331.1| NADH-quinone oxidoreductase subunit A [Moraxella catarrhalis O35E]
          Length = 202

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 66/112 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              +V++  +  +V+ +++ P ++  +S   +K   +E G      AR++   +F LV++
Sbjct: 5   WSAIVYLLASLGLVVFMLVVPRLLGGRSSGSQKQENFEAGVVSAGTARIRLSAKFYLVAI 64

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            FVIFDLE  +L+ +AV  +++ W GF S  VF+ IL VG +YE + GA+ W
Sbjct: 65  FFVIFDLEALYLYAYAVSVREVGWAGFASAFVFIAILFVGLVYEMRLGAMNW 116


>gi|10732664|gb|AAG22493.1|AF239263_1 NADH-ubiquinone oxidoreductase subunit 3 [Coix lacryma-jobi]
          Length = 118

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVFLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|153004157|ref|YP_001378482.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter sp. Fw109-5]
 gi|223635441|sp|A7H9V2|NUOA_ANADF RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|152027730|gb|ABS25498.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter sp. Fw109-5]
          Length = 128

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/126 (34%), Positives = 71/126 (56%), Gaps = 6/126 (4%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L +Y PI V + +A  +  V++    ++  + P   K + +ECG  P   AR +F 
Sbjct: 1   MLTPLQTYFPIAVALLVAVGLAAVMLALANVLGPRRPSEVKSTPFECGSLPVSPARERFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF------KQITWLGFGSMMVFLGILTVGFIYEWK 114
           ++F +V++LF++FD+E  FL+PWAV          + W G+ SM +F+  L  G +Y WK
Sbjct: 61  VKFYVVALLFIVFDIEAIFLYPWAVLLLPSDGYPGLGWAGYISMGIFVATLVAGLVYVWK 120

Query: 115 KGALEW 120
           KG L+W
Sbjct: 121 KGVLDW 126


>gi|323176787|gb|EFZ62377.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 1180]
          Length = 145

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  RFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 123


>gi|325104078|ref|YP_004273732.1| NADH dehydrogenase subunit A [Pedobacter saltans DSM 12145]
 gi|324972926|gb|ADY51910.1| NADH dehydrogenase subunit A [Pedobacter saltans DSM 12145]
          Length = 196

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 76/125 (60%), Gaps = 9/125 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T +  +L+F+ I +  V     +  I++ K P+PEK S+YECG + + ++ ++F+ RF 
Sbjct: 7   ITEFGKVLIFLIIGTIFVCATFFANKILSLKKPNPEKNSSYECGEEVYSNSWIQFNSRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQI---------TWLGFGSMMVFLGILTVGFIYEWKK 115
           +++++F++FD+E+ F+FPWA  F             WL F  M++F+ IL +G +Y W+K
Sbjct: 67  VIALVFLLFDVEMIFIFPWATIFSNNELIALDGRWGWLTFIEMLIFISILLLGLVYVWRK 126

Query: 116 GALEW 120
             L W
Sbjct: 127 KDLLW 131


>gi|224020969|ref|YP_002608202.1| NADH dehydrogenase subunit 3 [Carica papaya]
          Length = 119

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 1/115 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +++ ++PI +++ I+  + ++L+  PF + +  S  P+KLS YECGFDP  DAR +FDIR
Sbjct: 1   MMSEFSPIFIYLVISPLVSLILLGLPFPLSSNSSTYPDKLSAYECGFDPSGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           F LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  FYLVSILFIIPDPEVTFFFPWAVPPNKIDPFGFWSMMAFLFILTIGFLYEWKRGA 115


>gi|56478176|ref|YP_159765.1| NADH dehydrogenase I chain A [Aromatoleum aromaticum EbN1]
 gi|56314219|emb|CAI08864.1| NADH dehydrogenase I chain A (EC 1.6.5.3) [Aromatoleum aromaticum
           EbN1]
          Length = 124

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y P+L+F+ +     +V +I   ++A   PD EKLS YECGF+ F+DAR+KFD+R+
Sbjct: 1   MLENYFPVLMFILVGLGFGLVPVILGRVLAPYRPDGEKLSPYECGFEAFEDARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFK------QITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            L+++LF++FDLEIAFLFPWA  F+      +I W  FGS+MVFL +L +G++ EWK GA
Sbjct: 61  YLIAILFILFDLEIAFLFPWATVFQEFIAAGEIAWFVFGSVMVFLAVLVIGYVVEWKNGA 120

Query: 118 LEWD 121
           L+W+
Sbjct: 121 LDWE 124


>gi|293395170|ref|ZP_06639456.1| NADH dehydrogenase I subunit A [Serratia odorifera DSM 4582]
 gi|291422347|gb|EFE95590.1| NADH dehydrogenase I subunit A [Serratia odorifera DSM 4582]
          Length = 146

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 68/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +  ++++  F +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLVMAIGLCGLMLLGAFFLGGRARARAKNTPFESGIDSVGTARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVAIRETGWIGFIEAAIFILVLLAGLVYLVRIGALDW 123


>gi|283786356|ref|YP_003366221.1| NADH-quinone oxidoreductase subunit A [Citrobacter rodentium
           ICC168]
 gi|282949810|emb|CBG89433.1| NADH-quinone oxidoreductase subunit A [Citrobacter rodentium
           ICC168]
          Length = 145

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNTPFESGIDSVGTARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 123


>gi|116619253|ref|YP_821409.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Candidatus
           Solibacter usitatus Ellin6076]
 gi|122256133|sp|Q02CU2|NUOA_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|116222415|gb|ABJ81124.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 135

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           Y PIL+   IA  +   L+   +++  K  +  K   YE G  P  DAR +F ++F LV 
Sbjct: 9   YFPILLQAVIAMGLAAGLLTVSYLLGKKVRNRVKDMPYESGIVPTGDARHRFSVKFYLVG 68

Query: 68  VLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FL+PW V ++ +    +  GF  M+ F+ ++  GF Y WKKGAL+W
Sbjct: 69  MLFILFDIEAIFLYPWVVVYRDLSRNGSLFGFYEMLTFVILILSGFFYIWKKGALDW 125


>gi|92115247|ref|YP_575175.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Chromohalobacter salexigens DSM 3043]
 gi|122419104|sp|Q1QST2|NUOA_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|91798337|gb|ABE60476.1| NADH dehydrogenase subunit A [Chromohalobacter salexigens DSM 3043]
          Length = 139

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 68/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+  Y    +F+    A+  +++ +  ++  +S  P K   +E G      AR +F +
Sbjct: 6   TALIAQYWATGLFIIAVFALCALMIGAASLLGGRSRGPSKSLPFESGVVGTGSARQRFSV 65

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF WAV  +++ W GF    VF+ IL  G +Y+ + GALEW
Sbjct: 66  KFYLVAMLFVIFDIEAVFLFAWAVSVREVGWEGFAGAAVFIFILLAGLVYDSRVGALEW 124


>gi|11497474|ref|NP_042264.1| NADH dehydrogenase (ubiquinone), subunit 3 [Prototheca wickerhamii]
 gi|6647623|sp|Q37625|NU3M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|467865|gb|AAD12652.1| NADH dehydrogenase (ubiquinone), subunit 3 [Prototheca wickerhamii]
          Length = 117

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 93/116 (80%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  IL++  IA A+ ++L+  PF+V+ +  DPEK+S YECGFDPFDDAR +FDI+F 
Sbjct: 1   MYEFLGILIYFFIALALSLLLLGLPFLVSTRKADPEKISAYECGFDPFDDARGRFDIQFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+IFDLE+AFLFPWA+   +I + GF SMM+FL ILTVGFIYEW+KGAL+W
Sbjct: 61  LVAILFIIFDLEVAFLFPWALTLNKIGYFGFWSMMLFLFILTVGFIYEWRKGALDW 116


>gi|38704072|ref|NP_311199.2| NADH dehydrogenase subunit A [Escherichia coli O157:H7 str. Sakai]
 gi|194433296|ref|ZP_03065576.1| NADH-quinone oxidoreductase, A subunit [Shigella dysenteriae 1012]
 gi|297517329|ref|ZP_06935715.1| NADH dehydrogenase subunit A [Escherichia coli OP50]
 gi|301026959|ref|ZP_07190352.1| NADH dehydrogenase I subunit A [Escherichia coli MS 196-1]
 gi|309785008|ref|ZP_07679641.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella dysenteriae 1617]
 gi|312967586|ref|ZP_07781801.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 2362-75]
 gi|312973453|ref|ZP_07787625.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 1827-70]
 gi|331658370|ref|ZP_08359332.1| NADH dehydrogenase I subunit A [Escherichia coli TA206]
 gi|331668986|ref|ZP_08369834.1| NADH dehydrogenase I subunit A [Escherichia coli TA271]
 gi|331683959|ref|ZP_08384555.1| NADH dehydrogenase I subunit A [Escherichia coli H299]
 gi|194418390|gb|EDX34479.1| NADH-quinone oxidoreductase, A subunit [Shigella dysenteriae 1012]
 gi|299879506|gb|EFI87717.1| NADH dehydrogenase I subunit A [Escherichia coli MS 196-1]
 gi|308927378|gb|EFP72852.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella dysenteriae 1617]
 gi|310332048|gb|EFP99283.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 1827-70]
 gi|312287783|gb|EFR15688.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 2362-75]
 gi|313651111|gb|EFS15510.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri 2a str. 2457T]
 gi|315615557|gb|EFU96189.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 3431]
 gi|323156438|gb|EFZ42593.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli EPECa14]
 gi|323161622|gb|EFZ47507.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli E128010]
 gi|323168542|gb|EFZ54222.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella sonnei 53G]
 gi|323171970|gb|EFZ57614.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli LT-68]
 gi|323184393|gb|EFZ69769.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli 1357]
 gi|323187987|gb|EFZ73282.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli RN587/1]
 gi|323973007|gb|EGB68201.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           TA007]
 gi|325496677|gb|EGC94536.1| NADH dehydrogenase subunit A [Escherichia fergusonii ECD227]
 gi|327252558|gb|EGE64217.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Escherichia coli STEC_7v]
 gi|331056618|gb|EGI28627.1| NADH dehydrogenase I subunit A [Escherichia coli TA206]
 gi|331064180|gb|EGI36091.1| NADH dehydrogenase I subunit A [Escherichia coli TA271]
 gi|331078911|gb|EGI50113.1| NADH dehydrogenase I subunit A [Escherichia coli H299]
 gi|332088418|gb|EGI93536.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella boydii 5216-82]
 gi|332090610|gb|EGI95706.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella dysenteriae 155-74]
 gi|332093417|gb|EGI98475.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella boydii 3594-74]
 gi|332344069|gb|AEE57403.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Escherichia
           coli UMNK88]
 gi|332754936|gb|EGJ85301.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri 4343-70]
 gi|332755337|gb|EGJ85701.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri K-671]
 gi|332756357|gb|EGJ86708.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri 2747-71]
 gi|332766107|gb|EGJ96317.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Shigella
           flexneri 2930-71]
 gi|333001683|gb|EGK21249.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri K-218]
 gi|333002655|gb|EGK22215.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri K-272]
 gi|333016347|gb|EGK35678.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri K-304]
 gi|333016539|gb|EGK35869.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri K-227]
          Length = 145

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 123


>gi|62161303|ref|YP_214869.1| NADH dehydrogenase subunit 3 [Axinella corrugata]
 gi|55275034|gb|AAV49312.1| NADH dehydrogenase subunit 3 [Axinella corrugata]
          Length = 118

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + ++V  K PD EK+S YECGFDPF  +RV F ++F
Sbjct: 1   MSVEFLGIFLIILFSITLSTVISGASYVVGVKQPDSEKVSVYECGFDPFGSSRVPFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI   G  +M +FL ILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFMIFDLEISFLFPWCVAYNQIGSFGIWTMYLFLIILTIGLIYEWVKGGLEWE 118


>gi|6647615|sp|O99869|NU3M_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|4106840|gb|AAD03038.1| NADH dehydrogenase subunit 3 [Solanum tuberosum]
          Length = 118

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEK S YECG DP  DAR + DIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKSSAYECGLDPSGDARSRVDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|134283934|ref|ZP_01770630.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 305]
 gi|226195426|ref|ZP_03791015.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|134244723|gb|EBA44821.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei 305]
 gi|225932628|gb|EEH28626.1| NADH dehydrogenase I, A subunit [Burkholderia pseudomallei Pakistan
           9]
          Length = 105

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 53/105 (50%), Positives = 74/105 (70%)

Query: 17  IASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLE 76
           + + + I L+    I+    PD EK + YECGF+ F+DAR+KFD+R+ LV++LF+IFDLE
Sbjct: 1   MGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLE 60

Query: 77  IAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            AFLFPW V  ++I W GF +MM+FL    +GF Y WKKG L+W+
Sbjct: 61  TAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE 105


>gi|333001432|gb|EGK21000.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 family
           protein [Shigella flexneri VA-6]
          Length = 145

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 123


>gi|260887647|ref|ZP_05898910.1| NADH dehydrogenase I, A subunit [Selenomonas sputigena ATCC 35185]
 gi|330838006|ref|YP_004412586.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Selenomonas
           sputigena ATCC 35185]
 gi|260862663|gb|EEX77163.1| NADH dehydrogenase I, A subunit [Selenomonas sputigena ATCC 35185]
 gi|329745770|gb|AEB99126.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Selenomonas
           sputigena ATCC 35185]
          Length = 117

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 66/116 (56%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  + +F+ +A A   +++    I+  + P PEK   YECG D    + V++ + + 
Sbjct: 1   MGEFGGLGLFLIVAIAFPFMVLAPARILQPRQPTPEKQKPYECGVDTVGSSDVQYHVGYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             ++ F++FD+E  FL+PWAV F ++    F  M VFLGIL +G  Y W+KG L W
Sbjct: 61  RYALAFLLFDVETVFLYPWAVSFNRLGLFAFLEMFVFLGILALGLWYAWRKGDLAW 116


>gi|126695327|ref|YP_001090214.1| NADH dehydrogenase subunit 3 [Oscarella carmela]
 gi|116876183|gb|ABK30947.1| NADH dehydrogenase subunit 3 [Oscarella carmela]
          Length = 118

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  + + + ++  I + +  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFYGVFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFD EI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 61  FLIGILFLIFDXEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|307304394|ref|ZP_07584145.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
 gi|307318101|ref|ZP_07597537.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|306896142|gb|EFN26892.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti AK83]
 gi|306902596|gb|EFN33190.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Sinorhizobium
           meliloti BL225C]
          Length = 152

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 71/121 (58%), Gaps = 3/121 (2%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA-RVKF 59
           M+ +   + P+L  +     +    +    ++   +P PEK + YECG +   +A   +F
Sbjct: 32  MTAM--EFLPVLFMVTGIVLVAAATLFVSSLLRPSNPYPEKNAPYECGMEAAGEAAGGRF 89

Query: 60  DIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            + F ++++L V+FD+E  FLFPWAV  K+I ++G+  M VF+ +L VGF Y W KGALE
Sbjct: 90  RVPFFILAILLVVFDVEAMFLFPWAVVLKEIGFVGYIEMFVFMLLLLVGFAYAWLKGALE 149

Query: 120 W 120
           W
Sbjct: 150 W 150


>gi|317048939|ref|YP_004116587.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Pantoea sp.
           At-9b]
 gi|316950556|gb|ADU70031.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pantoea sp.
           At-9b]
          Length = 147

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +   +VF+ IA  +   ++   +++  ++    K + +E G D   D  ++   
Sbjct: 5   TEVIAHHWAFIVFIVIAFGLCAFMLTGGWLLGGRAKARYKNTPFESGIDSVGDTHIRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALFLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 123


>gi|238763926|ref|ZP_04624883.1| NADH dehydrogenase I chain A [Yersinia kristensenii ATCC 33638]
 gi|238697894|gb|EEP90654.1| NADH dehydrogenase I chain A [Yersinia kristensenii ATCC 33638]
          Length = 152

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 7   TEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W++  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEATIFILVLLAGLVYLVRIGALDW 125


>gi|261340676|ref|ZP_05968534.1| NADH dehydrogenase I subunit A [Enterobacter cancerogenus ATCC
           35316]
 gi|288317090|gb|EFC56028.1| NADH dehydrogenase I subunit A [Enterobacter cancerogenus ATCC
           35316]
          Length = 146

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNTPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|113477003|ref|YP_723064.1| NADH dehydrogenase subunit A [Trichodesmium erythraeum IMS101]
 gi|123160441|sp|Q10YT3|NU3C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|110168051|gb|ABG52591.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Trichodesmium erythraeum IMS101]
          Length = 135

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L+ Y   L F+ I+S + I+ + +  ++  K+  PE+ +TYE G +P   A ++F+IR+
Sbjct: 18  FLSGYEYFLGFLMISSLVPIIALTASKLLRPKTRGPERRTTYESGVEPIGGAWIQFNIRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 78  YMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALVYAWRKGALEW 134


>gi|304398216|ref|ZP_07380090.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pantoea sp.
           aB]
 gi|304354082|gb|EFM18455.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pantoea sp.
           aB]
          Length = 147

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +   +VF+ IA  +   ++   +++  ++    K + +E G +   D  ++   
Sbjct: 7   TEIIAQHWAFIVFIVIAFGLCAFMLTGGWLLGGRARARYKDTPFESGIESVGDTHIRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ WA   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWATSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|317134339|ref|YP_004123125.1| NADH dehydrogenase subunit 3 [Oscarella microlobata]
 gi|308912654|gb|ADO51417.1| NADH dehydrogenase subunit 3 [Oscarella microlobata]
          Length = 118

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + + ++ AI + +  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFYGIFIALCLSIAISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|331647943|ref|ZP_08349035.1| NADH dehydrogenase I subunit A [Escherichia coli M605]
 gi|281179375|dbj|BAI55705.1| NADH dehydrogenase I chain A [Escherichia coli SE15]
 gi|330912113|gb|EGH40623.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli AA86]
 gi|331043667|gb|EGI15805.1| NADH dehydrogenase I subunit A [Escherichia coli M605]
          Length = 147

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|63025149|ref|YP_232814.1| NADH dehydrogenase subunit 3 [Tethya actinia]
 gi|37961483|gb|AAP59073.1| NADH dehydrogenase subunit 3 [Tethya actinia]
          Length = 118

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  ++  + +IV  K PD EK+S YECGFDPF  +RV F ++F
Sbjct: 1   MSIEFVNIFLLILFSVTLSTIISGASYIVGNKQPDSEKVSVYECGFDPFGSSRVPFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI+  GF  + +FL ILT+G +YEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVVYNQISLFGFWVVYLFLIILTIGLVYEWAKGGLEWE 118


>gi|313679585|ref|YP_004057324.1| NADH dehydrogenase subunit a [Oceanithermus profundus DSM 14977]
 gi|313152300|gb|ADR36151.1| NADH dehydrogenase subunit A [Oceanithermus profundus DSM 14977]
          Length = 119

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T Y  IL+++ IA+ I +V++    ++  K P P KL  YE G DP  +   +  + F +
Sbjct: 5   TEYINILIYLGIAAGIGVVMLAMGAMLGPKKPSPTKLMPYESGNDPAGEVH-RLPVHFYV 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LF+IFD+E+AFL+P+AV   ++   GF ++  F  I+  GF+YEWKKG ++WD
Sbjct: 64  VAMLFIIFDVEVAFLWPYAVNAGKLGIAGFWAVTTFTLIVLAGFVYEWKKGVMKWD 119


>gi|146312474|ref|YP_001177548.1| NADH dehydrogenase subunit A [Enterobacter sp. 638]
 gi|223635459|sp|A4WCR7|NUOA_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145319350|gb|ABP61497.1| NADH dehydrogenase subunit A [Enterobacter sp. 638]
          Length = 146

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  +++I  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEVVAHHWAFAIFLIVAIGLCCLMLIGGWFLGGRARARHKNTPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|164421002|ref|YP_001648497.1| NADH dehydrogenase subunit 3 [Topsentia ophiraphidites]
 gi|158938932|gb|ABW83859.1| NADH dehydrogenase subunit 3 [Topsentia ophiraphidites]
          Length = 118

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + FI+  K PD EK+S YECGFDPF  +R+ F ++F
Sbjct: 1   MSAEFFNIFILLLFSIILSTVISGASFIIGVKQPDSEKVSVYECGFDPFGSSRIPFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V ++QI   GF +M +FL ILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVAYQQIGLFGFWTMYLFLIILTIGLIYEWVKGGLEWE 118


>gi|193068283|ref|ZP_03049247.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli E110019]
 gi|192958562|gb|EDV89001.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli E110019]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRTRARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|308187604|ref|YP_003931735.1| NADH dehydrogenase I chain A [Pantoea vagans C9-1]
 gi|308058114|gb|ADO10286.1| NADH dehydrogenase I chain A [Pantoea vagans C9-1]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +   +VF+ IA  +   ++   +++  ++    K + +E G +   D  ++   
Sbjct: 7   TEIIAQHWAFIVFIVIAFGLCAFMLTGGWLLGGRARARYKDTPFESGIESVGDTHIRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ WA   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWATSIRESGWIGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|300114493|ref|YP_003761068.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Nitrosococcus watsonii C-113]
 gi|299540430|gb|ADJ28747.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           watsonii C-113]
          Length = 132

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 72/116 (62%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
            T + P ++++AI  ++V +++   +I   +  +      +E G      AR++F ++F 
Sbjct: 3   FTEFWPFILYVAIVFSLVALILGLSYISGQRHQERATGEPFESGVVTVGFARLRFPVKFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV+VLFVIFD+E  FLF WAV F++  W+G+G  + F+ IL V  IYEW+ GAL+W
Sbjct: 63  LVAVLFVIFDMEAVFLFAWAVAFRKTGWIGYGGALAFIIILVVALIYEWRVGALDW 118


>gi|258593446|emb|CBE69785.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 74/118 (62%), Gaps = 1/118 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMIS-PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +   YA + +F+ +    V+V +     ++   +P+PEK +TYECG DP   + ++  +R
Sbjct: 1   MAADYAIVGIFLIVGLLFVVVNVDVVSRLLRPTNPEPEKYTTYECGEDPVGASWIRVHVR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + L ++++VIF +E  +L PWAV F+++    F  MM+F+ IL VGF Y W+KGALEW
Sbjct: 61  YYLYALVYVIFAVETIYLLPWAVVFRKLGMFAFVEMMLFIAILLVGFAYAWRKGALEW 118


>gi|332669449|ref|YP_004452457.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           fimi ATCC 484]
 gi|332338487|gb|AEE45070.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cellulomonas
           fimi ATCC 484]
          Length = 120

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   YAP+LV M IA+ + +  + +  I+  K  +  KL  YECG +P   A    +F I
Sbjct: 1   MDNPYAPLLVLMGIAAVLALGGVGASAILGPKRYNRAKLEAYECGIEPTPHAIGGGRFPI 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ LV++ F++FD+E+ FL+PWAV F  +   G  +M+ FL ++TV F+YEW++G  EWD
Sbjct: 61  KYYLVAMTFIVFDIEVVFLYPWAVAFADLAVFGLVAMLAFLVLITVPFVYEWRRGGFEWD 120


>gi|260869011|ref|YP_003235413.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O111:H- str. 11128]
 gi|257765367|dbj|BAI36862.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O111:H- str. 11128]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           RF LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  RFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|157144781|ref|YP_001452100.1| NADH dehydrogenase subunit A [Citrobacter koseri ATCC BAA-895]
 gi|223635447|sp|A8ADV1|NUOA_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|157081986|gb|ABV11664.1| hypothetical protein CKO_00508 [Citrobacter koseri ATCC BAA-895]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ IA  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEIIAHHWAFAIFLIIAIGLCCLMLVGGWFLGGRARARSKNTPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|320177170|gb|EFW52182.1| NADH ubiquinone oxidoreductase chain A [Shigella dysenteriae CDC
           74-1112]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|109156513|ref|YP_654325.1| NADH dehydrogenase subunit 3 [Agaricia humilis]
 gi|108744076|gb|ABG02301.1| NADH dehydrogenase subunit 3 [Agaricia humilis]
          Length = 118

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  +   +  +  +  +   + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MYLEFYSLFFLLVFSVVLSALFFGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V F QI+  GF  M+VFLG+LT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVLFNQISPFGFWVMVVFLGVLTLGLIYEWVKGGLEWE 118


>gi|312131894|ref|YP_003999234.1| NADH dehydrogenase subunit a [Leadbetterella byssophila DSM 17132]
 gi|311908440|gb|ADQ18881.1| NADH dehydrogenase subunit A [Leadbetterella byssophila DSM 17132]
          Length = 124

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 73/116 (62%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y P+L+ + +A   V++ +I+   +  K    +K   +ECG +   DAR+  ++R+ L
Sbjct: 7   QDYLPLLIQLVLALGFVVMTLIATHYLGPKLRSKKKDLPFECGVESVGDARMPLNVRYFL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++LFV+FD+E+ F++PWAV FK + WLGF  M++F+  L  GF Y  KKG L+W+
Sbjct: 67  TAILFVLFDVEVIFMYPWAVNFKGLGWLGFYEMLLFVAFLMAGFYYVIKKGVLDWE 122


>gi|291147675|gb|ACB20491.2| NADH dehydrogenase subunit 3 [Carica papaya]
          Length = 118

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ I+  + ++L+  PF + +  S  P+KLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVISPLVSLILLGLPFPLSSNSSTYPDKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFFFPWAVPPNKIDPFGFWSMMAFLFILTIGFLYEWKRGA 114


>gi|260598705|ref|YP_003211276.1| NADH:ubiquinone oxidoreductase subunit A [Cronobacter turicensis
           z3032]
 gi|260217882|emb|CBA32434.1| NADH-quinone oxidoreductase subunit A [Cronobacter turicensis
           z3032]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  +++   + +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFGIFLIVAIGLCCLMLAGAWFLGGRARARYKNTPFESGIDSVGTARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   +++ W+GF    +F+ +L  G +Y  + GALEW
Sbjct: 65  KFYLVAMFFVIFDVEALYLFAWSTSVREVGWVGFIEAAIFILVLLAGLVYLVRIGALEW 123


>gi|24113660|ref|NP_708170.1| NADH dehydrogenase subunit A [Shigella flexneri 2a str. 301]
 gi|26248675|ref|NP_754715.1| NADH dehydrogenase subunit A [Escherichia coli CFT073]
 gi|30063714|ref|NP_837885.1| NADH dehydrogenase subunit A [Shigella flexneri 2a str. 2457T]
 gi|49176207|ref|NP_416791.3| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K-12 substr. MG1655]
 gi|74312806|ref|YP_311225.1| NADH dehydrogenase subunit A [Shigella sonnei Ss046]
 gi|82544766|ref|YP_408713.1| NADH dehydrogenase subunit A [Shigella boydii Sb227]
 gi|82777696|ref|YP_404045.1| NADH dehydrogenase subunit A [Shigella dysenteriae Sd197]
 gi|89109106|ref|AP_002886.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K-12 substr. W3110]
 gi|91211580|ref|YP_541566.1| NADH dehydrogenase subunit A [Escherichia coli UTI89]
 gi|110642492|ref|YP_670222.1| NADH dehydrogenase subunit A [Escherichia coli 536]
 gi|110806251|ref|YP_689771.1| NADH dehydrogenase subunit A [Shigella flexneri 5 str. 8401]
 gi|117624477|ref|YP_853390.1| NADH dehydrogenase subunit A [Escherichia coli APEC O1]
 gi|157157146|ref|YP_001463631.1| NADH dehydrogenase subunit A [Escherichia coli E24377A]
 gi|157161776|ref|YP_001459094.1| NADH dehydrogenase subunit A [Escherichia coli HS]
 gi|168748137|ref|ZP_02773159.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|168755040|ref|ZP_02780047.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|168761273|ref|ZP_02786280.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|168767914|ref|ZP_02792921.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|168772986|ref|ZP_02797993.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|168780143|ref|ZP_02805150.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|168787195|ref|ZP_02812202.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC869]
 gi|168798458|ref|ZP_02823465.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC508]
 gi|170019403|ref|YP_001724357.1| NADH dehydrogenase subunit A [Escherichia coli ATCC 8739]
 gi|170081905|ref|YP_001731225.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170681754|ref|YP_001744486.1| NADH dehydrogenase subunit A [Escherichia coli SMS-3-5]
 gi|170767488|ref|ZP_02901941.1| NADH-quinone oxidoreductase, A subunit [Escherichia albertii
           TW07627]
 gi|187731136|ref|YP_001881109.1| NADH dehydrogenase subunit A [Shigella boydii CDC 3083-94]
 gi|188492191|ref|ZP_02999461.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli 53638]
 gi|191166518|ref|ZP_03028348.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli B7A]
 gi|191170282|ref|ZP_03031836.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli F11]
 gi|193062316|ref|ZP_03043411.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli E22]
 gi|194427118|ref|ZP_03059669.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli B171]
 gi|194436264|ref|ZP_03068366.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli 101-1]
 gi|195935665|ref|ZP_03081047.1| NADH dehydrogenase subunit A [Escherichia coli O157:H7 str. EC4024]
 gi|208806992|ref|ZP_03249329.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208813499|ref|ZP_03254828.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208818793|ref|ZP_03259113.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209400280|ref|YP_002271697.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|209919736|ref|YP_002293820.1| NADH dehydrogenase subunit A [Escherichia coli SE11]
 gi|215487501|ref|YP_002329932.1| NADH dehydrogenase subunit A [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217327503|ref|ZP_03443586.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. TW14588]
 gi|218548263|ref|YP_002382054.1| NADH dehydrogenase subunit A [Escherichia fergusonii ATCC 35469]
 gi|218554844|ref|YP_002387757.1| NADH dehydrogenase subunit A [Escherichia coli IAI1]
 gi|218559201|ref|YP_002392114.1| NADH dehydrogenase subunit A [Escherichia coli S88]
 gi|218690448|ref|YP_002398660.1| NADH dehydrogenase subunit A [Escherichia coli ED1a]
 gi|218695887|ref|YP_002403554.1| NADH dehydrogenase subunit A [Escherichia coli 55989]
 gi|218700762|ref|YP_002408391.1| NADH dehydrogenase subunit A [Escherichia coli IAI39]
 gi|218705818|ref|YP_002413337.1| NADH dehydrogenase subunit A [Escherichia coli UMN026]
 gi|227887344|ref|ZP_04005149.1| NADH dehydrogenase subunit A [Escherichia coli 83972]
 gi|237704762|ref|ZP_04535243.1| NADH-quinone oxidoreductase [Escherichia sp. 3_2_53FAA]
 gi|238901463|ref|YP_002927259.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli BW2952]
 gi|253772790|ref|YP_003035621.1| NADH dehydrogenase subunit A [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254162297|ref|YP_003045405.1| NADH dehydrogenase subunit A [Escherichia coli B str. REL606]
 gi|254794180|ref|YP_003079017.1| NADH dehydrogenase subunit A [Escherichia coli O157:H7 str.
           TW14359]
 gi|256017556|ref|ZP_05431421.1| NADH dehydrogenase subunit A [Shigella sp. D9]
 gi|256022028|ref|ZP_05435893.1| NADH dehydrogenase subunit A [Escherichia sp. 4_1_40B]
 gi|260844875|ref|YP_003222653.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O103:H2 str. 12009]
 gi|260856332|ref|YP_003230223.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O26:H11 str. 11368]
 gi|261223258|ref|ZP_05937539.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261259192|ref|ZP_05951725.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291283529|ref|YP_003500347.1| NADH-quinone oxidoreductase subunit A [Escherichia coli O55:H7 str.
           CB9615]
 gi|293410648|ref|ZP_06654224.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293415581|ref|ZP_06658224.1| NADH dehydrogenase I subunit A [Escherichia coli B185]
 gi|293446625|ref|ZP_06663047.1| NADH dehydrogenase I subunit A [Escherichia coli B088]
 gi|298381437|ref|ZP_06991036.1| NADH dehydrogenase I subunit A [Escherichia coli FVEC1302]
 gi|300818111|ref|ZP_07098323.1| NADH dehydrogenase I subunit A [Escherichia coli MS 107-1]
 gi|300822160|ref|ZP_07102302.1| NADH dehydrogenase I subunit A [Escherichia coli MS 119-7]
 gi|300896962|ref|ZP_07115443.1| NADH dehydrogenase I subunit A [Escherichia coli MS 198-1]
 gi|300903673|ref|ZP_07121589.1| NADH dehydrogenase I subunit A [Escherichia coli MS 84-1]
 gi|300918547|ref|ZP_07135137.1| NADH dehydrogenase I subunit A [Escherichia coli MS 115-1]
 gi|300924548|ref|ZP_07140512.1| NADH dehydrogenase I subunit A [Escherichia coli MS 182-1]
 gi|300931358|ref|ZP_07146689.1| NADH dehydrogenase I subunit A [Escherichia coli MS 187-1]
 gi|300936854|ref|ZP_07151743.1| NADH dehydrogenase I subunit A [Escherichia coli MS 21-1]
 gi|300948567|ref|ZP_07162660.1| NADH dehydrogenase I subunit A [Escherichia coli MS 116-1]
 gi|300956451|ref|ZP_07168740.1| NADH dehydrogenase I subunit A [Escherichia coli MS 175-1]
 gi|300981069|ref|ZP_07175341.1| NADH dehydrogenase I subunit A [Escherichia coli MS 200-1]
 gi|300983383|ref|ZP_07176567.1| NADH dehydrogenase I subunit A [Escherichia coli MS 45-1]
 gi|301024087|ref|ZP_07187801.1| NADH dehydrogenase I subunit A [Escherichia coli MS 69-1]
 gi|301049042|ref|ZP_07196027.1| NADH dehydrogenase I subunit A [Escherichia coli MS 185-1]
 gi|301303253|ref|ZP_07209378.1| NADH dehydrogenase I subunit A [Escherichia coli MS 124-1]
 gi|301328781|ref|ZP_07221829.1| NADH dehydrogenase I subunit A [Escherichia coli MS 78-1]
 gi|301647614|ref|ZP_07247410.1| NADH dehydrogenase I subunit A [Escherichia coli MS 146-1]
 gi|306814601|ref|ZP_07448763.1| NADH dehydrogenase subunit A [Escherichia coli NC101]
 gi|307138952|ref|ZP_07498308.1| NADH dehydrogenase subunit A [Escherichia coli H736]
 gi|307311152|ref|ZP_07590796.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli W]
 gi|309793168|ref|ZP_07687596.1| NADH dehydrogenase I subunit A [Escherichia coli MS 145-7]
 gi|331642926|ref|ZP_08344061.1| NADH dehydrogenase I subunit A [Escherichia coli H736]
 gi|331653730|ref|ZP_08354731.1| NADH dehydrogenase I subunit A [Escherichia coli M718]
 gi|331663803|ref|ZP_08364713.1| NADH dehydrogenase I subunit A [Escherichia coli TA143]
 gi|331673791|ref|ZP_08374554.1| NADH dehydrogenase I subunit A [Escherichia coli TA280]
 gi|331678234|ref|ZP_08378909.1| NADH dehydrogenase I subunit A [Escherichia coli H591]
 gi|332278566|ref|ZP_08390979.1| NADH:ubiquinone oxidoreductase [Shigella sp. D9]
 gi|84028740|sp|P0AFC5|NUOA_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|84028741|sp|P0AFC4|NUOA_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|84028742|sp|P0AFC3|NUOA_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|84028743|sp|P0AFC6|NUOA_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|122423112|sp|Q1R9C9|NUOA_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123048059|sp|Q0T2J9|NUOA_SHIF8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123147872|sp|Q0TFF8|NUOA_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123559141|sp|Q31YH3|NUOA_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123562058|sp|Q32DQ1|NUOA_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123616690|sp|Q3YZS2|NUOA_SHISS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635453|sp|A7ZPA2|NUOA_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635454|sp|B1X900|NUOA_ECODH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635455|sp|A8A2F7|NUOA_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635456|sp|A1ADD6|NUOA_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635457|sp|B1IXQ4|NUOA_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635458|sp|B1LLP1|NUOA_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635495|sp|B2TW69|NUOA_SHIB3 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|26109080|gb|AAN81283.1|AE016763_242 NADH dehydrogenase I chain A [Escherichia coli CFT073]
 gi|1788625|gb|AAC75348.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K-12 substr. MG1655]
 gi|1799656|dbj|BAA16123.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K12 substr. W3110]
 gi|13362642|dbj|BAB36595.1| NADH dehydrogenase I chain A [Escherichia coli O157:H7 str. Sakai]
 gi|24052725|gb|AAN43877.1| NADH dehydrogenase I chain A [Shigella flexneri 2a str. 301]
 gi|30041969|gb|AAP17695.1| NADH dehydrogenase I chain A [Shigella flexneri 2a str. 2457T]
 gi|73856283|gb|AAZ88990.1| NADH dehydrogenase I chain A [Shigella sonnei Ss046]
 gi|81241844|gb|ABB62554.1| NADH dehydrogenase I chain A [Shigella dysenteriae Sd197]
 gi|81246177|gb|ABB66885.1| NADH dehydrogenase I chain A [Shigella boydii Sb227]
 gi|91073154|gb|ABE08035.1| NADH dehydrogenase I chain A [Escherichia coli UTI89]
 gi|110344084|gb|ABG70321.1| NADH dehydrogenase I chain A [Escherichia coli 536]
 gi|110615799|gb|ABF04466.1| NADH dehydrogenase I chain A [Shigella flexneri 5 str. 8401]
 gi|115513601|gb|ABJ01676.1| NADH dehydrogenase subunit A [Escherichia coli APEC O1]
 gi|157067456|gb|ABV06711.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli HS]
 gi|157079176|gb|ABV18884.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli E24377A]
 gi|169754331|gb|ACA77030.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli ATCC 8739]
 gi|169889740|gb|ACB03447.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170123822|gb|EDS92753.1| NADH-quinone oxidoreductase, A subunit [Escherichia albertii
           TW07627]
 gi|170519472|gb|ACB17650.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli SMS-3-5]
 gi|187428128|gb|ACD07402.1| NADH-quinone oxidoreductase, A subunit [Shigella boydii CDC
           3083-94]
 gi|187771102|gb|EDU34946.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|188017362|gb|EDU55484.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|188487390|gb|EDU62493.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli 53638]
 gi|189002075|gb|EDU71061.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|189357603|gb|EDU76022.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|189362964|gb|EDU81383.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|189368310|gb|EDU86726.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|189372796|gb|EDU91212.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC869]
 gi|189378928|gb|EDU97344.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC508]
 gi|190903478|gb|EDV63197.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli B7A]
 gi|190909798|gb|EDV69383.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli F11]
 gi|192931982|gb|EDV84581.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli E22]
 gi|194414739|gb|EDX31010.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli B171]
 gi|194424992|gb|EDX40977.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli 101-1]
 gi|208726793|gb|EDZ76394.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208734776|gb|EDZ83463.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208738916|gb|EDZ86598.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209161680|gb|ACI39113.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|209765068|gb|ACI80846.1| NADH dehydrogenase I chain A [Escherichia coli]
 gi|209765070|gb|ACI80847.1| NADH dehydrogenase I chain A [Escherichia coli]
 gi|209765072|gb|ACI80848.1| NADH dehydrogenase I chain A [Escherichia coli]
 gi|209765074|gb|ACI80849.1| NADH dehydrogenase I chain A [Escherichia coli]
 gi|209765076|gb|ACI80850.1| NADH dehydrogenase I chain A [Escherichia coli]
 gi|209912995|dbj|BAG78069.1| NADH dehydrogenase I chain A [Escherichia coli SE11]
 gi|215265573|emb|CAS09976.1| NADH: ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217319870|gb|EEC28295.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli O157:H7
           str. TW14588]
 gi|218352619|emb|CAU98400.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli 55989]
 gi|218355804|emb|CAQ88417.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           fergusonii ATCC 35469]
 gi|218361612|emb|CAQ99204.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli IAI1]
 gi|218365970|emb|CAR03714.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli S88]
 gi|218370748|emb|CAR18561.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli IAI39]
 gi|218428012|emb|CAR08783.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli ED1a]
 gi|218432915|emb|CAR13809.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli UMN026]
 gi|222034044|emb|CAP76785.1| NadH-quinone oxidoreductase subunit A [Escherichia coli LF82]
 gi|226901128|gb|EEH87387.1| NADH-quinone oxidoreductase [Escherichia sp. 3_2_53FAA]
 gi|227835694|gb|EEJ46160.1| NADH dehydrogenase subunit A [Escherichia coli 83972]
 gi|238861873|gb|ACR63871.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli BW2952]
 gi|242377921|emb|CAQ32690.1| NADH:ubiquinone oxidoreductase, membrane subunit A, subunit of
           NADH:ubiquinone oxidoreductase I [Escherichia coli
           BL21(DE3)]
 gi|253323834|gb|ACT28436.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974198|gb|ACT39869.1| NADH dehydrogenase subunit A [Escherichia coli B str. REL606]
 gi|253978365|gb|ACT44035.1| NADH dehydrogenase subunit A [Escherichia coli BL21(DE3)]
 gi|254593580|gb|ACT72941.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O157:H7 str. TW14359]
 gi|257754981|dbj|BAI26483.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O26:H11 str. 11368]
 gi|257760022|dbj|BAI31519.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli O103:H2 str. 12009]
 gi|260448619|gb|ACX39041.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli DH1]
 gi|281601729|gb|ADA74713.1| NADH-quinone oxidoreductase subunit A [Shigella flexneri 2002017]
 gi|284922276|emb|CBG35361.1| NADH-quinone oxidoreductase subunit A [Escherichia coli 042]
 gi|290763402|gb|ADD57363.1| NADH-quinone oxidoreductase subunit A [Escherichia coli O55:H7 str.
           CB9615]
 gi|291323455|gb|EFE62883.1| NADH dehydrogenase I subunit A [Escherichia coli B088]
 gi|291433229|gb|EFF06208.1| NADH dehydrogenase I subunit A [Escherichia coli B185]
 gi|291471116|gb|EFF13600.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294489621|gb|ADE88377.1| NADH-quinone oxidoreductase, A subunit [Escherichia coli IHE3034]
 gi|298278879|gb|EFI20393.1| NADH dehydrogenase I subunit A [Escherichia coli FVEC1302]
 gi|300299151|gb|EFJ55536.1| NADH dehydrogenase I subunit A [Escherichia coli MS 185-1]
 gi|300307682|gb|EFJ62202.1| NADH dehydrogenase I subunit A [Escherichia coli MS 200-1]
 gi|300316721|gb|EFJ66505.1| NADH dehydrogenase I subunit A [Escherichia coli MS 175-1]
 gi|300359230|gb|EFJ75100.1| NADH dehydrogenase I subunit A [Escherichia coli MS 198-1]
 gi|300396743|gb|EFJ80281.1| NADH dehydrogenase I subunit A [Escherichia coli MS 69-1]
 gi|300404329|gb|EFJ87867.1| NADH dehydrogenase I subunit A [Escherichia coli MS 84-1]
 gi|300408549|gb|EFJ92087.1| NADH dehydrogenase I subunit A [Escherichia coli MS 45-1]
 gi|300414282|gb|EFJ97592.1| NADH dehydrogenase I subunit A [Escherichia coli MS 115-1]
 gi|300419266|gb|EFK02577.1| NADH dehydrogenase I subunit A [Escherichia coli MS 182-1]
 gi|300451915|gb|EFK15535.1| NADH dehydrogenase I subunit A [Escherichia coli MS 116-1]
 gi|300458041|gb|EFK21534.1| NADH dehydrogenase I subunit A [Escherichia coli MS 21-1]
 gi|300460820|gb|EFK24313.1| NADH dehydrogenase I subunit A [Escherichia coli MS 187-1]
 gi|300525290|gb|EFK46359.1| NADH dehydrogenase I subunit A [Escherichia coli MS 119-7]
 gi|300529255|gb|EFK50317.1| NADH dehydrogenase I subunit A [Escherichia coli MS 107-1]
 gi|300841427|gb|EFK69187.1| NADH dehydrogenase I subunit A [Escherichia coli MS 124-1]
 gi|300844843|gb|EFK72603.1| NADH dehydrogenase I subunit A [Escherichia coli MS 78-1]
 gi|301074241|gb|EFK89047.1| NADH dehydrogenase I subunit A [Escherichia coli MS 146-1]
 gi|305851995|gb|EFM52447.1| NADH dehydrogenase subunit A [Escherichia coli NC101]
 gi|306908658|gb|EFN39155.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli W]
 gi|307554350|gb|ADN47125.1| NADH dehydrogenase I chain A [Escherichia coli ABU 83972]
 gi|307626176|gb|ADN70480.1| NADH dehydrogenase subunit A [Escherichia coli UM146]
 gi|308123454|gb|EFO60716.1| NADH dehydrogenase I subunit A [Escherichia coli MS 145-7]
 gi|309702600|emb|CBJ01928.1| NADH-quinone oxidoreductase subunit A [Escherichia coli ETEC
           H10407]
 gi|312946906|gb|ADR27733.1| NADH dehydrogenase subunit A [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315061580|gb|ADT75907.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Escherichia
           coli W]
 gi|315136922|dbj|BAJ44081.1| NADH-quinone oxidoreductase subunit A [Escherichia coli DH1]
 gi|315255222|gb|EFU35190.1| NADH dehydrogenase I subunit A [Escherichia coli MS 85-1]
 gi|315285912|gb|EFU45350.1| NADH dehydrogenase I subunit A [Escherichia coli MS 110-3]
 gi|315292239|gb|EFU51591.1| NADH dehydrogenase I subunit A [Escherichia coli MS 153-1]
 gi|315298113|gb|EFU57382.1| NADH dehydrogenase I subunit A [Escherichia coli MS 16-3]
 gi|320178739|gb|EFW53702.1| NADH ubiquinone oxidoreductase chain A [Shigella boydii ATCC 9905]
 gi|320192091|gb|EFW66736.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli O157:H7
           str. EC1212]
 gi|320196155|gb|EFW70779.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli WV_060327]
 gi|320199876|gb|EFW74465.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli EC4100B]
 gi|320641115|gb|EFX10594.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O157:H7
           str. G5101]
 gi|320646503|gb|EFX15422.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O157:H-
           str. 493-89]
 gi|320651600|gb|EFX19980.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O157:H-
           str. H 2687]
 gi|320657352|gb|EFX25154.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320663054|gb|EFX30371.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667872|gb|EFX34780.1| NADH:ubiquinone oxidoreductase subunit A [Escherichia coli O157:H7
           str. LSU-61]
 gi|323377840|gb|ADX50108.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Escherichia
           coli KO11]
 gi|323936578|gb|EGB32865.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           E1520]
 gi|323941015|gb|EGB37202.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           E482]
 gi|323944801|gb|EGB40867.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           H120]
 gi|323952081|gb|EGB47955.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           H252]
 gi|323956054|gb|EGB51807.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           H263]
 gi|323961471|gb|EGB57081.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           H489]
 gi|323967729|gb|EGB63141.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           M863]
 gi|323977511|gb|EGB72597.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           TW10509]
 gi|324006662|gb|EGB75881.1| NADH dehydrogenase I subunit A [Escherichia coli MS 57-2]
 gi|324013172|gb|EGB82391.1| NADH dehydrogenase I subunit A [Escherichia coli MS 60-1]
 gi|324020885|gb|EGB90104.1| NADH dehydrogenase I subunit A [Escherichia coli MS 117-3]
 gi|324112820|gb|EGC06796.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia
           fergusonii B253]
 gi|324117834|gb|EGC11733.1| NADH-ubiquinone/plastoquinone oxidoreductase [Escherichia coli
           E1167]
 gi|326339639|gb|EGD63450.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli O157:H7
           str. 1125]
 gi|326344101|gb|EGD67862.1| NADH ubiquinone oxidoreductase chain A [Escherichia coli O157:H7
           str. 1044]
 gi|331039724|gb|EGI11944.1| NADH dehydrogenase I subunit A [Escherichia coli H736]
 gi|331048579|gb|EGI20655.1| NADH dehydrogenase I subunit A [Escherichia coli M718]
 gi|331059602|gb|EGI31579.1| NADH dehydrogenase I subunit A [Escherichia coli TA143]
 gi|331069064|gb|EGI40456.1| NADH dehydrogenase I subunit A [Escherichia coli TA280]
 gi|331074694|gb|EGI46014.1| NADH dehydrogenase I subunit A [Escherichia coli H591]
 gi|332100918|gb|EGJ04264.1| NADH:ubiquinone oxidoreductase [Shigella sp. D9]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|291618189|ref|YP_003520931.1| NuoA [Pantoea ananatis LMG 20103]
 gi|291153219|gb|ADD77803.1| NuoA [Pantoea ananatis LMG 20103]
 gi|327394582|dbj|BAK12004.1| NADH-quinone oxidoreductase chain A NuoA [Pantoea ananatis AJ13355]
          Length = 147

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +   +VF+ IA  +   ++   +++  ++    K + +E G +   D  ++   
Sbjct: 7   TEIIAQHWAFVVFIVIAFGLCAFMLTGGWLLGGRARARYKDTPFESGIESVGDTHLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ WA   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWATSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 125


>gi|109156483|ref|YP_654416.1| NADH dehydrogenase subunit 3 [Siderastrea radians]
 gi|108744172|gb|ABG02390.1| NADH dehydrogenase subunit 3 [Siderastrea radians]
          Length = 118

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  +   +  +  + ++   + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MYQEFYGLFFLLVFSIVLSVLFSGASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVLFNQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|156933122|ref|YP_001437038.1| NADH dehydrogenase subunit A [Cronobacter sakazakii ATCC BAA-894]
 gi|223635460|sp|A7MH22|NUOA_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|156531376|gb|ABU76202.1| hypothetical protein ESA_00932 [Cronobacter sakazakii ATCC BAA-894]
          Length = 149

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 68/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K + +E G D    AR++   
Sbjct: 7   TEVIAHHWAFGIFLIVAIGLCCLMLVGAWFLGGRARARYKNTPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   +++ WLGF    +F+ +L  G +Y  + GALEW
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSVREVGWLGFIEAAIFILVLLAGLVYLVRIGALEW 125


>gi|317134282|ref|YP_004123165.1| NADH dehydrogenase subunit 3 [Pseudocorticium jarrei]
 gi|308912683|gb|ADO51444.1| NADH dehydrogenase subunit 3 [Pseudocorticium jarrei]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  + + + ++  I  V+  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFYGVFIALCLSIVISTVISGASYILGVKEPDIEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ + F+IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 61  FLIGIXFLIFDLEISFLFPWSVVYNQISLFGYWTMIIFLLILTLGLIYEWMKGGLEWE 118


>gi|270262814|ref|ZP_06191085.1| NADH-quinone oxidoreductase subunit A [Serratia odorifera 4Rx13]
 gi|270043498|gb|EFA16591.1| NADH-quinone oxidoreductase subunit A [Serratia odorifera 4Rx13]
          Length = 145

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 68/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +  ++++  F +  ++    K + +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAVFLVMAIGLCGLMLLGAFFLGGRARARAKHTPFESGIDSVGTARMRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSVRESGWVGFIEAAIFILVLLAGLVYLVRIGALDW 123


>gi|317097444|ref|YP_004123643.1| NADH dehydrogenase subunit 3 [Oscarella tuberculata]
 gi|317134138|ref|YP_004123301.1| NADH dehydrogenase subunit 3 [Oscarella lobularis]
 gi|308912623|gb|ADO51388.1| NADH dehydrogenase subunit 3 [Oscarella tuberculata]
 gi|308912745|gb|ADO51502.1| NADH dehydrogenase subunit 3 [Oscarella lobularis]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + + ++  I + +  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFYGIFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+ +LF+IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 61  FLIGILFLIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|1524182|emb|CAA45193.1| NADH dehydrogenase subunit 3 [Brassica napus]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 114


>gi|24372607|ref|NP_716649.1| NADH dehydrogenase subunit A [Shewanella oneidensis MR-1]
 gi|81744860|sp|Q8EI29|NUOA_SHEON RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|24346632|gb|AAN54094.1|AE015546_11 NADH dehydrogenase I, A subunit [Shewanella oneidensis MR-1]
          Length = 134

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 69/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +D+   +    +++  A AI + ++    ++  ++    K   +E G D    AR++F  
Sbjct: 3   ADISAQHWAFAIYVIGAIAICLTMIGLAALLGGRAQGRTKNKPFESGVDSVGTARLRFSA 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+V  ++  W+GF    +F+G+L +G +Y W+ GALEW
Sbjct: 63  KFYLVAMFFVIFDVEALYLFAWSVSVRESGWVGFIEATIFIGLLLIGLVYLWRIGALEW 121


>gi|224583186|ref|YP_002636984.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|289805803|ref|ZP_06536432.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|224467713|gb|ACN45543.1| NADH dehydrogenase alpha subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 145

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 5   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDW 123


>gi|1518353|emb|CAA89852.1| NADH dehydrogenase subunit 3 [Magnolia grandiflora]
 gi|1518356|emb|CAA89890.1| NADH dehydrogenase subunit 3 [Magnolia x soulangeana]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             VS+LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVSILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|317097236|ref|YP_004123365.1| NADH dehydrogenase subunit 3 [Plakortis simplex]
 gi|308912758|gb|ADO51514.1| NADH dehydrogenase subunit 3 [Plakortis simplex]
          Length = 122

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + ++    I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCVSIGFSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V   QIT  G+ +M+VFL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVLNQITLFGYWTMIVFLIILTLGLVYEWVKGGLEWE 122


>gi|304311495|ref|YP_003811093.1| NADH dehydrogenase I, chain A [gamma proteobacterium HdN1]
 gi|301797228|emb|CBL45448.1| NADH dehydrogenase I, chain A [gamma proteobacterium HdN1]
          Length = 137

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 64/118 (54%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           + L       VF+     IV  ++  P  +  +S    K   +E G      AR++   +
Sbjct: 5   EALAQNWSFGVFLGGIVFIVCAMLFIPVWLGGRSWGRAKNDPFEAGARSVGGARLRLSTK 64

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++LFVIFD+E  FL+ WAV  ++  W+GF   ++F+ +L VG +Y W+ GALEW
Sbjct: 65  FYLVAMLFVIFDVEALFLYAWAVALREAGWVGFFEALIFIAVLMVGLVYVWRMGALEW 122


>gi|262369333|ref|ZP_06062661.1| NADH dehydrogenase subunit I A [Acinetobacter johnsonii SH046]
 gi|262315401|gb|EEY96440.1| NADH dehydrogenase subunit I A [Acinetobacter johnsonii SH046]
          Length = 182

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 65/120 (54%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +      I+ F+   + + + ++  P ++  KS    K   +E G      AR++  
Sbjct: 1   MSAITPYEWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVGAGGARIRLS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +F LV++ FV+FDLE  +L+ WA   +++ W+GF +  VF+ +L VG +YE   GAL W
Sbjct: 61  AKFYLVAIFFVVFDLEALYLYAWATSVREVGWVGFTTAAVFILVLLVGLVYELSTGALNW 120


>gi|56421891|ref|YP_149209.1| NADH dehydrogenase subunit A [Geobacillus kaustophilus HTA426]
 gi|261420761|ref|YP_003254443.1| NADH dehydrogenase subunit A [Geobacillus sp. Y412MC61]
 gi|319768431|ref|YP_004133932.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. Y412MC52]
 gi|81675685|sp|Q5KUJ5|NUOA_GEOKA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|56381733|dbj|BAD77641.1| NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Geobacillus
           kaustophilus HTA426]
 gi|261377218|gb|ACX79961.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. Y412MC61]
 gi|317113297|gb|ADU95789.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. Y412MC52]
          Length = 122

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 68/115 (59%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            SY  I VF+ +   + I  + +   +    P   K +TYE G +PF D+RV+F +R+ L
Sbjct: 7   NSYLIIFVFLCLGVLLPIGALTAGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV + Q+       M++F+ +L +G IY WKK  L W
Sbjct: 67  FALLFVIFDIETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRW 121


>gi|164421043|ref|YP_001648673.1| NADH dehydrogenase subunit 3 [Plakortis angulospiculatus]
 gi|158939033|gb|ABW83953.1| NADH dehydrogenase subunit 3 [Plakortis angulospiculatus]
          Length = 122

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + ++  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCVSIGLSIIISGASYTLGVKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QIT  G+ +M+VFL ILT+G IYEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQITLFGYWTMIVFLIILTLGLIYEWVKGGLEWE 122


>gi|164421079|ref|YP_001648624.1| NADH dehydrogenase subunit 3 [Agelas schmidti]
 gi|158938994|gb|ABW83917.1| NADH dehydrogenase subunit 3 [Agelas schmidti]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 76/118 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + +I   K PD EK+S YECGFDPF  +R  F +RF
Sbjct: 1   MSAPFFSIFILILFSVILSTVISGASYIAGVKQPDGEKVSVYECGFDPFGSSRAPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI   G  +M +FL ILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFMIFDLEISFLFPWCVTYNQIHLWGVWTMFLFLIILTIGLIYEWAKGGLEWE 118


>gi|82253|pir||JV0006 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 3 - garden
           petunia mitochondrion
 gi|1323713|gb|AAC00529.1| NAD3 [Petunia sp.]
 gi|1421804|gb|AAB03875.1| NADH dehydrogenase chain 3 [Petunia axillaris subsp. parodii]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|313672277|ref|YP_004050388.1| NADH dehydrogenase subunit a [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939033|gb|ADR18225.1| NADH dehydrogenase subunit A [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 117

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/116 (43%), Positives = 77/116 (66%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI + + +A+ I I+ +   F++  + P+  KLS YECG   F DAR ++++RF 
Sbjct: 1   MSGYLPIALMLVVAALIGIISVSVGFLIRPRKPEKVKLSVYECGMPEFSDARQRYNVRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  +   G   M++F+ IL  G+ Y WKKGALEW
Sbjct: 61  VIAMLFVIFDVETVFLFPWAVSFDVLGLFGLIEMIIFIIILVFGYFYAWKKGALEW 116


>gi|81176543|ref|YP_398425.1| nad3 [Triticum aestivum]
 gi|13704|emb|CAA32475.1| unnamed protein product [Triticum aestivum]
 gi|433682|emb|CAA41864.1| NADH dehydrogenase subunit 3 [Triticum aestivum]
 gi|78675267|dbj|BAE47692.1| nad3 [Triticum aestivum]
 gi|169649076|gb|ACA62637.1| nad3 [Triticum aestivum]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LV +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|258514490|ref|YP_003190712.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778195|gb|ACV62089.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 68/117 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT    I +F+ +        + + F++  +  +P K   YECG      + V+F +++
Sbjct: 1   MLTDGGAIAIFLIVGIIFGAGGIATSFLIHPRRKNPVKFEPYECGVKTIGSSWVQFKVQY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + ++LFVIFD+E  +L+PWAV F+ +    F  M++F+ IL +G  Y WK+GALEW
Sbjct: 61  FVYALLFVIFDVETIYLYPWAVKFQSLGMFAFVEMIIFIFILVLGLWYAWKEGALEW 117


>gi|164420993|ref|YP_001648614.1| NADH dehydrogenase subunit 3 [Halisarca dujardini]
 gi|158668147|gb|ABW76606.1| NADH dehydrogenase subunit 3 [Halisarca dujardini]
          Length = 119

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 76/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  + V + I+ A+   +  + +++  K PD EK+S YECGFDPF+ +R  F +R  LV
Sbjct: 5   EFLGVFVLLLISVALSTAISGASYVLGVKKPDSEKVSAYECGFDPFESSRTPFSVRXFLV 64

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI++LFPW V   QI  LGF  M+VF  ILT+G IYEW  G L+W+
Sbjct: 65  GILFLIFDLEISYLFPWCVVSNQIELLGFWIMVVFXVILTLGLIYEWILGGLDWE 119


>gi|294637179|ref|ZP_06715487.1| NADH dehydrogenase I subunit A [Edwardsiella tarda ATCC 23685]
 gi|291089643|gb|EFE22204.1| NADH dehydrogenase I subunit A [Edwardsiella tarda ATCC 23685]
          Length = 146

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +   +++  + +  K+    K   YE G D    AR++   
Sbjct: 5   TEVIAQHWAFAVFVLVALGLCGFMLLGAYALGGKARARTKNIPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  WLGF    +F+ +L  G  Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSVRENGWLGFAEATLFILVLLAGLFYLVRIGALDW 123


>gi|300723690|ref|YP_003712997.1| NADH dehydrogenase I subunit A [Xenorhabdus nematophila ATCC 19061]
 gi|297630214|emb|CBJ90865.1| NADH dehydrogenase I chain A [Xenorhabdus nematophila ATCC 19061]
          Length = 147

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + +L  +    VF+  A  +  ++++  + +  ++    K   YE G D    AR++   
Sbjct: 5   TGILAHHWAFAVFLIGALGLCALMLLGGYFMGGRAKARAKHVPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  WLGF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSVKESGWLGFIEASIFILVLLAGLVYLARIGALDW 123


>gi|115378553|ref|ZP_01465708.1| NADH-quinone oxidoreductase chain a 1 [Stigmatella aurantiaca
           DW4/3-1]
 gi|310820745|ref|YP_003953103.1| NADH-quinone oxidoreductase subunit [Stigmatella aurantiaca
           DW4/3-1]
 gi|115364425|gb|EAU63505.1| NADH-quinone oxidoreductase chain a 1 [Stigmatella aurantiaca
           DW4/3-1]
 gi|309393817|gb|ADO71276.1| NADH-quinone oxidoreductase subunit [Stigmatella aurantiaca
           DW4/3-1]
          Length = 122

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 75/121 (61%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS  L  Y P+ V + +A  + +++     ++  + P   K ST+E G +    AR +F 
Sbjct: 1   MSSPLAPYLPMAVALLVAGVLALLMPGLASLLGPRRPSAIKSSTFEAGSESTGPARQRFA 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F ++++LF+IFD+E  FL+PWAV F+ + W G+  M+VF   L VG IY WKKGAL+W
Sbjct: 61  VKFYVIALLFIIFDVEAVFLYPWAVNFQALGWFGYWEMVVFAATLVVGLIYIWKKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|332883544|gb|EGK03827.1| hypothetical protein HMPREF9456_01894 [Dysgonomonas mossii DSM
           22836]
          Length = 122

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/121 (40%), Positives = 80/121 (66%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  +  + PIL+ +A ++  V   +    ++        K + +ECG DP  DAR  F 
Sbjct: 1   MNSSIYDFIPILMQIAFSAIFVFATVFISKMLGPSRRSARKNANFECGLDPIGDARSPFP 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LFV+FD+EI F++PWAV FK+++W GFG M +F+GI+ VGF+YE K+ AL+W
Sbjct: 61  VKYFLVAILFVLFDIEIIFMYPWAVNFKELSWEGFGKMGIFIGIIVVGFLYEAKRKALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254796790|ref|YP_003081627.1| NADH dehydrogenase i, a subunit [Neorickettsia risticii str.
           Illinois]
 gi|254590038|gb|ACT69400.1| NADH dehydrogenase i, a subunit [Neorickettsia risticii str.
           Illinois]
          Length = 151

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  I +F  +A  I  V++I P  +A  S +  K  +YECGFD       +F++RF
Sbjct: 34  VMEGYIFIGLFFVVACFISCVMLILPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRF 93

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF++FDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 94  YLVGILFIVFDLEIIFLFPWAVSARELGPAAFVSVLIFLVILTVGFVYEFVSGALDW 150


>gi|219847966|ref|YP_002462399.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Chloroflexus aggregans DSM 9485]
 gi|219542225|gb|ACL23963.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chloroflexus
           aggregans DSM 9485]
          Length = 118

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 73/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+   IA  I   ++    ++  +   P KL+ YE G +P   A  +  ++F
Sbjct: 1   MLESYIPVLILFLIAVFIAAFVITLSALLGPRRSTPRKLAPYESGMNPIGQAIRRIPVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+E+ F +P+A+ F+Q+   G   M VF  +L VGF+YEWKKGAL W+
Sbjct: 61  YVVAMLFIVFDIEVVFFYPFALVFRQLGPAGLVVMGVFFLVLIVGFVYEWKKGALRWE 118


>gi|109156540|ref|YP_654300.1| NADH dehydrogenase subunit 3 [Rhodactis sp. CASIZ 171755]
 gi|108515268|gb|ABF93381.1| NADH dehydrogenase subunit 3 [Rhodactis sp. CASIZ 171755]
          Length = 118

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  +L  +  +  +      + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MNIEFHSLLFLLIFSVVLSAFFSGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI   GF  M+VFLGILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVIYNQIAPFGFWIMVVFLGILTLGLIYEWIKGGLEWE 118


>gi|107736857|ref|YP_626484.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168915]
 gi|107736884|ref|YP_626497.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168916]
 gi|99866568|gb|ABF67616.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168915]
 gi|99866582|gb|ABF67629.1| NADH dehydrogenase subunit 3 [Discosoma sp. CASIZ 168916]
          Length = 118

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  +L  +  +  +      + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MNIEFYSLLFLLIFSVVLSAFFSGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI  LGF  M+VFLGILT+G +YEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVIYNQIAPLGFWIMVVFLGILTLGLVYEWIKGGLEWE 118


>gi|148284879|ref|YP_001248969.1| NADH dehydrogenase subunit A [Orientia tsutsugamushi str. Boryong]
 gi|189183818|ref|YP_001937603.1| NADH dehydrogenase subunit A [Orientia tsutsugamushi str. Ikeda]
 gi|146740318|emb|CAM80722.1| NADH dehydrogenase I chain A [Orientia tsutsugamushi str. Boryong]
 gi|189180589|dbj|BAG40369.1| NADH dehydrogenase I chain A [Orientia tsutsugamushi str. Ikeda]
          Length = 123

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 70/115 (60%), Positives = 84/115 (73%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y PI++F AIA A+   ++I P I A K  +  KL +YECGFD F +AR KFDIRF L+
Sbjct: 9   EYLPIVIFFAIALALSFFIIILPKIFASKKYNKSKLESYECGFDTFSEARSKFDIRFYLI 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           S+LF+IFDLEIAFL PWAV  K+    GF SMM FL IL +GFIYEWKKGALEW+
Sbjct: 69  SMLFIIFDLEIAFLIPWAVNLKETKMFGFYSMMFFLLILVIGFIYEWKKGALEWE 123


>gi|109156525|ref|YP_654390.1| NADH dehydrogenase subunit 3 [Pavona clavus]
 gi|108744144|gb|ABG02364.1| NADH dehydrogenase subunit 3 [Pavona clavus]
          Length = 118

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  + + +  +  +  +   + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MYLEFYSLFLLLVFSVILSALFFGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF++FDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLVFDLEISFLFPWCVLFNQISPFGFWVMVGFLGVLTLGLIYEWVKGGLEWE 118


>gi|238023159|ref|ZP_04603585.1| hypothetical protein GCWU000324_03085 [Kingella oralis ATCC 51147]
 gi|237865542|gb|EEP66682.1| hypothetical protein GCWU000324_03085 [Kingella oralis ATCC 51147]
          Length = 122

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PIL+F  I     IV +    ++  K    EK + +ECGF+ F++AR+KFD+R+
Sbjct: 1   MLANYFPILIFAIIGIIAGIVFIGLGTLLGPKRHYAEKDAPFECGFEAFENARMKFDVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI----TWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            LV++LF++FDLE+AF+ PWAV +K +        F SM+VF+ +LTVGF+YEWKKGALE
Sbjct: 61  YLVAILFILFDLEVAFMVPWAVVYKDLMHSTGAYAFWSMLVFIVVLTVGFVYEWKKGALE 120

Query: 120 WD 121
           W+
Sbjct: 121 WE 122


>gi|269794073|ref|YP_003313528.1| NADH dehydrogenase subunit A [Sanguibacter keddieii DSM 10542]
 gi|269096258|gb|ACZ20694.1| NADH dehydrogenase subunit A [Sanguibacter keddieii DSM 10542]
          Length = 120

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+LV M IA  + +  + +  ++  K  +  KL  YECG +P   A    +F +
Sbjct: 1   MNNPYVPLLVLMGIAMVLALGGVAASAVIGPKRYNRAKLDAYECGIEPTPQAAGGGRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ LV++ F+IFD+E+ FL+PWAV F  +   G  +M+ FL ++TV F+YEW++G  EWD
Sbjct: 61  KYYLVAMTFIIFDIEVVFLYPWAVDFSTLAMFGLVAMLSFLALITVPFVYEWRRGGFEWD 120


>gi|49147175|ref|YP_025768.1| NADH dehydrogenase subunit 3 [Pseudendoclonium akinetum]
 gi|33439190|gb|AAQ18727.1| NADH dehydrogenase subunit 3 [Pseudendoclonium akinetum]
          Length = 117

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 80/116 (68%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  IL+++  A A   +   + F+VA +    EK S+YECGFDPFDDAR +FD+RF 
Sbjct: 1   MYDYLSILIYLVAAGAFATIFSGAAFLVAVRRTYSEKTSSYECGFDPFDDARSRFDVRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+I DLEI F FP+++    I  LG+   ++F+ ILTVGFIYEW KGAL+W
Sbjct: 61  LVALLFLIMDLEILFCFPYSIALADIGSLGYWVGIIFILILTVGFIYEWSKGALDW 116


>gi|317097064|ref|YP_004123206.1| NADH dehydrogenase subunit 3 [Oscarella viridis]
 gi|308912699|gb|ADO51459.1| NADH dehydrogenase subunit 3 [Oscarella viridis]
          Length = 118

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + + ++  I + +  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFYGIFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             + +LF+IFDLEI+FLFPW+V + QI+  G+ +M++FL ILT+G IYEW KG LEW+
Sbjct: 61  FXIGILFLIFDLEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118


>gi|322715377|gb|EFZ06948.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 147

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDW 125


>gi|329296019|ref|ZP_08253355.1| NADH:ubiquinone oxidoreductase subunit A [Plautia stali symbiont]
          Length = 147

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +   +VF+ IA  +   ++   +++  ++    K + +E G +   D  ++   
Sbjct: 5   TEVIAHHWAFIVFIVIAFGLCAFMLTGGWLLGGRALARHKDTPFESGIESVGDTHIRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDW 123


>gi|54606761|dbj|BAD66784.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGVPFPFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA
Sbjct: 61  YLVSILFIILDPEVTFFFPWAVPLNKIDPFGSWSMMAFLLILTIGFLYEWKRGA 114


>gi|237732319|ref|ZP_04562800.1| NADH dehydrogenase subunit I A [Citrobacter sp. 30_2]
 gi|283832282|ref|ZP_06352023.1| NADH dehydrogenase I subunit A [Citrobacter youngae ATCC 29220]
 gi|226907858|gb|EEH93776.1| NADH dehydrogenase subunit I A [Citrobacter sp. 30_2]
 gi|291071926|gb|EFE10035.1| NADH dehydrogenase I subunit A [Citrobacter youngae ATCC 29220]
          Length = 147

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEIIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWIGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|110636930|ref|YP_677137.1| NADH dehydrogenase I subunit A [Cytophaga hutchinsonii ATCC 33406]
 gi|110279611|gb|ABG57797.1| NADH dehydrogenase subunit A [Cytophaga hutchinsonii ATCC 33406]
          Length = 177

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S  L+ +  IL+F+      V++ +    ++    P+ EKL  YECG D    A V  + 
Sbjct: 5   SSQLSEFGVILLFIITGIVFVLIGVGVAALLRPNRPNIEKLMVYECGEDAVGKAWVNMNA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQ----------ITWLGFGSMMVFLGILTVGFIY 111
           R+ L +++FV+F++E+ +LFP A  +             T      +++F+ +L +G +Y
Sbjct: 65  RYYLTALIFVLFEVEVIYLFPIATVYGDHRLDAATQGAWTIFSLIEILIFITLLFIGLVY 124

Query: 112 EWKKGALEWD 121
            W+KG L+W+
Sbjct: 125 VWRKGYLDWN 134


>gi|330339540|ref|YP_004376740.1| NADH dehydrogenase subunit 3 [Corallium konojoi]
 gi|328750581|dbj|BAK18842.1| NADH dehydrogenase subunit 3 [Corallium konojoi]
          Length = 117

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFGGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +K +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYKGLPLFGYWVVMIFLFILTLGLIYEWIEGGLEWE 116


>gi|291285957|ref|YP_003502773.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883117|gb|ADD66817.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 117

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/116 (43%), Positives = 77/116 (66%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y PI++F+ +AS + +++M +  I+  K  +  K S YECG  P D+ R + ++RF 
Sbjct: 1   MSGYLPIVLFLLVASTLGLIVMFAGAIIRPKKYEKVKFSVYECGMPPLDENRKRLNVRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++++LFVIFD+E  FLFPWAV F  I   G   M++FL IL  G+ Y W+KGALEW
Sbjct: 61  IIAMLFVIFDVETVFLFPWAVAFDMIGLFGLIEMILFLVILVFGYFYAWQKGALEW 116


>gi|224365657|ref|YP_002608384.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
 gi|225465152|ref|XP_002278765.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|209954181|emb|CAQ77633.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
 gi|239764727|gb|ACS15198.1| NADH dehydrogenase subunit 3 [Vitis vinifera]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|16761253|ref|NP_456870.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765655|ref|NP_461270.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29141051|ref|NP_804393.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412775|ref|YP_149850.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62180898|ref|YP_217315.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161502527|ref|YP_001569639.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161612943|ref|YP_001586909.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167549673|ref|ZP_02343432.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994676|ref|ZP_02575767.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168229697|ref|ZP_02654755.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168237345|ref|ZP_02662403.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168242446|ref|ZP_02667378.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261656|ref|ZP_02683629.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168465969|ref|ZP_02699839.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168817942|ref|ZP_02829942.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444990|ref|YP_002041588.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447452|ref|YP_002046381.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472529|ref|ZP_03078513.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736597|ref|YP_002115397.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197250694|ref|YP_002147286.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264848|ref|ZP_03164922.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197361709|ref|YP_002141345.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243632|ref|YP_002216398.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387246|ref|ZP_03213858.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204929296|ref|ZP_03220439.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205353443|ref|YP_002227244.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857746|ref|YP_002244397.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213022739|ref|ZP_03337186.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052943|ref|ZP_03345821.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213420338|ref|ZP_03353404.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213427011|ref|ZP_03359761.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581021|ref|ZP_03362847.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213610192|ref|ZP_03370018.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647304|ref|ZP_03377357.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|238912393|ref|ZP_04656230.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289827448|ref|ZP_06546060.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|75505655|sp|Q57M28|NUOA_SALCH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81678157|sp|Q5PN55|NUOA_SALPA RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81706882|sp|Q7CQ49|NUOA_SALTY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81766267|sp|Q8XFY2|NUOA_SALTI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635484|sp|B5EZK9|NUOA_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635485|sp|A9MJ97|NUOA_SALAR RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635486|sp|B5FPG9|NUOA_SALDC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635487|sp|B5R309|NUOA_SALEP RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635488|sp|B5RCF3|NUOA_SALG2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635489|sp|B4TBJ4|NUOA_SALHS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635490|sp|B4SYZ9|NUOA_SALNS RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635491|sp|A9N4C4|NUOA_SALPB RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635492|sp|B5BCL8|NUOA_SALPK RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635493|sp|B4TPL0|NUOA_SALSV RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|25285113|pir||AF0797 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16420869|gb|AAL21229.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16503552|emb|CAD07560.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136677|gb|AAO68242.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127032|gb|AAV76538.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128531|gb|AAX66234.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160863874|gb|ABX20497.1| hypothetical protein SARI_00571 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362307|gb|ABX66075.1| hypothetical protein SPAB_00649 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403653|gb|ACF63875.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194405756|gb|ACF65975.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458893|gb|EDX47732.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712099|gb|ACF91320.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195631248|gb|EDX49808.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197093185|emb|CAR58629.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214397|gb|ACH51794.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243103|gb|EDY25723.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289662|gb|EDY29025.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938148|gb|ACH75481.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199604344|gb|EDZ02889.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204321840|gb|EDZ07039.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273224|emb|CAR38187.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325242|gb|EDZ13081.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327489|gb|EDZ14253.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205335825|gb|EDZ22589.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205338425|gb|EDZ25189.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205345007|gb|EDZ31771.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205349376|gb|EDZ36007.1| NADH-quinone oxidoreductase, A subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709549|emb|CAR33894.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261247534|emb|CBG25361.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994423|gb|ACY89308.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158886|emb|CBW18399.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913319|dbj|BAJ37293.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320086762|emb|CBY96534.1| NADH dehydrogenase I chain A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321222971|gb|EFX48042.1| NADH ubiquinone oxidoreductase chain A [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322617074|gb|EFY13980.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617620|gb|EFY14519.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624750|gb|EFY21579.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630299|gb|EFY27069.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634480|gb|EFY31213.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639190|gb|EFY35882.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640053|gb|EFY36720.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645726|gb|EFY42250.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322651502|gb|EFY47877.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656061|gb|EFY52360.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659414|gb|EFY55661.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665874|gb|EFY62057.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669886|gb|EFY66027.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673872|gb|EFY69969.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678630|gb|EFY74686.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683574|gb|EFY79588.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687650|gb|EFY83620.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323130659|gb|ADX18089.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323193516|gb|EFZ78721.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198421|gb|EFZ83523.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201935|gb|EFZ86997.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208527|gb|EFZ93466.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323209764|gb|EFZ94688.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218300|gb|EGA03010.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323227378|gb|EGA11543.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232295|gb|EGA16398.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235671|gb|EGA19755.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241168|gb|EGA25204.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244910|gb|EGA28912.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250029|gb|EGA33923.1| NADH:ubiquinone oxidoreductase subunit A [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323254448|gb|EGA38263.1| NADH:ubiquinone oxidoreductase subunit A [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323254952|gb|EGA38743.1| NADH:ubiquinone oxidoreductase subunit A [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260332|gb|EGA43951.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268092|gb|EGA51569.1| NADH:ubiquinone oxidoreductase subunit A [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270815|gb|EGA54253.1| NADH:ubiquinone oxidoreductase subunit A [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326624149|gb|EGE30494.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326628535|gb|EGE34878.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332989261|gb|AEF08244.1| NADH dehydrogenase subunit A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 147

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDW 125


>gi|269926649|ref|YP_003323272.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790309|gb|ACZ42450.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y PI V   + +A  I  +   + ++ K P+P K  TYE G  P   A+ ++DIR+
Sbjct: 1   MLTDYVPIGVLFLLVAAFAIAALALSYALSPKRPNPVKAETYESGIKPTGTAQHRYDIRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             V++LFV+FD+E  FL+PWAV + +I   G   M++F+ +L + + Y W+KGALEW
Sbjct: 61  YTVAMLFVLFDIEAIFLYPWAVVYDRIGLYGLVEMLLFIVLLIIAYAYAWRKGALEW 117


>gi|1518347|emb|CAA89854.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
 gi|12584567|emb|CAA58829.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|126666304|ref|ZP_01737283.1| NADH-quinone oxidoreductase, A subunit [Marinobacter sp. ELB17]
 gi|126629105|gb|EAZ99723.1| NADH-quinone oxidoreductase, A subunit [Marinobacter sp. ELB17]
          Length = 164

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 66/117 (56%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L+  Y    +F+     +   ++    ++  +S  P K   +E G      AR +F I+F
Sbjct: 36  LIAEYWATGLFVLAVIGLCTFMIGVSALLGGRSQGPSKGLPFESGIIGTGSARQRFSIQF 95

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LFVIFD+E  FLF WAV  +++ W GF    +F+GIL  G +Y+++ GAL+W
Sbjct: 96  YLVAMLFVIFDIEAMFLFSWAVSVREVGWGGFWGAAIFIGILLAGLVYDYRSGALDW 152


>gi|15802835|ref|NP_288862.1| NADH dehydrogenase subunit A [Escherichia coli O157:H7 EDL933]
 gi|25285105|pir||E85869 NADH dehydrogenase I chain A [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12516641|gb|AAG57417.1|AE005461_2 NADH dehydrogenase I chain A [Escherichia coli O157:H7 str. EDL933]
          Length = 147

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 65/119 (54%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D    AR++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F  V++ FVIFD+E  +LF W+   ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYXVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|88608319|ref|YP_506315.1| NADH dehydrogenase I, A subunit [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600488|gb|ABD45956.1| NADH dehydrogenase I, A subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 151

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  + +F  +A  I  V++  P  +A  S +  K  +YECGFD       +F++RF
Sbjct: 34  VVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRF 93

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF+IFDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 94  YLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDW 150


>gi|148266254|ref|YP_001232960.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Geobacter
           uraniireducens Rf4]
 gi|223635440|sp|A5G9B9|NUOA2_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|146399754|gb|ABQ28387.1| NADH dehydrogenase subunit A [Geobacter uraniireducens Rf4]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 77/118 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L +Y PI+V + +A       +I   ++  K P   K++ YECG +P   AR +F I+F
Sbjct: 1   MLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            ++++LF++FD+E  FL+PWAV FK++   G   M VF+ IL VG+IY WKKGALEW+
Sbjct: 61  YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE 118


>gi|256396792|ref|YP_003118356.1| NADH dehydrogenase subunit A [Catenulispora acidiphila DSM 44928]
 gi|256363018|gb|ACU76515.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Catenulispora
           acidiphila DSM 44928]
          Length = 119

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + SYAPILV   +A+   +  ++S  +   K  +  KL  YECG +P        +F ++
Sbjct: 1   MNSYAPILVLGGLAAGFAVFSVVSGMLTGPKRYNRAKLEAYECGIEPTPQPVGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV F  + W G   M+ F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVRFDSLGWFGLVEMVFFILTVFVAYAYVWRRGGLEWD 119


>gi|114151575|ref|YP_740363.1| NADH dehydrogenase subunit 3 [Zea perennis]
 gi|114151607|ref|YP_740442.1| NADH dehydrogenase subunit 3 [Zea luxurians]
 gi|114151641|ref|YP_740388.1| NADH dehydrogenase subunit 3 [Zea mays subsp. parviglumis]
 gi|115278613|ref|YP_762508.1| NADH dehydrogenase subunit 3 [Tripsacum dactyloides]
 gi|13914|emb|CAA32833.1| unnamed protein product [Zea mays]
 gi|12057071|emb|CAC19841.1| NADH dehydrogenase subunit 3 [Avena sativa]
 gi|93116049|gb|ABE98682.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|93116093|gb|ABE98725.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|93116140|gb|ABE98771.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|102567909|gb|ABF70826.1| NADH dehydrogenase subunit 3 [Zea perennis]
 gi|102567974|gb|ABF70858.1| NADH dehydrogenase subunit 3 [Zea mays subsp. parviglumis]
 gi|102579642|gb|ABF70922.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|110287603|gb|ABG65649.1| NADH dehydrogenase subunit 3 [Zea luxurians]
 gi|114432104|gb|ABI74653.1| NADH dehydrogenase subunit 3 [Tripsacum dactyloides]
 gi|164422235|gb|ABY55208.1| NADH dehydrogenase subunit 3-1 [Bambusa oldhamii]
 gi|164422236|gb|ABY55209.1| NADH dehydrogenase subunit 3-2 [Bambusa oldhamii]
 gi|291498631|gb|ADE08105.1| nad3 [Triticum aestivum]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|128720|sp|P27062|NU3M_PANGI RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1352869|gb|AAB01588.1| NADH dehydrogenase subunit 3 [Panax ginseng]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  P+KLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGVPFPFASNSSTYPDKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|116622681|ref|YP_824837.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116225843|gb|ABJ84552.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 79/117 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + + Y PI +F+AIA +  +V +++  ++   +P   KL  YECG     D+R ++ +RF
Sbjct: 1   MPSGYLPIFIFLAIAISFPVVAIVAAKLIRPSAPFAAKLEAYECGIKAASDSRGRYTVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++++LFVIFD+E  FLFPWAV ++Q+ W G   + VFL IL VG+I+ +KKGALEW
Sbjct: 61  YIIAILFVIFDVETIFLFPWAVRYRQMQWFGVAEVAVFLVILAVGYIWAYKKGALEW 117


>gi|104782521|ref|YP_609019.1| NADH dehydrogenase subunit A [Pseudomonas entomophila L48]
 gi|122402720|sp|Q1I800|NUOA_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|95111508|emb|CAK16228.1| NADH dehydrogenase I chain A [Pseudomonas entomophila L48]
          Length = 137

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/117 (31%), Positives = 62/117 (52%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   +F
Sbjct: 7   LIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKF 66

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LFVIFD+E  FL+ W+V  ++  W GF   +VF+ IL  G +Y W+ GAL+W
Sbjct: 67  YLVAMLFVIFDIEALFLYAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDW 123


>gi|12006705|gb|AAG44883.1|AF285878_1 NADH dehydrogenase subunit 3 [Daucus carota]
 gi|12006707|gb|AAG44884.1|AF285879_1 NADH dehydrogenase subunit 3 [Daucus carota]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 80/114 (70%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ A  S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFLFASNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|295400694|ref|ZP_06810671.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112612|ref|YP_003990928.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. Y4.1MC1]
 gi|294977275|gb|EFG52876.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217713|gb|ADP76317.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. Y4.1MC1]
          Length = 122

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 70/120 (58%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++  + +Y  + VF+ I   + +  +     +    PD  K +TYE G +PF D+RV F 
Sbjct: 2   LNVYVNNYVIVFVFLCIGVLLPVGALAVGRFLRPHVPDEAKQTTYESGNNPFHDSRVSFQ 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + + ++LFVIFD+E  FL+PWAV + ++ W  F  M +F+ +L +G +Y WKK  L W
Sbjct: 62  VHYYMFALLFVIFDVETVFLYPWAVAYDKLGWFAFIEMFIFMFMLVLGLVYAWKKKVLRW 121


>gi|63025106|ref|YP_232800.1| NADH dehydrogenase subunit 3 [Geodia neptuni]
 gi|37961468|gb|AAP59165.1| NADH dehydrogenase subunit 3 [Geodia neptuni]
          Length = 118

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I   +  +  +  V+  + ++V  + PD EK+S YECGFDP   +R  F ++F
Sbjct: 1   MDAEFLEIFFLILFSVTLSTVISGASYLVGIRQPDSEKVSVYECGFDPLGSSRTPFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF++FDLEI+FLFPW V + QI  LG   M +FL ILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLVFDLEISFLFPWCVIYNQIGLLGIWMMYLFLVILTIGLIYEWVKGGLEWE 118


>gi|255036229|ref|YP_003086850.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dyadobacter
           fermentans DSM 18053]
 gi|254948985|gb|ACT93685.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dyadobacter
           fermentans DSM 18053]
          Length = 155

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 10/127 (7%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ +  IL+F+  A  ++ +++     +    P+ EKL+TYE G +P  +A ++F++RF
Sbjct: 1   MLSDFGYILLFIIAALVLLGLMLTIARFLRPHKPNEEKLTTYESGEEPLGNANIQFNVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYF----------KQITWLGFGSMMVFLGILTVGFIYEW 113
            +V+++FV+F++E+ FLFPW+V F           Q  W     M VF+GIL  G  Y W
Sbjct: 61  YVVALIFVLFEVELLFLFPWSVVFGSEELIEQTGGQWGWFAMAEMTVFIGILIFGLAYAW 120

Query: 114 KKGALEW 120
            KG L+W
Sbjct: 121 AKGYLDW 127


>gi|257485439|ref|ZP_05639480.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331010727|gb|EGH90783.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 137

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD++  FLF W+V  ++  W GF   +VF+ IL  G +Y W+ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIDALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDW 123


>gi|313768497|ref|YP_004062173.1| NADH dehydrogenase subunit 3 [Gracilariophila oryzoides]
 gi|312844624|gb|ADR03189.1| NADH dehydrogenase subunit 3 [Gracilariophila oryzoides]
          Length = 121

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 64/121 (52%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y+ IL+F+ I+  + + +    + +  +  D EK+S YECGF+PFDDARV FD
Sbjct: 1   MKLIFTEYSIILMFLVISFILSVAIFSLSYFLIPQKADQEKVSAYECGFNPFDDARVTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPW++    I   GF SM++FL ILT+GFIYEW KGALEW
Sbjct: 61  VRFYLVAILFLIFDLEISFLFPWSLVLGNIPLFGFWSMIIFLLILTLGFIYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|164421018|ref|YP_001648539.1| NADH dehydrogenase subunit 3 [Iotrochota birotulata]
 gi|158938948|gb|ABW83874.1| NADH dehydrogenase subunit 3 [Iotrochota birotulata]
          Length = 122

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 75/115 (65%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  I   +  +  +  ++  + +IV  K PD EK+S YECGFDPF  +RV F ++F LV
Sbjct: 8   EFWGIFWLILCSIVLSTIISGASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLV 67

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPW V   QI  LG   M +FL ILT+G IYEW +G LEW+
Sbjct: 68  GILFLIFDLEISFLFPWCVVLNQINILGVWVMYLFLIILTIGLIYEWVRGGLEWE 122


>gi|226315030|ref|YP_002774926.1| NADH dehydrogenase subunit A [Brevibacillus brevis NBRC 100599]
 gi|226097980|dbj|BAH46422.1| NADH-quinone oxidoreductase chain A [Brevibacillus brevis NBRC
           100599]
          Length = 123

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLM-ISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
            +Y  + +F+ +   + +  +     ++  K P  EK +TYE G  P  D+ V+F++++ 
Sbjct: 7   NNYVIVAIFLILGVLLPVATVSFVGPLLRPKKPTREKQTTYESGNIPVGDSWVRFNVKYY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + +++FVIFD+E  FL+PWAV +K++       M++F+ +L VG IY W+K  LEW+
Sbjct: 67  IFALMFVIFDVETLFLYPWAVAYKELGLFALVEMVIFISLLVVGLIYAWRKKVLEWN 123


>gi|2665687|gb|AAB88455.1| NADH-UQ dehydrogenase subunit 3 [Lupinus luteus]
 gi|2665690|gb|AAB88457.1| NADH-UQ dehydrogenase subunit 3 [Lupinus albus]
 gi|2665693|gb|AAB88459.1| NADH-UQ dehydrogenase subunit 3 [Lupinus mutabilis]
 gi|2665696|gb|AAB88461.1| NADH-UQ dehydrogenase subunit 3 [Lupinus angustifolius]
          Length = 118

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISLLVSLIPLGLPFPFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLFILTIGSLYEWKRGA 114


>gi|108804470|ref|YP_644407.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Rubrobacter
           xylanophilus DSM 9941]
 gi|108765713|gb|ABG04595.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Rubrobacter
           xylanophilus DSM 9941]
          Length = 129

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 62/113 (54%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           Y  +  F+ +    V  +++   ++A   P   K   YE       D    F +R+ + +
Sbjct: 16  YLYVGAFILLVVGFVASVLVLARLIAPSRPSETKRRVYETAETSVTDPWRPFPVRYYVFA 75

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF+IFD+E AFL+PWAV ++++   GF  M+VF+ IL  G  Y WKKGAL W
Sbjct: 76  LLFLIFDVEAAFLYPWAVVYRELGVYGFVEMVVFVLILGAGLAYAWKKGALRW 128


>gi|117621492|ref|YP_856318.1| NADH dehydrogenase subunit A [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|223635444|sp|A0KJ67|NUOA_AERHH RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|117562899|gb|ABK39847.1| NADH-quinone oxidoreductase chain a [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 134

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 65/114 (57%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +    V++  A  I + ++    ++  ++    K   +E G D   +AR++F  +F LV
Sbjct: 8   QHWAFAVYVVGAICICLTMIGLAALLGGRAYGRAKNKPFESGVDSVGNARLRFSAKFYLV 67

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++ FVIFD+E  +LF W+V  ++  W+GF    +F+ +L VG IY W+ GAL+W
Sbjct: 68  AMFFVIFDVEALYLFAWSVSVRESGWVGFIEATIFISLLLVGLIYLWRIGALDW 121


>gi|292559464|ref|YP_003540832.1| NADH dehydrogenase subunit 3 [Hartmannella vermiformis]
 gi|290775717|gb|ADD62216.1| NADH dehydrogenase subunit 3 [Hartmannella vermiformis]
          Length = 117

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 82/117 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA I ++  +   I + L    F++ +  PD EKLS YECGF PF DAR +F+++F
Sbjct: 1   MLVEYANIGIYWVLVLFIALALCALSFLLVYHKPDDEKLSAYECGFSPFGDARGRFEVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFDLEI FLFPW+V    I + GF SM +FL ILT+GFIYEW KGAL+W
Sbjct: 61  YLVAILFIIFDLEITFLFPWSVVVGHIGFWGFNSMFIFLFILTIGFIYEWMKGALDW 117


>gi|146299006|ref|YP_001193597.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Flavobacterium johnsoniae UW101]
 gi|146153424|gb|ABQ04278.1| NADH dehydrogenase subunit A [Flavobacterium johnsoniae UW101]
          Length = 121

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/121 (39%), Positives = 72/121 (59%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M     SY PIL+ + +A   V+  +I    +  K     K   +ECG +   +AR+ F 
Sbjct: 1   MQSDQYSYIPILMQLILAVGFVVGTIIISGKLGPKRNSEVKDKNFECGIESVGNARIPFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LFV+FD+E+ FL+PWAV FK +   G   M+VF+ +L VGF Y  KK ALEW
Sbjct: 61  VKYFLVAILFVLFDVEVIFLYPWAVNFKDLGIEGMLKMIVFMSLLLVGFFYIIKKKALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|322831984|ref|YP_004212011.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rahnella sp.
           Y9602]
 gi|321167185|gb|ADW72884.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rahnella sp.
           Y9602]
          Length = 147

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +  ++++    +  ++    K + +E G      AR++   
Sbjct: 7   TEVIAQHWAFAVFLVVAVGLCCLMLLGAAFLGGRARARYKNTPFESGIASVGTARLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W GF    +F+ +L  G  Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEALYLYAWSTSIRESGWTGFVEATIFILVLLAGLFYLVRIGALDW 125


>gi|164420949|ref|YP_001648462.1| NADH dehydrogenase subunit 3 [Amphimedon compressa]
 gi|158668073|gb|ABW76537.1| NADH dehydrogenase subunit 3 [Amphimedon compressa]
          Length = 118

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + +IV  K PD EK S YECGFDPF+ +R+ F +RF
Sbjct: 1   MNIEFIGIFLLLFFSIILSTVISGASYIVGVKQPDGEKTSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW+V + Q    GF +M++FL ILT+G IYEW +G LEW+
Sbjct: 61  FLVGILFMIFDLEISFLFPWSVVYNQTGLFGFWTMVLFLIILTIGLIYEWVQGGLEWE 118


>gi|41203470|ref|NP_957730.1| NADH dehydrogenase subunit 3 [Emiliania huxleyi]
 gi|33114156|gb|AAP94712.1| NADH dehydrogenase subunit 3 [Emiliania huxleyi]
          Length = 119

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 95/118 (80%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++T+Y+ IL+F+ IA  + +++   P+++++K+ D EK S+YECGF+PF D+R +F+I+F
Sbjct: 2   IITNYSGILLFLVIAIILAVIVFAIPYLLSYKTIDREKFSSYECGFNPFKDSRNEFEIKF 61

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLEI+FLFP+ +   Q+T +G GSM +FL +LTVGF YEWKKG+L+W+
Sbjct: 62  YLVAILFLIFDLEISFLFPFIMCLDQLTIVGVGSMFIFLLVLTVGFYYEWKKGSLDWE 119


>gi|167630264|ref|YP_001680763.1| proton-translocating NADH-ubiquinone oxidoreductase, chain a
           [Heliobacterium modesticaldum Ice1]
 gi|223635466|sp|B0TH77|NUOA_HELMI RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|167593004|gb|ABZ84752.1| proton-translocating NADH-ubiquinone oxidoreductase, chain a
           [Heliobacterium modesticaldum Ice1]
          Length = 118

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 63/117 (53%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  I +F+A    I  +      ++  +     K   YECG +   D  ++F   +
Sbjct: 1   MLKEYLGISLFLAAGLIIPFLAFAVSRLLQTRKNSLVKGEPYECGMETIGDTWIQFKSNY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L +++FV FD+E  FL+PWAV F+Q+       M +F+ IL VGF Y WK+GALEW
Sbjct: 61  FLYALVFVAFDVETVFLYPWAVKFQQLGTFAIVEMFIFITILVVGFWYAWKEGALEW 117


>gi|148657778|ref|YP_001277983.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
 gi|148569888|gb|ABQ92033.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Roseiflexus
           sp. RS-1]
          Length = 118

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL    +A  I + +++    +  + P+  KL  YE G +P   A+ +F I+F
Sbjct: 1   MLIDYLPILTLFLVAMFIAVFVIVLSRYLGPQRPNRRKLMPYESGMEPIGPAQRRFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+EI FLFP+A+ ++Q+   G  +M VF  +L +G IYEW++GAL W+
Sbjct: 61  NLVAMLFILFDIEIIFLFPYALVYRQLGIPGLAAMGVFFVVLVIGLIYEWRRGALRWE 118


>gi|328775175|gb|AEB39982.1| NADH dehydrogenase subunit 3 [Funaria hygrometrica]
 gi|328775233|gb|AEB40012.1| NADH dehydrogenase subunit 3 [Funaria hygrometrica]
          Length = 118

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 71/117 (60%), Positives = 89/117 (76%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFC 64
            +API V++ I+  + ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF 
Sbjct: 2   EFAPICVYLVISLLLSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLE+ FLFPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 62  LVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|330503271|ref|YP_004380140.1| NADH dehydrogenase subunit A [Pseudomonas mendocina NK-01]
 gi|328917557|gb|AEB58388.1| NADH dehydrogenase subunit A [Pseudomonas mendocina NK-01]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 61/116 (52%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++      VF+     ++  ++    ++  K+    K   +E G  P   AR++   +F 
Sbjct: 8   MSHNWAFAVFLLGVCGLIAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LFVIFD+E  +LF WAV  ++  W G     VF+ IL  G +Y W+ GAL+W
Sbjct: 68  LVAMLFVIFDVEALYLFAWAVSVRESGWAGLIEATVFIAILLAGLVYLWRIGALDW 123


>gi|109156447|ref|YP_654279.1| NADH dehydrogenase subunit 3 [Pseudopterogorgia bipinnata]
 gi|108513892|gb|ABF93175.1| NADH dehydrogenase subunit 3 [Pseudopterogorgia bipinnata]
          Length = 117

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 83/115 (72%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +K +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYKGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|1046292|gb|AAA80308.1| NADH dehydrogenase chain 3 [Petunia axillaris subsp. parodii]
 gi|1046302|gb|AAB82731.1| NADH dehydrogenase chain 3 [Petunia x hybrida]
 gi|1256947|gb|AAA96603.1| NADH dehydrogenase subunit 3 [Petunia axillaris subsp. parodii]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+ +  S   PEK S YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKFSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|28870529|ref|NP_793148.1| NADH dehydrogenase I subunit A [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|66046426|ref|YP_236267.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. syringae
           B728a]
 gi|71734591|ref|YP_275279.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|213970035|ref|ZP_03398167.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tomato T1]
 gi|289625426|ref|ZP_06458380.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649291|ref|ZP_06480634.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298487548|ref|ZP_07005590.1| NADH ubiquinone oxidoreductase chain A [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381390|ref|ZP_07229808.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062161|ref|ZP_07253702.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tomato K40]
 gi|302130362|ref|ZP_07256352.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302185023|ref|ZP_07261696.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. syringae
           642]
 gi|81308097|sp|Q4ZRJ3|NUOA_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|81730556|sp|Q87ZQ9|NUOA_PSESM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|123635951|sp|Q48H54|NUOA_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|28853777|gb|AAO56843.1| NADH dehydrogenase I, A subunit [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|63257133|gb|AAY38229.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Pseudomonas
           syringae pv. syringae B728a]
 gi|71555144|gb|AAZ34355.1| NADH-quinone oxidoreductase, A subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213925139|gb|EEB58702.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. tomato T1]
 gi|298157932|gb|EFH99010.1| NADH ubiquinone oxidoreductase chain A [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320323788|gb|EFW79872.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327927|gb|EFW83932.1| NADH dehydrogenase subunit A [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330866838|gb|EGH01547.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330875773|gb|EGH09922.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330881188|gb|EGH15337.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889660|gb|EGH22321.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330954563|gb|EGH54823.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae Cit
           7]
 gi|330958159|gb|EGH58419.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330965591|gb|EGH65851.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330972907|gb|EGH72973.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330981371|gb|EGH79474.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330987942|gb|EGH86045.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331017271|gb|EGH97327.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y W+ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDW 123


>gi|292492189|ref|YP_003527628.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
 gi|291580784|gb|ADE15241.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nitrosococcus
           halophilus Nc4]
          Length = 134

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 71/115 (61%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T + P +++  I  A+V  ++   +I+  +  +      +E G  P D AR++F  +F L
Sbjct: 7   TEFWPFVLYAGIVLALVAGILGLSYILGQRHGEKATGEPFESGIVPVDFARLRFSAKFYL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           V+VLFVIFD+E  F+F WAV F++  W+G+G  + F+ IL V  IYEW+ GAL+W
Sbjct: 67  VAVLFVIFDMEAVFIFAWAVAFRETGWIGYGGALTFIAILVVALIYEWRVGALDW 121


>gi|156741309|ref|YP_001431438.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
 gi|156232637|gb|ABU57420.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Roseiflexus
           castenholzii DSM 13941]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y PIL    +A  I + +++    +  + P+  KL  YE G +P   A+ +F I+F
Sbjct: 1   MLIDYLPILTLFLVAMFIAVFVIVLSRYLGPQRPNRRKLMPYESGMEPIGPAQRRFPIKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+EI FLFP+A+ ++Q+   G   M VF  +L +G +YEW++GAL W+
Sbjct: 61  NLVAMLFILFDIEIIFLFPYALVYRQLGVPGLAVMGVFFVVLVIGLVYEWRRGALRWE 118


>gi|20385855|gb|AAM21471.1|AF395896_1 NADH dehydrogenase subunit 3 [Pisum sativum]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++ +  PF+ A  S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MPEFAPICIYLVISPLVSLIPLGVPFLFASNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|311897890|dbj|BAJ30298.1| putative NADH-quinone oxidoreductase subunit A [Kitasatospora setae
           KM-6054]
          Length = 119

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  AIA+A  +  ++   +   K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGAIAAAFAVGSVVMASLTGPKRYNRAKLEAYECGIEPTPQPVGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVSFDALGIFGLVEMLLFIATVFVAYAYVWRRGGLEWD 119


>gi|169629220|ref|YP_001702869.1| NADH dehydrogenase subunit A [Mycobacterium abscessus ATCC 19977]
 gi|169241187|emb|CAM62215.1| NADH-quinone oxidoreductase, A subunit NuoA [Mycobacterium
           abscessus]
          Length = 128

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 11/128 (8%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------- 55
           + +Y PILV  AIA    +  +     V  +  +  KL  YECG +    +         
Sbjct: 1   MDAYVPILVLGAIAVVFAVFSVGVSSFVGPRRYNRAKLEAYECGIEATQHSMGRDHHGAA 60

Query: 56  --RVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEW 113
               +  +++ L ++LF+IFD+EI FL+PWAV+F  +   G  +M +F+  ++V + YEW
Sbjct: 61  AGGHRVPVKYYLTAMLFIIFDIEIVFLYPWAVHFDALGVFGLLAMALFIVNVSVAYAYEW 120

Query: 114 KKGALEWD 121
           ++G L WD
Sbjct: 121 RRGGLSWD 128


>gi|297531556|ref|YP_003672831.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. C56-T3]
 gi|297254808|gb|ADI28254.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. C56-T3]
          Length = 122

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 68/115 (59%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            SY  I VF+ +   + I  + +   +    P   K +TYE G +PF D+RV+F +R+ L
Sbjct: 7   NSYLIIFVFLCLGVLLPIGALTAGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV + Q+       M++F+ +L +G IY WKK  L W
Sbjct: 67  FALLFVIFDIETVFLYPWAVVYDQLGLFALVEMIMFIVLLAIGLIYAWKKKVLRW 121


>gi|57239037|ref|YP_180173.1| NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161116|emb|CAH58027.1| putative NADH-quinone oxidoreductase chain A [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 123

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y PIL+F+ IA  I  +  + P ++A ++PD  KLS+YECGF P  ++R  F+IRF 
Sbjct: 7   ITEYLPILIFLGIAGFISFLFSVLPMLLASRNPDSSKLSSYECGFSPLGNSRKIFNIRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLEIAFLFPW++    I   GF SMM+FL IL +GFIYEW KGALEW+
Sbjct: 67  LVAILFIIFDLEIAFLFPWSICLSDIGIGGFWSMMIFLVILIIGFIYEWSKGALEWE 123


>gi|311033319|ref|ZP_07711409.1| NADH dehydrogenase subunit A [Bacillus sp. m3-13]
          Length = 124

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 74/115 (64%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y  ++VF+A+   + +V +    ++    P   K +TYE G DPF D+RV+F++R+ +
Sbjct: 9   NNYLIVVVFLALGVLLPVVALAIGRVLRPNKPSAAKQTTYESGIDPFHDSRVQFNVRYYI 68

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV ++++       M++F+ +L +G IY WKK  L+W
Sbjct: 69  FALLFVIFDVETVFLYPWAVAYEKLGIFALIEMLIFVVLLLIGLIYAWKKKVLKW 123


>gi|109156427|ref|YP_654313.1| NADH dehydrogenase subunit 3 [Ricordea florida]
 gi|108515297|gb|ABF93394.1| NADH dehydrogenase subunit 3 [Ricordea florida]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 75/118 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  +   +  +  +      + + +  K PD EK+S YECGF+PF      F +RF
Sbjct: 1   MNIEFYSLFFLLIFSVILSAFFSGASYFLGVKQPDREKVSAYECGFEPFGVPGRPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI+ LGF  M+VFLGILT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVIYNQISPLGFWIMVVFLGILTLGLIYEWIKGGLEWE 118


>gi|138896933|ref|YP_001127386.1| NADH dehydrogenase subunit A [Geobacillus thermodenitrificans
           NG80-2]
 gi|196249750|ref|ZP_03148446.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. G11MC16]
 gi|223635464|sp|A4ITI7|NUOA_GEOTN RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|134268446|gb|ABO68641.1| NADH-quinone oxidoreductase chain A [Geobacillus
           thermodenitrificans NG80-2]
 gi|196210626|gb|EDY05389.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. G11MC16]
          Length = 122

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 67/115 (58%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            SY  + VF+ +   + I  +     +    PD  K +TYE G  PF D+R++F +R+ L
Sbjct: 7   NSYLIVFVFLCLGVLLPIGALTIGRWLRPNVPDEAKATTYESGNIPFHDSRIQFQVRYYL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV + Q+       M++F+ +L +G IY WKK  L W
Sbjct: 67  FALLFVIFDVETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRW 121


>gi|262376777|ref|ZP_06070005.1| NADH dehydrogenase subunit I A [Acinetobacter lwoffii SH145]
 gi|262308487|gb|EEY89622.1| NADH dehydrogenase subunit I A [Acinetobacter lwoffii SH145]
          Length = 181

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 66/120 (55%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +      I+ F+   + + + ++  P ++  KS    K   +E G      AR++  
Sbjct: 1   MSAITPYEWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +F LV++ FV+FDLE  +L+ WAV  +++ W+GF +  +F+ +L VG IYE   GAL W
Sbjct: 61  AKFYLVAIFFVVFDLEALYLYAWAVSVREVGWIGFATAAIFIIVLLVGLIYELSTGALNW 120


>gi|312200067|ref|YP_004020128.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia sp.
           EuI1c]
 gi|311231403|gb|ADP84258.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia sp.
           EuI1c]
          Length = 120

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 47/120 (39%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +L++Y PILV +AIA+A     ++   +V  K  +  KL  YECG +P   A    +F +
Sbjct: 1   MLSNYVPILVLIAIATAFAGGSIVISMLVGPKRFNRAKLDAYECGIEPEPQAAGPRRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +F L+++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  KFYLIAMLFIVFDIEIIFLYPWAVAFGGLGVFGLVEMVLFVATVFVAYAYVWRRGGLEWD 120


>gi|237800545|ref|ZP_04589006.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331023405|gb|EGI03462.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y W+ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFAEALVFIAILLAGLVYLWRVGALDW 123


>gi|323649905|ref|YP_004237278.1| NADH dehydrogenase subunit 3 [Ricinus communis]
 gi|322394285|gb|ADW96042.1| NADH dehydrogenase subunit 3 [Ricinus communis]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ I+  + ++ +  PF   +  S  PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFSPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   GF SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIILDPEVTFFFPWAVPPNKIDLFGFWSMMAFLLILTIGSLYEWKRGA 114


>gi|26990813|ref|NP_746238.1| NADH dehydrogenase subunit A [Pseudomonas putida KT2440]
 gi|148546984|ref|YP_001267086.1| NADH dehydrogenase subunit A [Pseudomonas putida F1]
 gi|167034687|ref|YP_001669918.1| NADH dehydrogenase subunit A [Pseudomonas putida GB-1]
 gi|170721057|ref|YP_001748745.1| NADH dehydrogenase subunit A [Pseudomonas putida W619]
 gi|325277478|ref|ZP_08143083.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas sp. TJI-51]
 gi|81733278|sp|Q88FH7|NUOA_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635476|sp|A5W192|NUOA_PSEP1 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635477|sp|B0KMX8|NUOA_PSEPG RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|223635478|sp|B1J6N4|NUOA_PSEPW RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|24985819|gb|AAN69702.1|AE016606_5 NADH dehydrogenase I, A subunit [Pseudomonas putida KT2440]
 gi|148511042|gb|ABQ77902.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Pseudomonas
           putida F1]
 gi|166861175|gb|ABY99582.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pseudomonas
           putida GB-1]
 gi|169759060|gb|ACA72376.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pseudomonas
           putida W619]
 gi|313498031|gb|ADR59397.1| NuoA [Pseudomonas putida BIRD-1]
 gi|324097394|gb|EGB95635.1| NADH:ubiquinone oxidoreductase subunit A [Pseudomonas sp. TJI-51]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 62/117 (52%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   +F
Sbjct: 7   LIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKF 66

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y W+ GAL+W
Sbjct: 67  YLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDW 123


>gi|320160239|ref|YP_004173463.1| NADH-quinone oxidoreductase subunit A [Anaerolinea thermophila
           UNI-1]
 gi|319994092|dbj|BAJ62863.1| NADH-quinone oxidoreductase chain A [Anaerolinea thermophila UNI-1]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/118 (37%), Positives = 71/118 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y P++V +  A  +  +++    +   K P  +K   YE G  P+   + +  +R+
Sbjct: 1   MLTDYFPLVVIIVFAVILAFLVVALGHLFGPKRPSEKKSMPYESGMVPYGPGQRRMTVRY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L++VLF++FD+E+ F  PWAV F+ +   GF  M+VF+ IL V  +Y WKKGALEW+
Sbjct: 61  YLIAVLFILFDIEVVFFLPWAVAFRDLGLPGFLLMVVFVVILEVAHLYAWKKGALEWE 118


>gi|227535971|ref|ZP_03966020.1| NADH dehydrogenase (quinone) [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300771677|ref|ZP_07081552.1| NADH dehydrogenase (quinone) subunit A [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|227244214|gb|EEI94229.1| NADH dehydrogenase (quinone) [Sphingobacterium spiritivorum ATCC
           33300]
 gi|300761666|gb|EFK58487.1| NADH dehydrogenase (quinone) subunit A [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 126

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 72/115 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y PIL+ + +A +  +  +I   ++  K     KLS++E G +   +AR  F I++ LV
Sbjct: 12  DYLPILIQLLVAVSFGVGTIIITHMIGPKVRTENKLSSFESGVEVKGNARQPFSIKYFLV 71

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+E+ F++PWAV F+     G   M VF+G+L +GFIY  KK AL+WD
Sbjct: 72  AILFVIFDIEVIFMYPWAVNFRSFGMQGLIEMFVFMGLLLLGFIYIIKKKALDWD 126


>gi|164420803|ref|YP_001648471.1| NADH dehydrogenase subunit 3 [Ephydatia muelleri]
 gi|158938919|gb|ABW83847.1| NADH dehydrogenase subunit 3 [Ephydatia muelleri]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 78/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+  + +IV  K PD EK+S YECGFDPF+ +R+ F +RF
Sbjct: 1   MSAEFLSIFILLLFSIILSTVISGASYIVGVKQPDSEKVSVYECGFDPFESSRIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V + QI   GF +M  FL ILTVG IYEW KG L W+
Sbjct: 61  FLVGILFMIFDLEISFLFPWCVVYNQIGLFGFWTMYFFLVILTVGLIYEWIKGGLGWE 118


>gi|124484828|ref|YP_001031210.1| NADH dehydrogenase subunit 3 [Amphimedon queenslandica]
 gi|113952600|gb|ABI48999.1| NADH dehydrogenase subunit 3 [Amphimedon queenslandica]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   Y  ++  +  +  +  ++    +++  + PD EK+S YECGFDPF+ AR+ F +RF
Sbjct: 1   MNGDYMGVVSLILFSVVLSTIISGGSYVMGVRHPDSEKVSVYECGFDPFESARIPFSVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF+IFDLEI+++FPW V +  I   GF  MM+FL ILT G IYEW +G LEW
Sbjct: 61  FLVGILFMIFDLEISYIFPWGVAYSHIGLYGFWIMMLFLVILTGGLIYEWAQGGLEW 117


>gi|115278543|ref|YP_762328.1| NADH dehydrogenase subunit 3 [Sorghum bicolor]
 gi|1839016|emb|CAB06623.1| mitochondrial nad3 [Sorghum bicolor]
 gi|114309664|gb|ABI60881.1| NADH dehydrogenase subunit 3 [Sorghum bicolor]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|148653496|ref|YP_001280589.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Psychrobacter sp. PRwf-1]
 gi|223635479|sp|A5WG48|NUOA_PSYWF RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|148572580|gb|ABQ94639.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Psychrobacter sp. PRwf-1]
          Length = 211

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 65/112 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              L F+  A  +VI +++ P ++  +S   EK   +E G     +AR++   +F LV++
Sbjct: 7   WSALAFILAAIGLVIFMLVVPRLLGGRSQGTEKEEVFESGVVGAGNARIRLSAKFYLVAI 66

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            FVIFDLE  +L+ ++V  +++ W+G+ + ++F+  L +G IY    GAL W
Sbjct: 67  FFVIFDLEALYLYAYSVSVREVGWIGYATALIFVVDLLIGLIYALSLGALNW 118


>gi|113955198|ref|YP_729478.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9311]
 gi|113882549|gb|ABI47507.1| NADH dehydrogenase I chain 3 (or A) [Synechococcus sp. CC9311]
          Length = 142

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 25  VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRY 84

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 85  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEW 141


>gi|317097126|ref|YP_004123258.1| NADH dehydrogenase subunit 3 [Plakina jani]
 gi|308912727|gb|ADO51485.1| NADH dehydrogenase subunit 3 [Plakina jani]
          Length = 122

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + I+  +  ++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCISIGLSFIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQISLFGYWTMIIFLIILTLGLVYEWIKGGLEWE 122


>gi|307131814|ref|YP_003883830.1| NADH:ubiquinone oxidoreductase membrane subunit A [Dickeya dadantii
           3937]
 gi|306529343|gb|ADM99273.1| NADH:ubiquinone oxidoreductase, membrane subunit A [Dickeya
           dadantii 3937]
          Length = 147

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ +A  +   +++  F++  ++    K   YE G D    AR++   
Sbjct: 5   TEVLAHHWAFALFVIVAVGLCGFMLLGGFLLGGRARARHKNIPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G IY  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSIRESGWIGFVEATIFILVLLAGLIYLVRIGALDW 123


>gi|91208869|ref|YP_539030.1| NADH dehydrogenase subunit 3 [Physcomitrella patens]
 gi|90991409|dbj|BAE93101.1| NADH dehydrogenase subunit 3 [Physcomitrella patens]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 88/117 (75%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFC 64
            +API V++ I+  + ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF 
Sbjct: 2   EFAPICVYLVISLLLSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLE+ F FPWAV   +I   GF SM+VFL ILT+GF+YEWKKGAL+W+
Sbjct: 62  LVSILFIIFDLEVTFSFPWAVSLNKIGLFGFWSMIVFLLILTIGFLYEWKKGALDWE 118


>gi|242239968|ref|YP_002988149.1| NADH dehydrogenase subunit A [Dickeya dadantii Ech703]
 gi|242132025|gb|ACS86327.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dickeya
           dadantii Ech703]
          Length = 147

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 68/119 (57%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ +A  +   +++  F++  ++    K   YE G D    AR++   
Sbjct: 5   TEVLAHHWAFALFIVVAVGLCGFMLLGGFLLGGRARARHKNIPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ WAV  K+  W+GF   ++F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWAVSIKESGWVGFVEAVIFILVLLAGLVYLVRIGALDW 123


>gi|290475917|ref|YP_003468812.1| NADH dehydrogenase I subunit A [Xenorhabdus bovienii SS-2004]
 gi|289175245|emb|CBJ82048.1| NADH dehydrogenase I chain A [Xenorhabdus bovienii SS-2004]
          Length = 147

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + +   +    VF+  A  +  ++++  + +  +S    K   YE G D    AR++   
Sbjct: 5   TGVFAHHWAFAVFLLGAFGLCALMLLGAYFLGGRSKGRAKHIPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  K+  WLGF    +F+ +L  G +Y  + GAL W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSIKESGWLGFAEASIFILVLLAGLVYLARIGALNW 123


>gi|93005403|ref|YP_579840.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Psychrobacter cryohalolentis K5]
 gi|122415843|sp|Q1QD97|NUOA_PSYCK RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|92393081|gb|ABE74356.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Psychrobacter cryohalolentis K5]
          Length = 207

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 65/112 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              + F+  A  +V+ +++ P ++  +S   +K   +E G     +AR++   +F LV++
Sbjct: 6   LSAIAFILAAIGLVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKFYLVAI 65

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            FVIFDLE  +L+ +AV  ++  WLGF +  +F+ IL +G +YE   GA+ W
Sbjct: 66  FFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNW 117


>gi|164421122|ref|YP_001648417.1| NADH dehydrogenase subunit 3 [Cinachyrella kuekenthali]
 gi|158938904|gb|ABW83833.1| NADH dehydrogenase subunit 3 [Cinachyrella kuekenthali]
          Length = 119

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 74/118 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I   +  +  +  V+  + ++V  K PD EK+S YECGFDP   +R  F ++F
Sbjct: 2   MDVEFLEIFYLILFSVTLSTVVSGASYLVGIKQPDSEKVSVYECGFDPLGSSRTPFSVKF 61

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF++FDLEI+FLFPW V + QI   G   M +FL ILT+G IYEW KG LEW+
Sbjct: 62  FLVGILFLVFDLEISFLFPWCVIYNQIGLXGVWMMYLFLVILTIGLIYEWVKGGLEWE 119


>gi|11467815|ref|NP_050866.1| NADH dehydrogenase subunit 3 [Nephroselmis olivacea]
 gi|17433147|sp|Q9TKX9|NU3C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|5880744|gb|AAD54837.1|AF137379_60 subunit 3 of NADH-plastoquinoneoxidoreductase [Nephroselmis
           olivacea]
          Length = 120

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F  IAS I ++ + +  ++  +   PE+ +TYE G +P  +A ++F+IR+
Sbjct: 3   ILEGYGSVLAFFVIASLIPVIALSASKLLRPRGGGPERRTTYESGIEPMGEAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F+++    F  +++F+ +L +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETLFLYPWAVTFQRLGLSAFFEVLIFIIVLLIGLVYAWRKGALEW 119


>gi|312139309|ref|YP_004006645.1| NADH dehydrogenase (quinone) chain a nuoa [Rhodococcus equi 103S]
 gi|325673385|ref|ZP_08153076.1| NADH-quinone oxidoreductase subunit A [Rhodococcus equi ATCC 33707]
 gi|311888648|emb|CBH47960.1| NADH dehydrogenase (quinone) chain A NuoA [Rhodococcus equi 103S]
 gi|325555406|gb|EGD25077.1| NADH-quinone oxidoreductase subunit A [Rhodococcus equi ATCC 33707]
          Length = 122

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 5/122 (4%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDAR-----VKF 59
           + +Y PILV  AIA A  +  +     V     +  KL  YECG +P           + 
Sbjct: 1   MNAYVPILVLGAIAVAFAVFSVFVASAVGPARRNRAKLEAYECGIEPMQQPGGRAGGQRI 60

Query: 60  DIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            +++ L ++LF+IFD+EI FL+PWAV+F  +   G  +M VF+  ++V ++YEW++G L 
Sbjct: 61  PVKYYLTAMLFIIFDIEIVFLYPWAVHFDALGVFGLAAMAVFVFNVSVAYVYEWRRGGLS 120

Query: 120 WD 121
           WD
Sbjct: 121 WD 122


>gi|251789014|ref|YP_003003735.1| NADH dehydrogenase subunit A [Dickeya zeae Ech1591]
 gi|247537635|gb|ACT06256.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dickeya zeae
           Ech1591]
          Length = 147

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 67/119 (56%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ +A  +   +++  F++  ++    K   YE G D    AR++   
Sbjct: 5   TEVLAHHWAFALFVIVAVGLCGFMLLGGFLLGGRARARHKNIPYESGIDSVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSIRESGWIGFVEATIFILVLLAGLVYLVRIGALDW 123


>gi|320529349|ref|ZP_08030437.1| NADH dehydrogenase subunit A [Selenomonas artemidis F0399]
 gi|320138315|gb|EFW30209.1| NADH dehydrogenase subunit A [Selenomonas artemidis F0399]
          Length = 117

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 67/116 (57%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  + VF+ +A A  ++ +   F++  + P P+K   YECG DP     V+F   + 
Sbjct: 1   MGEYGSLGVFLLVALAFPVMALGPAFLLQPRRPSPQKYIPYECGVDPVGSPYVQFRAGYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           L ++LF++FD+E  FL+PWAV F+ +       M VF+GIL +G  Y W+KG L W
Sbjct: 61  LYALLFIVFDIETVFLYPWAVEFRMLGVFALIEMFVFVGILALGLGYAWRKGDLTW 116


>gi|312796902|ref|YP_004029824.1| NADH-quinone oxidoreductase chain A [Burkholderia rhizoxinica HKI
           454]
 gi|312168677|emb|CBW75680.1| NADH-quinone oxidoreductase chain A (EC 1.6.5.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 119

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +   + I L+    ++    PD +K S YECGF+ F+DAR+KFD+R+ 
Sbjct: 3   LAAYFPVLLFLLVGLGLGIALVSIGKLLGPNKPDSDKNSPYECGFEAFEDARMKFDVRYY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV++LF+IFDLE AFLFPW V  + I W GF +MM+FL    +GF Y WK+G L W+
Sbjct: 63  LVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKRGGLNWE 119


>gi|773393|emb|CAA60117.1| NADH dehydrogenase subunit 3 [Pinus sylvestris]
          Length = 118

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+S + ++ +  PF  A   S  PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISSLVCLIPLGVPFPFAPNGSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V + F+I D E+ F  P AV   +I   G  SMMVF  I T+GF +EWKKGA
Sbjct: 61  YPVPISFIISDPEVTFSSPRAVPLNKIDPFGSRSMMVFSLISTIGFPHEWKKGA 114


>gi|332830188|gb|EGK02816.1| hypothetical protein HMPREF9455_01066 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 122

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 49/121 (40%), Positives = 76/121 (62%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS  L  + PIL+ +A +   V   +++  ++  K  +  K + +ECG DP  +AR  F 
Sbjct: 1   MSSNLYDFLPILMQIAFSVVFVFATVLASNMLGPKRKNARKQANFECGLDPIGNARSPFP 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           I++ LV++LFV+FD+EI F++PWAV FK I W G   M  F+ +L VG++Y  K+ ALEW
Sbjct: 61  IKYFLVAILFVLFDIEIVFMYPWAVNFKAIGWDGLLKMGGFIALLLVGYLYIVKRKALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|22653466|gb|AAN04077.1| NADH dehydrogenase subunit 3 [Amoebidium parasiticum]
          Length = 122

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 87/115 (75%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PI+  + ++ AI +VL+I+ + +A +SPDPEK+S YECGF P+ DAR KF++RF L
Sbjct: 7   NQYLPIVWLIVVSIAIAVVLVIASYFLAVQSPDPEKVSAYECGFQPYSDAREKFEVRFFL 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           V++LF++FDLEI  L P+A+   QI+ +GF ++ +F+ +LT+G ++EW+ GALEW
Sbjct: 67  VAILFILFDLEITLLVPFALVINQISLMGFWNVWLFVILLTLGLVFEWRSGALEW 121


>gi|255318316|ref|ZP_05359551.1| NADH dehydrogenase i chain a [Acinetobacter radioresistens SK82]
 gi|262379060|ref|ZP_06072216.1| NADH dehydrogenase subunit I A [Acinetobacter radioresistens SH164]
 gi|255304628|gb|EET83810.1| NADH dehydrogenase i chain a [Acinetobacter radioresistens SK82]
 gi|262298517|gb|EEY86430.1| NADH dehydrogenase subunit I A [Acinetobacter radioresistens SH164]
          Length = 183

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 65/120 (54%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS +      I+ F+   + + + ++  P ++  KS    K   +E G      AR++  
Sbjct: 1   MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +F LV++ FV+FDLE  +L+ WA   +++ W+GF +  VF+ +L VG IYE   GAL W
Sbjct: 61  AKFYLVAIFFVVFDLEALYLYAWASSVREVGWIGFATAAVFILVLLVGLIYEMSTGALNW 120


>gi|1518341|emb|CAA89848.1| NADH dehydrogenase subunit 3 [Allium cepa]
 gi|12584573|emb|CAA58989.1| NADH dehydrogenase subunit 3 [Allium cepa]
          Length = 118

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 52/114 (45%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ ++  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVMSPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LV +LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVPILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|16330875|ref|NP_441603.1| NADH dehydrogenase subunit A [Synechocystis sp. PCC 6803]
 gi|128691|sp|P19045|NU3C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|581791|emb|CAA35484.1| unnamed protein product [Synechocystis sp. PCC 6803]
 gi|1653369|dbj|BAA18283.1| NADH dehydrogenase subunit 3 [Synechocystis sp. PCC 6803]
          Length = 120

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT Y   L F+ I S + ++ + +  ++  +   PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLTGYEYFLGFLFICSLVPVLALTASKLLRPRDGGPERQTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEW 119


>gi|255533963|ref|YP_003094335.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pedobacter
           heparinus DSM 2366]
 gi|255346947|gb|ACU06273.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Pedobacter
           heparinus DSM 2366]
          Length = 123

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 71/115 (61%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            + PI+  + +A   V+  +I+  ++       +KL T+E G     +AR  F I++ LV
Sbjct: 9   DFLPIIFQVVVALGFVVTTLIATHLLGPSRKTKDKLETFEAGIKTIGNARQPFSIKYFLV 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+E+ F++PWAV F+++   G   M VF+G L +GFIY  KK AL+W+
Sbjct: 69  AILFVLFDVEVIFMYPWAVNFRELGMTGMIEMFVFMGTLLLGFIYVLKKKALDWN 123


>gi|171187531|gb|ACB41369.1| NADH dehydrogenase subunit A [Mimulus guttatus]
          Length = 114

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PIL+++ I+S + ++ +  PF   +  S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFSPILIYLVISSLVSLIPLGVPFPFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|167463141|ref|ZP_02328230.1| NADH dehydrogenase subunit A [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383098|ref|ZP_08056925.1| hypothetical protein PL1_1947 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152760|gb|EFX45386.1| hypothetical protein PL1_1947 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 121

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 69/116 (59%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
           T Y  + +F+ +   + I  +     +    P  EK +TYE G +P  + +++F+IR+ L
Sbjct: 4   TKYVIVAIFVGLGILLPITALTLGKWLRPHKPVQEKYTTYESGNEPVGEGQIRFNIRYYL 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +++F++FD+E  FL+PWAV +K++       M +F+ +L VG +Y WKK  L+W+
Sbjct: 64  FALMFIVFDVETVFLYPWAVAYKKLGLFALVEMCIFVAMLAVGLLYAWKKKVLKWN 119


>gi|15597833|ref|NP_251327.1| NADH dehydrogenase subunit A [Pseudomonas aeruginosa PAO1]
 gi|116050624|ref|YP_790557.1| NADH dehydrogenase subunit A [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891202|ref|YP_002440068.1| NADH dehydrogenase subunit A [Pseudomonas aeruginosa LESB58]
 gi|254235622|ref|ZP_04928945.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa C3719]
 gi|254241069|ref|ZP_04934391.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa 2192]
 gi|296388902|ref|ZP_06878377.1| NADH dehydrogenase subunit A [Pseudomonas aeruginosa PAb1]
 gi|313107675|ref|ZP_07793857.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa 39016]
 gi|81783695|sp|Q9I0K1|NUOA2_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|122259747|sp|Q02NC9|NUOA1_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|9948705|gb|AAG06025.1|AE004692_4 NADH dehydrogenase I chain A [Pseudomonas aeruginosa PAO1]
 gi|115585845|gb|ABJ11860.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167553|gb|EAZ53064.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa C3719]
 gi|126194447|gb|EAZ58510.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa 2192]
 gi|218771427|emb|CAW27194.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa LESB58]
 gi|310880359|gb|EFQ38953.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa 39016]
          Length = 137

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 62/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++L   +     F+     ++  ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   AELAAHHWGFAAFLLGVVGLLAFMLGVSSLLGSKAFGRSKNEPFESGIVPTGGARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W G     +F+ IL  G +Y W+ GAL+W
Sbjct: 65  KFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGALDW 123


>gi|323702664|ref|ZP_08114325.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532327|gb|EGB22205.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfotomaculum nigrificans DSM 574]
          Length = 117

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 66/116 (56%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ +  + VFM +        +++ F++  +S +  K   YECG        V+F  ++ 
Sbjct: 1   MSEWVGVAVFMVVGILFGAGGILTSFLIHPRSKNRFKEEPYECGLPTEGPTWVQFKNQYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             +++FVIFD+E+ +L+PWAV FK +   G   M +F+ IL +G  Y WK+GALEW
Sbjct: 61  TYALMFVIFDVEVIYLYPWAVTFKGLGLAGLIKMFIFIFILVLGLWYAWKEGALEW 116


>gi|152984906|ref|YP_001347934.1| NADH dehydrogenase subunit A [Pseudomonas aeruginosa PA7]
 gi|223635400|sp|A6V4E9|NUOA1_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|150960064|gb|ABR82089.1| NADH dehydrogenase I chain A [Pseudomonas aeruginosa PA7]
          Length = 137

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 62/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++L   +     F+     ++  ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   AELAAHHWGFAAFLLGVVGLLAFMLGVSALLGSKAFGRSKNEPFESGIVPTGGARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W G     +F+ IL  G +Y W+ GAL+W
Sbjct: 65  KFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGALDW 123


>gi|108773216|ref|YP_635743.1| NADH dehydrogenase subunit 3 [Chara vulgaris]
 gi|122177817|sp|Q1ACK4|NU3C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|77157872|gb|ABA61913.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chara vulgaris]
          Length = 120

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 71/116 (61%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y  +  F+ IAS + I+      I+A     PEKL++YE G +P   A ++F IR+ 
Sbjct: 4   LQEYDYLWFFLVIASIVPILAFTISEILAPIRSGPEKLTSYESGIEPKGQAWIQFHIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 64  MFALVFVVFDVETVFLYPWAISFHSLGISAFIEALLFILILMVGLVYAWRKGALEW 119


>gi|11466607|ref|NP_066497.1| NADH dehydrogenase subunit 3 [Rhodomonas salina]
 gi|10444194|gb|AAG17768.1|AF288090_44 NADH dehydrogenase subunit 3 [Rhodomonas salina]
          Length = 121

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 58/121 (47%), Positives = 83/121 (68%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+  L+ +  + ++  I   +  +  I  +++  K    EKLS YECGFDPFD+AR  FD
Sbjct: 1   MTLYLSQFFSLFIYFFICFLLAFIFFILSYVLGPKKIYIEKLSAYECGFDPFDNARNTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF++FDLE++FLFPW +   +     + SM++FL ILTVGFIYEWKKGAL+W
Sbjct: 61  IRFYLVAILFIVFDLEVSFLFPWCLVISKSCLFSYWSMVIFLVILTVGFIYEWKKGALDW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|254424329|ref|ZP_05038047.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Synechococcus sp. PCC 7335]
 gi|196191818|gb|EDX86782.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Synechococcus sp. PCC 7335]
          Length = 120

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ I+S + +V + +  ++   S  P   +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYFLGFLIISSLVPVVALGASKLLRPASAGPASRTTYESGCEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F  +  L F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHTLGLLAFVEALIFIAILVVGLVYAWRKGALEW 119


>gi|124112059|ref|YP_001019119.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chlorokybus
           atmophyticus]
 gi|223635365|sp|A2CI37|NU3C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|124012175|gb|ABM87957.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chlorokybus
           atmophyticus]
          Length = 120

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   LVF+ IA  I ++ + +  +V  K   PEK +TYE G +P  +A V+F+IR+
Sbjct: 3   ILKGYDSFLVFLIIACLIPVLALSASKLVRPKFGGPEKYTTYESGIEPMGEAWVQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F Q+ ++ F   +VFL IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVSFAQMGFISFLEALVFLSILIVGLVYAWRKGALEW 119


>gi|237748891|ref|ZP_04579371.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes OXCC13]
 gi|229380253|gb|EEO30344.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes OXCC13]
          Length = 119

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 79/117 (67%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +A    +  +    I+A   PD EK S YECG  PFDDAR+KFD+RF 
Sbjct: 3   LENYFPVLLFLLVALFFGVFSLFLGRILAPHRPDAEKNSPYECGIAPFDDARMKFDVRFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPWA   K + W  F ++M+FL  L  GF Y WKKGAL W+
Sbjct: 63  LIAILFILFDLETAFLFPWASAMKDLGWEAFVAIMIFLAELVAGFWYIWKKGALNWE 119


>gi|284009320|emb|CBA76479.1| NADH-quinone oxidoreductase chain A [Arsenophonus nasoniae]
          Length = 146

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 63/118 (53%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           ++   +    +++  A  +  ++++  + +  +S    K   YE G +    AR++   +
Sbjct: 6   EVFAHHWAFAIYLIGALGLCSLMLLGAYYLGGRSQARAKHIPYESGINSVGSARLRISAK 65

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F LV++ FVIFD+E  FL+ WAV  K+  WLGF    +F+ +L VG  Y  + GAL W
Sbjct: 66  FYLVAMFFVIFDVEALFLYAWAVSIKESGWLGFIEASIFILVLLVGLFYLVRIGALNW 123


>gi|164420979|ref|YP_001648601.1| NADH dehydrogenase subunit 3 [Xestospongia muta]
 gi|158938984|gb|ABW83908.1| NADH dehydrogenase subunit 3 [Xestospongia muta]
          Length = 118

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 57/99 (57%), Positives = 73/99 (73%)

Query: 23  IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFP 82
            V+  + +IV  K PD EK+S YECGFDPF+ +R+ F +RF LV +LF+IFDLEI+FLFP
Sbjct: 20  TVISGASYIVGVKQPDGEKVSVYECGFDPFESSRIPFSVRFFLVGILFMIFDLEISFLFP 79

Query: 83  WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           W V + QI   GF +M+ FL ILT+G IYEW KG LEW+
Sbjct: 80  WCVVYNQIGLFGFWTMIFFLIILTIGLIYEWVKGGLEWE 118


>gi|57639721|gb|AAW55707.1| NADH dehydrogenase subunit 3 [Thuidium recognitum]
          Length = 114

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 67/110 (60%), Positives = 82/110 (74%), Gaps = 2/110 (1%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           PI V++ I+    ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF LVS
Sbjct: 1   PICVYLVISLLFSLILIGVSFLFASSSNSAYPEKLSAYECGFDPFDDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+IFDLE+ FLFPWAV   +I   GF SM+VFL ILT+GF+YEWKKGA
Sbjct: 61  ILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMIVFLSILTIGFLYEWKKGA 110


>gi|57639693|gb|AAW55693.1| NADH dehydrogenase subunit 3 [Laurus nobilis]
          Length = 117

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +API +++ I+  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF 
Sbjct: 1   SEFAPIFIYLVISPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  PVPILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|149280570|ref|ZP_01886686.1| NADH dehydrogenase I chain A [Pedobacter sp. BAL39]
 gi|149228685|gb|EDM34088.1| NADH dehydrogenase I chain A [Pedobacter sp. BAL39]
          Length = 123

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/115 (36%), Positives = 71/115 (61%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            + PI+  + +A   V+V +++   +       +KLST+E G     +AR  F +++ LV
Sbjct: 9   DFLPIIFQVIVALGFVVVTLVATHFLGPTRKTADKLSTFEAGVKVVGNARQPFSVKYFLV 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+E+ F++PWAV F+++   G   M VF+  L +GFIY  KK AL+W+
Sbjct: 69  AILFVLFDVEVIFMYPWAVNFRELGMTGMIEMFVFMATLLLGFIYILKKKALDWN 123


>gi|11467917|ref|NP_057978.1| NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
 gi|8099200|gb|AAF72055.1|AF204057_10 NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
 gi|7271429|emb|CAB77707.1| NADH ubiquinone oxidoreductase subunit 3 [Scenedesmus obliquus]
 gi|7711039|emb|CAB90363.1| NADH dehydrogenase subunit 3 [Scenedesmus obliquus]
          Length = 117

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 81/116 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T Y  +L+++AIA  + IV++   + V  +  D EK + YECGF+PF +AR  FDI F 
Sbjct: 1   MTEYVGVLLYIAIAVGLGIVILFRSYKVRPRRLDLEKATAYECGFEPFGEARSPFDIGFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LF+IFD+E+AFL PW +        GF + ++FL +LT+GF++EW+KGALEW
Sbjct: 61  LVAILFLIFDIEVAFLLPWVLGGISTGSSGFFAFLLFLVVLTIGFVFEWQKGALEW 116


>gi|317097079|ref|YP_004123218.1| NADH dehydrogenase subunit 3 [Plakortis halichondrioides]
 gi|308912712|gb|ADO51471.1| NADH dehydrogenase subunit 3 [Plakortis halichondrioides]
          Length = 122

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + ++  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCVSIGLSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFXVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QIT  G+ +M+ FL  LT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQITLFGYWTMIXFLIXLTLGLVYEWVKGGLEWE 122


>gi|284034169|ref|YP_003384100.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Kribbella
           flavida DSM 17836]
 gi|283813462|gb|ADB35301.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Kribbella
           flavida DSM 17836]
          Length = 119

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PILV   +A+  V   +++  +V  K  +  KL +YECG +P        +F ++
Sbjct: 1   MHPYVPILVLGVLAAIFVAGTLVTSALVGPKRYNRAKLDSYECGIEPTPQPVGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + + ++LF++FD+EI FL+PWAV F Q+   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYITAMLFIVFDIEIIFLYPWAVAFDQMALFGLIEMVIFIATVFVAYAYVWRRGGLEWD 119


>gi|77164636|ref|YP_343161.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Nitrosococcus oceani ATCC 19707]
 gi|254433332|ref|ZP_05046840.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
 gi|123594558|sp|Q3JC15|NUOA_NITOC RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|76882950|gb|ABA57631.1| NADH dehydrogenase subunit A [Nitrosococcus oceani ATCC 19707]
 gi|207089665|gb|EDZ66936.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 superfamily
           [Nitrosococcus oceani AFC27]
          Length = 129

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 70/116 (60%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
            T + P +++  +   +V +++   +I+  +  +      +E G      AR++F  +F 
Sbjct: 3   FTEFWPFILYAGMVLVLVALIVGFSYILGQRPRERATDEPFESGVVTVGFARLRFPAKFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV+VLFVIFD+E AF+F WAV F++  W+G+G  + F+ IL V  IYEW+ GAL+W
Sbjct: 63  LVAVLFVIFDMEAAFIFAWAVAFRETGWIGYGGALAFITILGVALIYEWRVGALDW 118


>gi|313768554|ref|YP_004062228.1| NADH dehydrogenase subunit 3 [Plocamiocolax pulvinata]
 gi|312844681|gb|ADR03244.1| NADH dehydrogenase subunit 3 [Plocamiocolax pulvinata]
          Length = 121

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 84/121 (69%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y  ILVF+ I+  I  ++ + P+ V  K  D EKLS YECGF+PFDDAR  FD
Sbjct: 1   MKLIFTEYFSILVFLLISLLISCIIFLLPYYVIKKKSDQEKLSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           IRF LV++LF+IFDLEI+FLFPW +    I   GF SM+ FL ILT GF YEW KGALEW
Sbjct: 61  IRFYLVAILFLIFDLEISFLFPWVLVLGDILLYGFWSMVFFLIILTFGFFYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|183599636|ref|ZP_02961129.1| hypothetical protein PROSTU_03123 [Providencia stuartii ATCC 25827]
 gi|188021888|gb|EDU59928.1| hypothetical protein PROSTU_03123 [Providencia stuartii ATCC 25827]
          Length = 147

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 61/116 (52%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L       +F   A A+   ++++   +  ++    K   YE G D    AR++   +F 
Sbjct: 8   LAHNWAFTIFFVGAIALCSFMLVAGHFLGSRAKARTKHVPYESGIDSVGSARLRMSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++ FV+FD+E  FLF WAV  +++ WLGF    +F+ +L  G  Y  + GAL+W
Sbjct: 68  LVAMFFVVFDVEAMFLFAWAVAVREVGWLGFIEAAIFILVLLAGLFYLVRVGALDW 123


>gi|107736214|ref|YP_626510.1| NADH dehydrogenase subunit 3 [Briareum asbestinum]
 gi|100913614|gb|ABF69701.1| NADH dehydrogenase subunit 3 [Briareum asbestinum]
          Length = 117

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 81/115 (70%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G +YEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMSLPLFGYWVVMLFLFILTLGLVYEWIEGGLEWE 116


>gi|57639705|gb|AAW55699.1| NADH dehydrogenase subunit 3 [Lonicera sp. Bergthorsson 0301]
          Length = 113

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           + +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDP  DAR +FDIRF 
Sbjct: 1   SEFAPICIYLVISPLVSLIPLGVPFPFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LVSILFIIPDPEVTFSFPWAVPLNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|302553479|ref|ZP_07305821.1| NADH dehydrogenase subunit NuoA2 [Streptomyces viridochromogenes
           DSM 40736]
 gi|302471097|gb|EFL34190.1| NADH dehydrogenase subunit NuoA2 [Streptomyces viridochromogenes
           DSM 40736]
          Length = 152

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 63/121 (52%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +D   SY+ + +  A+    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 31  ADYFQSYSVVGLLAAVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 90

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M +FLG L VG +Y +KKG L 
Sbjct: 91  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGAATLVEMFIFLGFLAVGLLYAYKKGVLA 150

Query: 120 W 120
           W
Sbjct: 151 W 151


>gi|37526977|ref|NP_930321.1| NADH dehydrogenase subunit A [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81707633|sp|Q7N2I7|NUOA_PHOLL RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|36786410|emb|CAE15463.1| NADH dehydrogenase I chain A (NADH-ubiquinone oxidoreductase chain
           A) [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 149

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++L   +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 7   TELFAHHWAFAVFLLGAFGLCALMLLGAFFLGGRAKARAKHVPYESGIDSVGSARLRMSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ W+V  K+  WLGF    +F+ +L  G  Y  + GAL W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWSVSIKESGWLGFIEASIFILVLLAGLFYLVRIGALNW 125


>gi|170079339|ref|YP_001735977.1| NADH dehydrogenase subunit A [Synechococcus sp. PCC 7002]
 gi|75527213|sp|Q8KX40|NU3C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|22652004|gb|AAN03553.1|AF381040_3 NADH dehydrogenase subunit C [Synechococcus sp. PCC 7002]
 gi|169887008|gb|ACB00722.1| NADH dehydrogenase subunit C [Synechococcus sp. PCC 7002]
          Length = 120

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ ++S + I+ + +  ++  K   PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYFLGFLIVSSLVPILALTASKLLRPKGGGPERKTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVIALVYAWRKGALEW 119


>gi|332662313|ref|YP_004445101.1| NAD(P)H-quinone oxidoreductase subunit 3 [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332331127|gb|AEE48228.1| NAD(P)H-quinone oxidoreductase subunit 3 [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 124

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y  IL+ +A+A   V+  MI   ++  K    +K   +ECG +   +AR+ F I++ L 
Sbjct: 6   DYLAILIQLAVALGFVVTTMIVTHLLGPKRHSAQKAEAFECGIESVGNARLPFSIKYFLT 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+E+ F +PWAV FK++   G+  M++F+  L +G++Y  KKGAL W+
Sbjct: 66  AILFVLFDVEVIFFYPWAVNFKELGSSGYLKMLLFIAPLFLGYLYILKKGALNWE 120


>gi|323398668|ref|YP_004222743.1| NADH dehydrogenase subunit 3 [Glaucocystis nostochinearum]
 gi|321401361|gb|ADW83115.1| NADH dehydrogenase subunit 3 [Glaucocystis nostochinearum]
          Length = 123

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 85/116 (73%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y  + ++++I+  + +V+    + VA +  D EK+S YECGF+PFDDAR  FDIRF L
Sbjct: 8   QQYFVLFIYLSISIILSVVIFGLSYFVASQRADSEKVSAYECGFNPFDDARNTFDIRFYL 67

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           VS+LF+IFDLE+AFLFPWA+   +   LGF SM++FL +LT+GF YEW KGALEW+
Sbjct: 68  VSILFIIFDLEVAFLFPWALTLSKTYLLGFWSMIIFLILLTIGFFYEWMKGALEWE 123


>gi|86739251|ref|YP_479651.1| NADH dehydrogenase subunit A [Frankia sp. CcI3]
 gi|86566113|gb|ABD09922.1| NADH dehydrogenase subunit A [Frankia sp. CcI3]
          Length = 120

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +L++Y PILV + IA+   +  + +  ++  +  +  K+  YECG +P        +F +
Sbjct: 1   MLSNYVPILVLLVIAALFAVGSVAAGALIGPRRFNRAKIDAYECGIEPSPAPAGPQRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++   ++LF++FD+EI FLFPWAV F  +   G G+M +F+  + V + YEW++G LEWD
Sbjct: 61  KYYNTAMLFIVFDIEIIFLFPWAVAFDSLAVFGLGAMALFMATIFVAYAYEWRRGGLEWD 120


>gi|57639691|gb|AAW55692.1| NADH dehydrogenase subunit 3 [Eichhornia crassipes]
          Length = 116

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 56/112 (50%), Positives = 75/112 (66%), Gaps = 1/112 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +API +++ I+  + ++ +  PF   +  S  PEKLS +ECG DPF DAR +FDIRF  
Sbjct: 1   EFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPFGDARSRFDIRFYP 60

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           VS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  VSILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 112


>gi|223635449|sp|Q0IDJ4|NU3C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
          Length = 135

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 18  VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRY 77

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 78  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEW 134


>gi|6647624|sp|Q96007|NU3M_ALLCE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1518344|emb|CAA89850.1| NADH dehydrogenase subunit 3 [Allium cepa]
          Length = 118

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ ++PI +++ ++  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MSEFSPIFIYLVMSLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|397898|emb|CAA48360.1| NADH dehydrogenase I, subunit nuoA [Escherichia coli]
          Length = 147

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 62/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    +F+ +A  +  ++++  + +  ++    K   +E G D     R++   
Sbjct: 7   TEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSGRLRLSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E A      +  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 67  KFYLVAMFFVIFDVEGAVSVRMVLLIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDW 125


>gi|297181760|gb|ADI17941.1| NADH:ubiquinone oxidoreductase subunit 3 (chain a) [uncultured
           Desulfobacterales bacterium HF0200_07G10]
          Length = 118

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 67/118 (56%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y    +   +A  I   ++    ++  K    +K+  +ECG         +F ++F
Sbjct: 1   MLEEYLGAAIMFLMAMGIACGMVAMTSLLGPKREFADKMEPFECGESQLVSPHQRFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV+VLFV+FD+E  F FPWA+ F+++   GF  M++F+ IL VG +Y WK+G L+W+
Sbjct: 61  YLVAVLFVLFDIEAIFFFPWAILFRRLGMFGFIEMILFIFILGVGLLYVWKRGGLDWE 118


>gi|317134164|ref|YP_004123417.1| NADH dehydrogenase subunit 3 [Corticium candelabrum]
 gi|308912773|gb|ADO51528.1| NADH dehydrogenase subunit 3 [Corticium candelabrum]
          Length = 122

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 79/117 (67%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  +  I + + ++  +  ++  + + +  K PD EK+S YECGFDPF+ +R+ F +R  
Sbjct: 6   LLEFFVIFIMLCLSIGLSFIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRXF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V   QI   G+  M+VFL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVLNQIPLFGYWIMIVFLFILTLGLVYEWVKGGLEWE 122


>gi|118466422|ref|YP_883185.1| NADH dehydrogenase subunit A [Mycobacterium avium 104]
 gi|118167709|gb|ABK68606.1| NADH-quinone oxidoreductase, a subunit [Mycobacterium avium 104]
          Length = 154

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 8/125 (6%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------R 56
           L  Y PILV  AIA+A  +  ++   +      +  K++ YECG +P + +         
Sbjct: 30  LNVYIPILVLGAIATAFAVGSVVIASLAGPSRFNKSKMAAYECGIEPTETSVSGPRATAG 89

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +F +++ L ++LF++FD+EI FL+PWAV +  +       M+VF+  + V + Y W++G
Sbjct: 90  QRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALIEMVVFMLTVFVAYAYVWRRG 149

Query: 117 ALEWD 121
            L WD
Sbjct: 150 GLTWD 154


>gi|326799000|ref|YP_004316819.1| NAD(P)H-quinone oxidoreductase subunit 3 [Sphingobacterium sp. 21]
 gi|326549764|gb|ADZ78149.1| NAD(P)H-quinone oxidoreductase subunit 3 [Sphingobacterium sp. 21]
          Length = 125

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 70/115 (60%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y PIL+ M +A    +  +I   ++  K     KLS++E G     +AR    I++ +V
Sbjct: 11  DYLPILLQMFVAVGFGVTTIIGTHLIGPKLRTENKLSSFESGIKVIGNARQPVSIKYFMV 70

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFVIFD+E+ F++PWAV F+ +   G   M +F+G+L +GFIY  KK ALEWD
Sbjct: 71  AILFVIFDVEVIFMYPWAVNFRSLGMEGLIEMFIFMGLLLLGFIYVIKKRALEWD 125


>gi|223635534|sp|Q2GDY1|NUOA_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
          Length = 130

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++  Y  + +F  +A  I  V++  P  +A  S +  K  +YECGFD       +F++RF
Sbjct: 13  VVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRF 72

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV +LF+IFDLEI FLFPWAV  +++    F S+++FL ILTVGF+YE+  GAL+W
Sbjct: 73  YLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDW 129


>gi|21450020|ref|NP_659282.1| NADH dehydrogenase subunit 3 [Laminaria digitata]
 gi|21425345|emb|CAC87978.1| NADH dehydrogenase subunit 3 [Laminaria digitata]
          Length = 120

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y P+L+F+  +  +  ++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   FLKEYYPVLIFLGFSLVLASLIFGASYTLAFSEADSEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWAV   ++  +G+ SMM FL  L VGF+Y W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETVFLFPWAVSLSELPSIGYWSMMDFLFELVVGFVYAWQIGSLDWE 120


>gi|89895334|ref|YP_518821.1| NADH dehydrogenase I chain A [Desulfitobacterium hafniense Y51]
 gi|219669768|ref|YP_002460203.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfitobacterium hafniense DCB-2]
 gi|122482324|sp|Q24UB5|NUOA_DESHY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|89334782|dbj|BAE84377.1| NADH dehydrogenase I chain A [Desulfitobacterium hafniense Y51]
 gi|219540028|gb|ACL21767.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Desulfitobacterium hafniense DCB-2]
          Length = 118

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  ++A + + + +A AI +++M+ P ++A K P PEKL+ YE G        + F   +
Sbjct: 1   MSDNFAAVGIALVVAIAINLIMMLMPKLLAPKKPVPEKLTPYEGGNQTIGRTWLGFKSNY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            L +++F  FD+E  FLFPWA+ F+Q+    F  M VF+ IL VGF Y WK+GALEW
Sbjct: 61  FLYALVFTAFDVETVFLFPWALSFRQLGTFAFIEMFVFIVILLVGFWYAWKEGALEW 117


>gi|49574599|ref|NP_848065.2| NADH dehydrogenase subunit 3 [Adiantum capillus-veneris]
 gi|68565802|sp|Q85FL5|NU3C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|48476004|gb|AAP29397.2| NADH dehydrogenase subunit 3 [Adiantum capillus-veneris]
          Length = 120

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 67/114 (58%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y    +F+ +  +I ++        A     PEK ++YE G +P  D  ++F IR+ + 
Sbjct: 6   QYDSFWIFLLVCISIPLLAFSITRFAAPPREGPEKSTSYESGIEPKGDTWIRFQIRYYMF 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++F +FD+E  FL+PWA  F+++    F  ++VF+ IL VG +Y W+KGALEW
Sbjct: 66  ALVFTVFDVETVFLYPWATSFEELGLFAFVEVIVFIFILIVGLVYAWRKGALEW 119


>gi|239828583|ref|YP_002951207.1| NADH dehydrogenase subunit A [Geobacillus sp. WCH70]
 gi|239808876|gb|ACS25941.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Geobacillus
           sp. WCH70]
          Length = 122

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 69/117 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            + +Y  + VF+ I   + +  +     +    P   K +TYE G +PF D+RV+F +R+
Sbjct: 5   YVNNYVIVFVFLCIGILLPVGALTIGRFLRPHVPSEAKQTTYESGNNPFHDSRVQFQVRY 64

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + ++LFVIFD+E  FL+PWAV + ++       M++F+ +L +G +Y WKK  L+W
Sbjct: 65  YMFALLFVIFDVETVFLYPWAVAYNKLGLFALVEMIIFVLMLVLGLVYAWKKKVLQW 121


>gi|149374627|ref|ZP_01892401.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Marinobacter
           algicola DG893]
 gi|149361330|gb|EDM49780.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Marinobacter
           algicola DG893]
          Length = 138

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 65/120 (54%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           ++DLL  Y     F+     +   ++ +  ++  +S    K   +E G     DAR +F 
Sbjct: 5   VTDLLVRYWATGFFIVATLGLCAFMVGASSVLGGRSRGVSKSLPFESGIVGTGDARQRFS 64

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LFVIFD+E  FLF WA+    + W GF    VF+ IL  G +Y+ + GAL+W
Sbjct: 65  VKFYLVAMLFVIFDIEAVFLFAWAIVIPDVGWTGFWGAAVFILILLAGLLYDSRTGALDW 124


>gi|254776455|ref|ZP_05217971.1| NADH dehydrogenase subunit A [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 159

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 8/125 (6%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------R 56
           L  Y PILV  AIA+A  +  ++   +      +  K++ YECG +P + +         
Sbjct: 35  LNVYIPILVLGAIATAFAVGSVVIASLAGPSRFNKSKMAAYECGIEPTETSVSGPRATAG 94

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +F +++ L ++LF++FD+EI FL+PWAV +  +       M+VF+  + V + Y W++G
Sbjct: 95  QRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALIEMVVFMLTVFVAYAYVWRRG 154

Query: 117 ALEWD 121
            L WD
Sbjct: 155 GLTWD 159


>gi|320009167|gb|ADW04017.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           flavogriseus ATCC 33331]
          Length = 133

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           SD   SY+ + +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 12  SDYFQSYSVVGLLALVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 71

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M +FLG L VG +Y WKKG LE
Sbjct: 72  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFIFLGFLAVGLLYAWKKGVLE 131

Query: 120 W 120
           W
Sbjct: 132 W 132


>gi|253807632|gb|ACT36210.1| NADH dehydrogenase subunit 3 [Helicosporidium sp. ex Simulium
           jonesi]
          Length = 120

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 92/119 (77%), Gaps = 2/119 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSP--DPEKLSTYECGFDPFDDARVKFDI 61
           + + +  I ++  IA A+ ++L++ PFIV+      D EK+S YECGFDPFDDAR +FDI
Sbjct: 1   MNSEFLGIFIYFIIALALSLLLLVLPFIVSPAQNVADSEKISAYECGFDPFDDARGRFDI 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LF+IFDLE+AFLFPWA+   +I + GF +MMVFL ILT+GFIYEW+KGAL+W
Sbjct: 61  QFYLVAILFIIFDLEVAFLFPWALTLSKIGYFGFWTMMVFLIILTIGFIYEWRKGALDW 119


>gi|297570896|ref|YP_003696670.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Arcanobacterium haemolyticum DSM 20595]
 gi|296931243|gb|ADH92051.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Arcanobacterium haemolyticum DSM 20595]
          Length = 119

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 73/119 (61%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV--KFDIR 62
           +  Y P+L+ +A+AS + +  +    I+  K  +  K++ YECG +P   A    +F I+
Sbjct: 1   MNPYVPLLIMIAVASLVAVGGLAVSAILGPKRYNRVKVANYECGLEPTPSAGASGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++ F+IFD+E+ FL+PWAV   ++      ++  F+ ++T+ FIYEW++G L+W+
Sbjct: 61  YFLTAMTFIIFDIEVVFLYPWAVSAGRLGLASLIAIASFVFLITIPFIYEWRRGGLDWE 119


>gi|319738250|emb|CBJ18026.1| NADH dehydrogenase subunit 3 [Ectocarpus siliculosus]
          Length = 120

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y P+L+F+  + A+  V+  + FI+A    D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   FLKEYYPVLIFLGFSLALAGVIFGASFILAVSDADTEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPW+V   Q+  +G+ SM+ FL  L VGFIY W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETIFLFPWSVSLSQLPSIGYWSMLDFLFELVVGFIYAWQIGSLDWE 120


>gi|148238588|ref|YP_001223975.1| NADH dehydrogenase subunit A [Synechococcus sp. WH 7803]
 gi|223635442|sp|A5GIB3|NU3C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|147847127|emb|CAK22678.1| NAD(P)H-quinone oxidoreductase chain 3 [Synechococcus sp. WH 7803]
          Length = 120

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S D E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQDGERQLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEW 119


>gi|2143312|emb|CAA73769.1| NAD3 subunit of NADH dehydrogenase complex [Sorghum bicolor]
          Length = 118

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++ +  PF   +  S  PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
             V +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YPVPILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|271501268|ref|YP_003334293.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dickeya
           dadantii Ech586]
 gi|270344823|gb|ACZ77588.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Dickeya
           dadantii Ech586]
          Length = 147

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 66/119 (55%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +++L  +    +F+ IA  +   +++  F++  ++    K   YE G      AR++   
Sbjct: 5   TEVLAHHWAFALFVIIAVGLCGFMLLGGFLLGGRARARHKNIPYESGIASVGSARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+V  ++  W+GF    +F+ +L  G +Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSVSVRESGWIGFVEATIFILVLLAGLVYLVRIGALDW 123


>gi|330339525|ref|YP_004376726.1| NADH dehydrogenase subunit 3 [Paracorallium japonicum]
 gi|328750566|dbj|BAK18828.1| NADH dehydrogenase subunit 3 [Paracorallium japonicum]
          Length = 117

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 81/115 (70%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFGGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|321268732|gb|ADW79181.1| NADH dehydrogenase subunit 3 [Cyanophora paradoxa]
          Length = 123

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 85/118 (72%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L   Y  + +F  ++  +  ++  + + +A +  D EK+S YECGF+PF+DAR  FDIRF
Sbjct: 6   LYNQYFDLFLFFIVSFILACIIFGASYFIALQKTDSEKVSAYECGFNPFEDARSTFDIRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ FLFPWA+  +Q T +GF SM +FL ILT+GFIYEW KGALEW+
Sbjct: 66  YLVSILFIIFDLEVVFLFPWALTLQQTTIIGFTSMFIFLIILTIGFIYEWLKGALEWE 123


>gi|116075554|ref|ZP_01472813.1| NADH dehydrogenase subunit A [Synechococcus sp. RS9916]
 gi|116066869|gb|EAU72624.1| NADH dehydrogenase subunit A [Synechococcus sp. RS9916]
          Length = 134

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+  + +I+  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 18  LPGYDAFLGFLLIAAAVPALALITNKLLAPRSQQGEREITYESGMEPIGGAWIQFNIRYY 77

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 78  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEW 133


>gi|159899598|ref|YP_001545845.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892637|gb|ABX05717.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 129

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 70/118 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  + PI +   +   I +  ++   I+  K     KL  YE G  P  DA  +  +RF
Sbjct: 12  MLRPFLPIFIIFVVGVVIPVAALVLSAILGPKKATKRKLIPYESGMTPLGDAMQRMPVRF 71

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +V++LF++FD+EI FL P+A+YF+Q+   G   M  F+GIL VGF+Y W+KGAL WD
Sbjct: 72  YVVAMLFILFDIEIIFLMPYALYFRQMGLFGLAEMGAFMGILLVGFVYIWRKGALRWD 129


>gi|268053561|ref|YP_003288920.1| NADH dehydrogenase subunit 3 [Saccharina japonica]
 gi|268053600|ref|YP_003288958.1| NADH dehydrogenase subunit 3 [Saccharina religiosa]
 gi|268053639|ref|YP_003288996.1| NADH dehydrogenase subunit 3 [Saccharina ochotensis]
 gi|268053678|ref|YP_003289073.1| NADH dehydrogenase subunit 3 [Saccharina diabolica]
 gi|268053717|ref|YP_003289124.1| NADH dehydrogenase subunit 3 [Saccharina longipedalis]
 gi|268164066|ref|YP_003288831.1| NADH dehydrogenase subunit 3 [Saccharina angustata]
 gi|268164105|ref|YP_003288882.1| NADH dehydrogenase subunit 3 [Saccharina coriacea]
 gi|262318181|dbj|BAI48506.1| NADH dehydrogenase subunit 3 [Saccharina japonica]
 gi|262318220|dbj|BAI48544.1| NADH dehydrogenase subunit 3 [Saccharina religiosa]
 gi|262318259|dbj|BAI48582.1| NADH dehydrogenase subunit 3 [Saccharina ochotensis]
 gi|262318298|dbj|BAI48620.1| NADH dehydrogenase subunit 3 [Saccharina diabolica]
 gi|262318337|dbj|BAI48658.1| NADH dehydrogenase subunit 3 [Saccharina longipedalis]
 gi|262318376|dbj|BAI48696.1| NADH dehydrogenase subunit 3 [Saccharina angustata]
 gi|262318415|dbj|BAI48734.1| NADH dehydrogenase subunit 3 [Saccharina coriacea]
          Length = 120

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y PIL+F+  +  +  ++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   FLKEYYPILIFLGFSLVLASLIFGASYTLAFSESDSEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWAV   ++  +G+ SMM FL  L +GF+Y W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETVFLFPWAVSLSELPSIGYWSMMDFLFELVIGFVYAWQIGSLDWE 120


>gi|298674245|ref|YP_003725995.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Methanohalobium evestigatum Z-7303]
 gi|298287233|gb|ADI73199.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Methanohalobium evestigatum Z-7303]
          Length = 131

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 77/121 (63%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S ++ SY P+ +F+ +   +  + M+   +++ +S   +K +TYE G DP  DAR++F++
Sbjct: 8   SSIINSYVPVAIFLIVGVVMPPITMLIVKLLSPRSKSKQKFTTYESGSDPTGDARIQFNV 67

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMV--FLGILTVGFIYEWKKGALE 119
            + + ++ FV+FD+EI FL+PWA  ++        +  +  F+ I+ +GFIYEWKKGAL+
Sbjct: 68  EYYIYAIAFVLFDVEILFLYPWATVYRGHGITSIATTAILAFIVIMVIGFIYEWKKGALQ 127

Query: 120 W 120
           W
Sbjct: 128 W 128


>gi|146221431|gb|ABQ11831.1| NADH dehydrogenase subunit 3 [Iphiteon panicea]
          Length = 119

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/116 (45%), Positives = 77/116 (66%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y PIL+ +  ++    +L+    + +   P+PEK S YECGFDP    R+ F I+F L
Sbjct: 4   EEYIPILILLITSAIFSSILITISTLSSKNIPEPEKTSVYECGFDPIKTPRLPFSIKFFL 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V +LF++FD+EI+F+FPW    K I+W+ F +M++FL ILT+GFIYEW K  LEW+
Sbjct: 64  VGILFLLFDIEISFIFPWCTTIKSISWISFSTMILFLLILTIGFIYEWLKEGLEWE 119


>gi|87300571|ref|ZP_01083413.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 5701]
 gi|87284442|gb|EAQ76394.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 5701]
          Length = 120

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  +VA KS D E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKMVAPKSRDGERRLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFISILVVALAYAWRKGALEW 119


>gi|23092542|gb|AAN08353.1| NADH dehydrogenase I subunit A [Photorhabdus temperata subsp.
           temperata]
          Length = 149

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++L   +    VF+  A  +  ++++  F +  ++    K   YE G D    AR++   
Sbjct: 7   TELFAHHWAFAVFLLGAFGLCALMLLGAFFLGGRAKARAKHIPYESGIDSVGSARLRMSA 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  FL+ W+V  K+  WLGF    +F+ +L  G  Y  + GAL W
Sbjct: 67  KFYLVAMFFVIFDVEALFLYAWSVSIKESGWLGFIEASIFILVLLAGLFYLVRIGALNW 125


>gi|62161348|ref|YP_214976.1| NADH dehydrogenase subunit 3 [Montipora cactus]
 gi|62161421|ref|YP_214924.1| NADH dehydrogenase subunit 3 [Anacropora matthai]
 gi|58220699|gb|AAW67963.1| NADH dehydrogenase subunit 3 [Anacropora matthai]
 gi|58220713|gb|AAW67976.1| NADH dehydrogenase subunit 3 [Montipora cactus]
          Length = 118

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/99 (53%), Positives = 68/99 (68%)

Query: 23  IVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFP 82
            +   + + +  K PD EK+S YECGF+PF      F +RF LV +LF+IFDLEI+FLFP
Sbjct: 20  ALFSGASYFLGVKQPDREKVSAYECGFEPFGIPGRPFSVRFFLVGILFLIFDLEISFLFP 79

Query: 83  WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           W V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 80  WCVLFNQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|84508623|ref|YP_448670.1| NADH dehydrogenase subunit 3 [Desmarestia viridis]
 gi|45925655|gb|AAS79056.1| NADH dehydrogenase subunit 3 [Desmarestia viridis]
          Length = 120

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y P+L+F+  + A+ +++  + + +AF   D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   FLKEYYPVLIFLGFSLALALLIFGASYTLAFSEADNEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWA    Q+  +G+ SMM FL  L +GFIY W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETVFLFPWASSLSQLPAIGYWSMMDFLLELVIGFIYAWQIGSLDWE 120


>gi|295311644|ref|YP_003587240.1| NADH dehydrogenase subunit 3 [Citrullus lanatus]
 gi|38605649|sp|P60159|NU3M_HELAN RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|38605650|sp|P60160|NU3M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|1518350|emb|CAA89856.1| NADH dehydrogenase subunit 3 [Helianthus annuus]
 gi|259156772|gb|ACV96634.1| NADH dehydrogenase subunit 3 [Citrullus lanatus]
          Length = 118

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|116749376|ref|YP_846063.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Syntrophobacter fumaroxidans MPOB]
 gi|223635496|sp|A0LJM6|NUOA_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|116698440|gb|ABK17628.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Syntrophobacter fumaroxidans MPOB]
          Length = 136

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 60/95 (63%)

Query: 26  MISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAV 85
           +   + +  + P  EK   YECG  P   AR+++ + F LV++ F+IFD+E A++  WAV
Sbjct: 35  LFVAWWLGERKPGVEKARPYECGIIPTGSARLRYPVPFYLVAIFFLIFDMEGAYILTWAV 94

Query: 86  YFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F+++ W G+  M  F+G+L VG +Y WKKG L+W
Sbjct: 95  AFEELGWAGWLQMSFFIGLLLVGLVYVWKKGGLDW 129


>gi|117926909|ref|YP_867526.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Magnetococcus sp. MC-1]
 gi|117610665|gb|ABK46120.1| NADH dehydrogenase subunit A [Magnetococcus sp. MC-1]
          Length = 118

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY P+L+ + IA  + + ++ + ++V  K P  EK S YECGF P     +KFD+RF
Sbjct: 1   MLESYFPVLILLVIAGGMAVFMLAASYLVGVKRPYAEKRSQYECGFAPLSRVYIKFDVRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+++LF++FD+E AFLFPWAV FK+I  +GF  M++FL +L VG+ Y WKKGALEW+
Sbjct: 61  YLLAILFIVFDIEAAFLFPWAVAFKEIGIVGFVEMVLFLVVLLVGYAYAWKKGALEWE 118


>gi|182436718|ref|YP_001824437.1| putative NADH dehydrogenase chain A [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465234|dbj|BAG19754.1| putative NADH dehydrogenase chain A [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 156

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+   SY+ I +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 35  SEFFQSYSVIGLLALVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 94

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L VG +Y WKKG L 
Sbjct: 95  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFVFLGFLAVGLLYAWKKGVLA 154

Query: 120 W 120
           W
Sbjct: 155 W 155


>gi|330810463|ref|YP_004354925.1| NADH-quinone oxidoreductase subunit A [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|9719437|gb|AAF97797.1|AF281148_1 NADH dehydrogenase I subunit A [Pseudomonas fluorescens]
 gi|327378571|gb|AEA69921.1| NADH-quinone oxidoreductase subunit A [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 137

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLMAHNWGFAIFLLGVVGLCAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGGARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y ++ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLYRVGALDW 123


>gi|108796688|ref|YP_636544.1| NADH dehydrogenase subunit 3 [Zygnema circumcarinatum]
 gi|122211718|sp|Q32RI2|NU3C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|61393672|gb|AAX45814.1| subunit 3 of NADH-plastoquinone oxidoreductase [Zygnema
           circumcarinatum]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y     F+ IAS + ++ + +  +VA  S   EK ++YE G +P  ++ ++F IR+ 
Sbjct: 4   LAGYESFWAFLLIASLVPVLAVGTSSLVAPSSKAAEKRTSYESGIEPMGESWIQFQIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FV+FD+E  FL+PWA+ F+Q+  L F   +VF+ +L +G +Y W+KGALEW
Sbjct: 64  MFALVFVVFDVETVFLYPWAMSFQQLGVLAFIEALVFVLVLIIGLVYAWRKGALEW 119


>gi|84494930|ref|ZP_00994049.1| NADH dehydrogenase alpha subunit [Janibacter sp. HTCC2649]
 gi|84384423|gb|EAQ00303.1| NADH dehydrogenase alpha subunit [Janibacter sp. HTCC2649]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD--DARVKFDI 61
           +   Y PIL  +A+        + +  +V  K  +  K   YECG  P    D   +  I
Sbjct: 1   MSNPYVPILFLLALGFVFAAGSVGTSLVVGPKRYNRAKSEPYECGIQPSPRADGGGRVPI 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ L ++LF+IFD+E  FL+P+AV F  +       M++F+  + V + Y WK+G LEWD
Sbjct: 61  KYFLTAMLFIIFDIESVFLYPFAVAFDSLGLFALVEMVLFILTVFVAYAYVWKRGGLEWD 120


>gi|20065794|ref|NP_612826.1|ND3_16049 NADH dehydrogenase subunit 3 [Acropora tenuis]
 gi|19908474|gb|AAM02917.1|AF338425_11 NADH dehydrogenase subunit 3 [Acropora tenuis]
          Length = 118

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 73/118 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + + +  +   +  +  +      + + +  K PD EK+S YECGF+PF      F  RF
Sbjct: 1   MHSEFYSLFFLLVFSVVLSAFFSGASYFLGVKQPDREKVSAYECGFEPFGIPGRLFQFRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPW V F QI+  GF  M+ FLG+LT+G IYEW KG LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWCVLFNQISPFGFWIMVGFLGVLTLGLIYEWIKGGLEWE 118


>gi|320107660|ref|YP_004183250.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Terriglobus
           saanensis SP1PR4]
 gi|319926181|gb|ADV83256.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Terriglobus
           saanensis SP1PR4]
          Length = 135

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 74/123 (60%), Gaps = 6/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L +Y P+++ + +A  +    +   F++     +  KL  YECG DP  DAR +F +RF
Sbjct: 6   YLWNYLPLVMQVLVAIGLASAFVAISFVIGKHKRNKTKLGAYECGMDPVGDARGRFSVRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGA 117
            +V++LF++FD+E  F+ PWAV F+++       + GF  M+V+LG + VG  Y WKKG 
Sbjct: 66  YMVAMLFILFDVEAVFMLPWAVIFRRLPAITGQRFFGFWEMVVYLGFVGVGLFYVWKKGI 125

Query: 118 LEW 120
           L+W
Sbjct: 126 LDW 128


>gi|58578627|ref|YP_203347.1| NADH dehydrogenase subunit 3 [Mortierella verticillata]
 gi|57545560|gb|AAW51684.1| NADH dehydrogenase subunit 3 [Mortierella verticillata]
          Length = 199

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 67/110 (60%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
             L +  +   IVI L++     A   P+ EKL+T+ECGF P + AR KF I F LV +L
Sbjct: 3   SFLFYFILVPVIVIALLVLNLFFAQSKPNEEKLTTFECGFSPVEQARQKFSIHFYLVGIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           F++FDLE+  LFP AV    I   GF  ++ FL +LT+GF+YE+  GAL 
Sbjct: 63  FLVFDLEVLLLFPAAVSMYSIGQSGFWILVFFLVVLTIGFVYEYASGALN 112


>gi|227822753|ref|YP_002826725.1| NADH-quinone oxidoreductase chain A1 [Sinorhizobium fredii NGR234]
 gi|227341754|gb|ACP25972.1| NADH-quinone oxidoreductase chain A1 [Sinorhizobium fredii NGR234]
          Length = 121

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA-RVKFDIRFCL 65
            + P+LV +A    +V   +    ++   +P PEK   YECG DP  +A   +F ++F +
Sbjct: 5   EFLPVLVMIAGIVLVVGATLFVSSLLRPSNPYPEKNMPYECGMDPAGEAAGGRFRVQFYI 64

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++L V+FD+E  FLFPWAV  K+I  +GF  M VF+ +L VGF Y W KGALEW+
Sbjct: 65  LAILLVVFDVETMFLFPWAVVLKEIGLIGFVEMFVFIVLLLVGFAYAWLKGALEWE 120


>gi|1518359|emb|CAA89888.1| NADH dehydrogenase subunit 3 [Magnolia x soulangeana]
          Length = 118

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 87/118 (73%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  + PI +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFVPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|299138542|ref|ZP_07031721.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX8]
 gi|298599788|gb|EFI55947.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX8]
          Length = 137

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            +  Y P+++ + +A  +   ++ + F +        KL  YECG DP  DAR +F +RF
Sbjct: 8   YIWQYLPLVLQILVAVGLAGGMVGASFFIGKHKRSRTKLGAYECGMDPVGDARGRFSVRF 67

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGA 117
            +V++LF++FD+E  F+ PWAV ++++         GF  M+V++G + VG  Y WKKG 
Sbjct: 68  YMVAMLFILFDVEAVFMLPWAVIYRRLPGITGSRLFGFWEMLVYIGFVAVGLFYVWKKGI 127

Query: 118 LEW 120
           L W
Sbjct: 128 LNW 130


>gi|224178042|ref|YP_002600946.1| subunit 3 of NADH-plastoquinone oxidoreductase [Pyramimonas
           parkeae]
 gi|215882709|gb|ACJ71082.1| subunit 3 of NADH-plastoquinone oxidoreductase [Pyramimonas
           parkeae]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  + +F  IA  + I+ + +  ++  +   PE+ +TYE G +P  +AR++F+IR+
Sbjct: 3   VLNEYTYVFLFFVIACLVPILALTTSKLLRPEGVGPERRTTYESGIEPMGEARIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + ++LFV+FD+E  FL+PW+V F+Q+    F   +VF+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALLFVLFDVETLFLYPWSVTFRQLGLSAFLEALVFVCILILGLVYAWRKGALEW 119


>gi|194476961|ref|YP_002049140.1| NADH dehydrogenase alpha subunit [Paulinella chromatophora]
 gi|223635371|sp|B1X4R1|NU3C_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3, organellar
           chromatophore; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|171191968|gb|ACB42930.1| NADH dehydrogenase alpha subunit [Paulinella chromatophora]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  I+A KS + E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIATAVPVLALLTNKILAPKSRNGERELTYESGMEPVGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|162279929|ref|NP_064074.2| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|307101733|ref|YP_003875492.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|323435094|ref|YP_004222312.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|87248035|gb|ABD36072.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|148491433|dbj|BAA99467.2| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. vulgaris]
 gi|296040777|gb|ADG85356.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|301338028|gb|ADK73320.1| NADH dehydrogenase subunit 3 [Silene latifolia]
 gi|317905648|emb|CBJ14047.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|319439827|emb|CBJ17538.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
 gi|320148727|emb|CBJ23365.1| NADH dehydrogenase subunit 3 [Beta vulgaris subsp. maritima]
          Length = 118

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ +   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|303248400|ref|ZP_07334660.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Desulfovibrio
           fructosovorans JJ]
 gi|302490198|gb|EFL50116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Desulfovibrio
           fructosovorans JJ]
          Length = 139

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 66/113 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              LV+  +  AI+ +++     +  + P P+K   YECG  P  DAR ++ + F L++V
Sbjct: 22  LAFLVYFVLVLAILGLILFLSGFLVRRRPTPDKQRPYECGILPTGDARFRYPVPFFLMAV 81

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            F+IFD+E A++  WAV + ++   G+  M VF+ IL +G  Y W KG L+W+
Sbjct: 82  FFLIFDVETAYIVSWAVAWPELGLPGYLRMAVFIVILGLGLAYAWVKGGLDWN 134


>gi|318042791|ref|ZP_07974747.1| NADH:ubiquinone oxidoreductase subunit A [Synechococcus sp. CB0101]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  IV+ KS   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIAAAVPVLALVTNKIVSPKSRTGERDLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEW 119


>gi|269958901|ref|YP_003328690.1| NADH dehydrogenase subunit A [Anaplasma centrale str. Israel]
 gi|269848732|gb|ACZ49376.1| NADH dehydrogenase subunit A [Anaplasma centrale str. Israel]
          Length = 126

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/116 (45%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVK-FDIRFCL 65
            Y+ +L+F+ +A+ +  V  + P  +A +     KLS YECGFD         FD++FC+
Sbjct: 11  GYSSVLLFIVLAAMVSSVFAVLPAFLAKRRESVGKLSPYECGFDRDGAPGSPSFDVKFCV 70

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +++LFV+FD+E+AFLFPWAV    I   GF SM+ F+G+L VGF+YEW  GALEW+
Sbjct: 71  IAILFVVFDVEVAFLFPWAVCLGTIGAFGFWSMVCFVGLLAVGFVYEWGVGALEWE 126


>gi|237746751|ref|ZP_04577231.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes HOxBLS]
 gi|229378102|gb|EEO28193.1| NADH-ubiquinone/plastoquinone oxidoreductase [Oxalobacter
           formigenes HOxBLS]
          Length = 119

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 81/117 (69%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L +Y P+L+F+ +A    I  +     +A   PD EKLS YECGF PF++AR+KFD+RF 
Sbjct: 3   LENYFPVLLFLLVALFFGIFSLFLGRFLAPHRPDSEKLSPYECGFAPFENARMKFDVRFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+++LF++FDLE AFLFPWA   +++ W  F ++M+FL  L  GF Y WKKGAL W+
Sbjct: 63  LIAILFILFDLETAFLFPWAASMRELGWQAFVAIMIFLAELVAGFWYIWKKGALNWE 119


>gi|15150750|ref|NP_150416.1| NADH dehydrogenase subunit 3 [Pylaiella littoralis]
 gi|15147756|emb|CAC50857.1| NADH dehydrogenase subunit 3 [Pylaiella littoralis]
          Length = 120

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 84/118 (71%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y P L+F+  +  +  ++  + +I+A  S D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   LLKEYYPALIFLVFSFVLAAIIFGASYILAVSSADSEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWAV   Q+  +G+ SMM FL  L VGFIY W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETIFLFPWAVSLSQLPSIGYWSMMDFLFELVVGFIYAWQIGSLDWE 120


>gi|118340564|gb|ABK80614.1| putative NADH dehydrogenase I A subunit [uncultured marine
           Nitrospinaceae bacterium]
          Length = 118

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 69/118 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  YA   +   +A  I   +++   ++  K    +K+  +ECG         +F ++F
Sbjct: 1   MLEEYAGAAIMFLMAMGIACGMVLMTTLLGPKREFADKMEPFECGESQLVSPHQRFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV+VLFV+FD+E  F FPWA+ F+++   GF  M++F+ IL VG +Y WK+G L+W+
Sbjct: 61  YLVAVLFVLFDIEAIFFFPWAILFRRLGMFGFIEMILFVFILGVGLMYVWKRGGLDWE 118


>gi|3914180|sp|O63850|NU3M_SARGL RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|3132795|gb|AAC16384.1| NADH dehydrogenase subunit 3 [Sarcophyton glaucum]
          Length = 117

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + I+  + I+++ + +I+ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116


>gi|270267569|ref|YP_003331253.1| NADH dehydrogenase subunit 3 [Dendronephthya gigantea]
 gi|209887407|gb|ACI95029.1| NADH dehydrogenase subunit 3 [Dendronephthya gigantea]
          Length = 117

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 82/115 (71%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++ +K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G IYEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTYMGLPLFGYWVIMLFLFILTLGLIYEWIEGGLEWE 116


>gi|212712276|ref|ZP_03320404.1| hypothetical protein PROVALCAL_03362 [Providencia alcalifaciens DSM
           30120]
 gi|212685022|gb|EEB44550.1| hypothetical protein PROVALCAL_03362 [Providencia alcalifaciens DSM
           30120]
          Length = 147

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 59/116 (50%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L       +F+  A  +   ++ +   +  ++    K   YE G D    AR++   +F 
Sbjct: 8   LAHNWGFAIFLLGAIGLCAFMLTAGHFLGSRAKARTKHVPYESGIDSVGSARLRMSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++ FVIFD+E  FLF W+V  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 68  LVAMFFVIFDVEAMFLFAWSVSIREAGWVGFIEAAIFILVLLAGLFYLVRVGALDW 123


>gi|226365380|ref|YP_002783163.1| NADH dehydrogenase subunit A [Rhodococcus opacus B4]
 gi|226243870|dbj|BAH54218.1| NADH-quinone oxidoreductase chain A [Rhodococcus opacus B4]
          Length = 119

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PILV  AIA A  +  +I   IV  +  +  KL  YECG +P        +  ++
Sbjct: 1   MNVYVPILVLGAIAVAFAVFSVIVARIVGPRRYNRAKLDAYECGIEPTSSPLGAGRIPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV+F  + + G G+M +F+  ++V + YEW++G L WD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVHFDALGFFGLGAMALFIFNVSVAYAYEWRRGGLSWD 119


>gi|304437259|ref|ZP_07397219.1| NADH-quinone oxidoreductase subunit A [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304369751|gb|EFM23416.1| NADH-quinone oxidoreductase subunit A [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 117

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 65/116 (56%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  + +F+ +A    ++ +   F++  K P P+K   YECG D      V+F   + 
Sbjct: 1   MGEYGSLGIFLLVALFFPVMALGPAFLLQPKKPSPQKYIPYECGVDSIGSPYVQFRAGYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           L ++LF++FD+E  FL+PWAV F+ +       M +F+GIL +G  Y W+KG L W
Sbjct: 61  LYALLFIVFDIETVFLYPWAVEFRMLGAFALIEMFIFVGILVLGLAYAWRKGDLTW 116


>gi|258593434|emb|CBE69773.1| NADH-quinone oxidoreductase chain A (NADH dehydrogenase I, chain A)
           (NDH-1, chain A) [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L SY PI + + +A+   +V ++   ++  + P   KL+ YECG DP   AR +F ++F
Sbjct: 1   MLISYLPIFILILLAAGFALVTLLLSHVLGPRRPTRSKLTPYECGIDPVGSARERFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            LV++LF+IFD+EI FL+PWAV    +   G   M++FLGIL +G +Y WKKG LEW
Sbjct: 61  YLVAMLFIIFDIEIVFLYPWAVILNSLKLFGLIEMILFLGILLIGLLYVWKKGGLEW 117


>gi|261346157|ref|ZP_05973801.1| NADH dehydrogenase I subunit A [Providencia rustigianii DSM 4541]
 gi|282565810|gb|EFB71345.1| NADH dehydrogenase I subunit A [Providencia rustigianii DSM 4541]
          Length = 147

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 58/116 (50%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L       +F   A  +   ++ +   +  ++    K   YE G D    AR++   +F 
Sbjct: 8   LAHNWGFAIFFIGAIGLCAFMLTAGHFLGSRAKARAKHVPYESGIDSVGSARLRMSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++ FVIFD+E  FLF W+V  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 68  LVAMFFVIFDVEAMFLFAWSVAIREAGWVGFIEAAIFIFVLLAGLFYLVRVGALDW 123


>gi|14917019|sp|P92533|NU3M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|61229010|sp|P68159|NU3M_RAPSA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|61229012|sp|P68160|NU3M_BRANA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 119

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIR 62
           ++  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIR
Sbjct: 1   MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  FYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 119


>gi|322436003|ref|YP_004218215.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX9]
 gi|321163730|gb|ADW69435.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Acidobacterium sp. MP5ACTX9]
          Length = 135

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 72/123 (58%), Gaps = 6/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y P+++ + +A A+   ++ + F V        K  TYECG DP  D+R +F +RF
Sbjct: 6   YLWQYLPLVLQIVVAIALAGGMVGASFFVGKHKNSRTKAGTYECGMDPVGDSRGRFSVRF 65

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGA 117
            +V++LF++FD+E  F+ PWAV F+++       + GF  M+V+L  + VG  Y WKKG 
Sbjct: 66  YMVAMLFILFDVEAVFMLPWAVIFRKLPGLGYSKYFGFNEMLVYLAFVGVGLFYVWKKGI 125

Query: 118 LEW 120
           L W
Sbjct: 126 LNW 128


>gi|94968343|ref|YP_590391.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Candidatus
           Koribacter versatilis Ellin345]
 gi|94550393|gb|ABF40317.1| NADH dehydrogenase subunit A [Candidatus Koribacter versatilis
           Ellin345]
          Length = 135

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 76/125 (60%), Gaps = 5/125 (4%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
            +    Y P+L+ +A+ + I + ++I  + V     +  K+S YECG +P  DA+ +F +
Sbjct: 3   DNYFVRYVPLLIHLAVVTIIPVGMVILSWFVGQHKYNKAKMSAYECGMEPVGDAQSRFSV 62

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQIT-----WLGFGSMMVFLGILTVGFIYEWKKG 116
           +F LV++LF++FD+E  F++PWA+ FK +         +  M+V++ I+  GF Y WKKG
Sbjct: 63  KFYLVAILFILFDVEAVFMYPWAIIFKDLKNAGAALFAYSEMLVYVLIVLAGFFYIWKKG 122

Query: 117 ALEWD 121
            L+W+
Sbjct: 123 VLDWN 127


>gi|77459825|ref|YP_349332.1| NADH dehydrogenase subunit A [Pseudomonas fluorescens Pf0-1]
 gi|123604057|sp|Q3KA63|NUOA_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|77383828|gb|ABA75341.1| NADH dehydrogenase subunit A [Pseudomonas fluorescens Pf0-1]
          Length = 137

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLMAHNWGFAIFLLGVVGLCAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGGARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y ++ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLFRVGALDW 123


>gi|268591135|ref|ZP_06125356.1| NADH dehydrogenase I subunit A [Providencia rettgeri DSM 1131]
 gi|291313437|gb|EFE53890.1| NADH dehydrogenase I subunit A [Providencia rettgeri DSM 1131]
          Length = 147

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 59/116 (50%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L       +F+     +   ++++   +  ++    K   YE G D    AR++   +F 
Sbjct: 8   LAHNWAFAIFLIGTIGLCAFMLVAGHFLGSRAKARTKHVPYESGIDSVGSARLRMSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++ FVIFD+E  FLF W+V  ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 68  LVAMFFVIFDVEAMFLFAWSVAIREAGWVGFIEAAIFILVLLAGLFYLVRVGALDW 123


>gi|238927269|ref|ZP_04659029.1| NADH dehydrogenase (quinone) [Selenomonas flueggei ATCC 43531]
 gi|238884856|gb|EEQ48494.1| NADH dehydrogenase (quinone) [Selenomonas flueggei ATCC 43531]
          Length = 117

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 65/116 (56%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  + +F+ +A    I+ +   F++  K P P+K   YECG D      V+F   + 
Sbjct: 1   MGEYGSLGIFLLVALFFPIMALGPAFLLQPKKPSPQKYIPYECGVDSIGSPYVQFRAGYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           L ++LF++FD+E  FL+PWAV F+ +       M VF+GIL +G  Y W+KG L W
Sbjct: 61  LYALLFIVFDIETVFLYPWAVEFRMLGVFALIEMFVFVGILVLGLAYAWRKGDLTW 116


>gi|269994341|dbj|BAI50331.1| NADH dehydrogenase subunit 3 [Xenodermichthys copei]
          Length = 133

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + IA  +  +LMI  F +   +PD EKLS YECGFDP   AR+ F + F L+++LF
Sbjct: 4   ITMILLIALTLSTILMIVSFWMPQMTPDTEKLSPYECGFDPQGSARLPFSLHFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +T  G        L +LT+G IYEW +G L+W
Sbjct: 64  LLFDLEIALLLPLPWGDQLLTPTGTLLWAAAVLILLTLGLIYEWTQGGLKW 114


>gi|317134246|ref|YP_004123490.1| NADH dehydrogenase subunit 3 [Halisarca sp. DVL-2010]
 gi|315141537|gb|ADT81741.1| NADH dehydrogenase subunit 3 [Halisarca sp. DVL-2010]
          Length = 119

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  I   + I+ A+  ++  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF LV
Sbjct: 5   EFLGIFFILLISVALSTIISGASYILGVKEPDSEKVSAYECGFDPFESSRIPFSVRFFLV 64

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI++LFPW V   QI  LGF  MM+FL ILT+G IYEW  G L+W+
Sbjct: 65  GILFLIFDLEISYLFPWCVVSNQIELLGFWIMMIFLIILTLGLIYEWILGGLDWE 119


>gi|295311690|ref|YP_003587376.1| NADH dehydrogenase subunit 3 [Cucurbita pepo]
 gi|9280618|gb|AAF86497.1|AF279450_1 NADH dehydrogenase subunit 3 [Lupinus luteus]
 gi|9280622|gb|AAF86499.1|AF279452_1 NADH dehydrogenase subunit 3 [Lupinus angustifolius]
 gi|259156818|gb|ACV96679.1| NADH dehydrogenase subunit 3 [Cucurbita pepo]
          Length = 118

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|1352558|sp|P48911|NU3M_CYACA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|758180|emb|CAA88774.1| NADH dehydrogenase subunit 3 [Cyanidium caldarium]
          Length = 120

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/120 (45%), Positives = 81/120 (67%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M      Y  +  ++ I+  +  ++ +  +++  K  DPEK S YECGF+PFDD R  FD
Sbjct: 1   MKFYFVEYFILFTYIIISFILACIISLLSYLLTTKKEDPEKTSAYECGFNPFDDTRTTFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF  F LEI+FLFPW++    I++ GF ++++FL ILT+GFIYEWKKGAL W
Sbjct: 61  VKFYLVAILFFNFCLEISFLFPWSIVLGNISYFGFVAIILFLFILTIGFIYEWKKGALNW 120


>gi|229328250|ref|YP_002860263.1| NADH dehydrogenase subunit 3 [Megaceros aenigmaticus]
 gi|186695219|gb|ACC86786.1| NADH dehydrogenase subunit 3 [Nothoceros aenigmaticus]
          Length = 118

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 74/117 (63%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAF--KSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
            + PI V++ I+S + ++L+    + AF   S  PEKLS +ECG DP DDAR +FDIR  
Sbjct: 2   EFVPICVYLVISSLLPLILIGVSLLFAFPSSSAYPEKLSAHECGSDPSDDARSRFDIRLY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LV    +I D E+   FPWAV   +I   G  SMMVF  I T+GF+YEWKKGA +W+
Sbjct: 62  LVLTSSIISDSEVTSSFPWAVPPNKIGLFGSWSMMVFSLISTIGFVYEWKKGASDWE 118


>gi|229591253|ref|YP_002873372.1| NADH dehydrogenase subunit A [Pseudomonas fluorescens SBW25]
 gi|229363119|emb|CAY50136.1| NADH-quinone oxidoreductase chain A [Pseudomonas fluorescens SBW25]
          Length = 137

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           + L+       +F+     +   ++    ++  K+    K   +E G  P   AR++   
Sbjct: 5   TGLMAHNWGFAIFLLGVVGLCAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGGARLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++LFVIFD+E  FLF W+V  ++  W GF   +VF+ IL  G +Y ++ GAL+W
Sbjct: 65  KFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLFRVGALDW 123


>gi|283850905|ref|ZP_06368191.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Desulfovibrio
           sp. FW1012B]
 gi|283573828|gb|EFC21802.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Desulfovibrio
           sp. FW1012B]
          Length = 139

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/93 (38%), Positives = 57/93 (61%)

Query: 29  PFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFK 88
              +  + P+P+K   YECG  P   AR ++ + F LV+V F+IFD+E A++  WAV + 
Sbjct: 42  SGFLVRRRPNPDKQRPYECGILPTGPARFRYPVPFFLVAVFFLIFDVETAYIVSWAVAWP 101

Query: 89  QITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++   G+  M VF+ +L +G  Y W+KG L+WD
Sbjct: 102 ELGLPGYLRMAVFIVVLGLGLAYAWRKGGLDWD 134


>gi|154508637|ref|ZP_02044279.1| hypothetical protein ACTODO_01138 [Actinomyces odontolyticus ATCC
           17982]
 gi|293191716|ref|ZP_06609273.1| NADH dehydrogenase I, A subunit [Actinomyces odontolyticus F0309]
 gi|153798271|gb|EDN80691.1| hypothetical protein ACTODO_01138 [Actinomyces odontolyticus ATCC
           17982]
 gi|292820488|gb|EFF79470.1| NADH dehydrogenase I, A subunit [Actinomyces odontolyticus F0309]
          Length = 119

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 63/118 (53%), Gaps = 2/118 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+L+  A A  +    +++  I+        K   YECG  P        +F +
Sbjct: 1   MTNPYVPLLIMSAAALVLAFGGLVASAILGPTKKSKTKADNYECGIQPTSAHLTEGRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ LV++ F+IFD+E+ F++PWAV F Q+   G   MM FL  L V + YEW++G L+
Sbjct: 61  RYYLVAMTFIIFDIEVVFMYPWAVSFNQLGLFGLVVMMSFLVTLCVPYAYEWRRGGLD 118


>gi|282901527|ref|ZP_06309449.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Cylindrospermopsis raciborskii CS-505]
 gi|281193570|gb|EFA68545.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Cylindrospermopsis raciborskii CS-505]
          Length = 120

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ + S +  + + +  I+   S  PE+ +TYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLILCSLVPALALSASKILRPSSYSPERRTTYESGMEPFGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALVYAWRKGALEW 119


>gi|148241312|ref|YP_001226469.1| NADH dehydrogenase subunit A [Synechococcus sp. RCC307]
 gi|223635416|sp|A5GQF7|NU3C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|147849622|emb|CAK27116.1| NAD(P)H-quinone oxidoreductase chain 3 [Synechococcus sp. RCC307]
          Length = 120

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +I+  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALITNAVLAPRSRQGERRLTYESGMEPVGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEW 119


>gi|110816057|ref|YP_684389.1| NADH dehydrogenase subunit 3 [Oltmannsiellopsis viridis]
 gi|86450268|gb|ABC96347.1| NADH dehydrogenase subunit 3 [Oltmannsiellopsis viridis]
          Length = 125

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 65/115 (56%), Positives = 82/115 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ Y  I V++  +S + +++    F+ A + PDPEKLS YECGFDPFD AR +FDI F 
Sbjct: 1   MSDYLNIFVYLCFSSVLSLLISSLAFVTAVRKPDPEKLSAYECGFDPFDSARTQFDIHFY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           LV++LF+IFDLEI FLFPW +   QI   GF  MMVFL ILT+GFIYEW K ALE
Sbjct: 61  LVAILFIIFDLEITFLFPWCITLGQIGMEGFFVMMVFLIILTIGFIYEWLKTALE 115


>gi|262200420|ref|YP_003271628.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gordonia
           bronchialis DSM 43247]
 gi|262083767|gb|ACY19735.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Gordonia
           bronchialis DSM 43247]
          Length = 140

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 23/140 (16%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD---------- 54
           + +Y PI+V  AI +A  +  +     +  K  +  KL  YECG +P +           
Sbjct: 1   MNAYVPIMVLGAIGAAFAVFSVFIAVAIGPKRYNRAKLEPYECGIEPVEQSLVSTSVASS 60

Query: 55  -------------ARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVF 101
                           +  +++ L ++LF+IFD+EI FL+PWAV F  + W G  +M +F
Sbjct: 61  GARQRSAGAVVTGPVHRVPVKYYLTAMLFIIFDIEIVFLYPWAVAFDALGWFGLLAMTLF 120

Query: 102 LGILTVGFIYEWKKGALEWD 121
           +  ++V + YEW++G L WD
Sbjct: 121 IVNVSVAYAYEWRRGGLSWD 140


>gi|224160831|ref|XP_002338259.1| predicted protein [Populus trichocarpa]
 gi|222871535|gb|EEF08666.1| predicted protein [Populus trichocarpa]
          Length = 113

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 1/113 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVA-FKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++L+  PF+ A   S  PEKLS YECGFDPF DAR +FDIRF LVS+
Sbjct: 1   PICIYLVISLLVSLILLGLPFLFASPSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  LFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 113


>gi|308072459|dbj|BAJ22091.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
          Length = 118

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +   API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEIAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMVFLLILTIGFLYEWKKGALDWE 118


>gi|333025067|ref|ZP_08453131.1| putative NADH dehydrogenase chain A [Streptomyces sp. Tu6071]
 gi|332744919|gb|EGJ75360.1| putative NADH dehydrogenase chain A [Streptomyces sp. Tu6071]
          Length = 158

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S    +Y  + V  A     V     +  ++    P  EK  TYECG DP  +      +
Sbjct: 37  SGYFHAYTLVGVITAAGVLFVAFAFAAGRLLRPVVPTREKFLTYECGVDPVGEGWAHTQV 96

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L +G +Y WKKG LE
Sbjct: 97  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFVFLGFLAIGLLYAWKKGVLE 156

Query: 120 W 120
           W
Sbjct: 157 W 157


>gi|317123845|ref|YP_004097957.1| NADH dehydrogenase subunit A [Intrasporangium calvum DSM 43043]
 gi|315587933|gb|ADU47230.1| NADH dehydrogenase subunit A [Intrasporangium calvum DSM 43043]
          Length = 119

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PIL  + +  A   + + +  +V  K  +  KL  YECG  P        +  I+
Sbjct: 1   MNPYVPILFMLGLGFAFAALSVGASLVVGPKRYNRAKLEAYECGIQPSPHPAGGGRVPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+E  FL+P+AV F ++       M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIIFDIESVFLYPFAVAFNRLGLFALVEMVLFILTVFVAYAYVWRRGGLEWD 119


>gi|300717651|ref|YP_003742454.1| NADH dehydrogenase I chain A [Erwinia billingiae Eb661]
 gi|299063487|emb|CAX60607.1| NADH dehydrogenase I chain A [Erwinia billingiae Eb661]
          Length = 145

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 60/119 (50%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ +A  +   ++   + +  K+      + +E G        ++   
Sbjct: 5   TEVIAHHWAFAVFLIVAIGLCCAMLAGAWFLGGKARGRYTNTPFESGAPAVGTTHLRMSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G +Y  +  AL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSTAIRESGWIGFVEATIFILVLLAGLVYLVRIRALDW 123


>gi|254281967|ref|ZP_04956935.1| NADH dehydrogenase i chain a [gamma proteobacterium NOR51-B]
 gi|219678170|gb|EED34519.1| NADH dehydrogenase i chain a [gamma proteobacterium NOR51-B]
          Length = 141

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 63/114 (55%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y P +V+      +V  +++  +I+  +  +      +E G  P   ++V+  + F LV
Sbjct: 6   GYWPFVVYAFGVLVLVATMLLLSWILGQRRANDATNMPFESGVVPVGTSQVQMSVEFYLV 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LFVIFDLE  F+  WAV F ++ W GF ++ +F+ IL V  IYE   GAL W
Sbjct: 66  AILFVIFDLETVFILAWAVAFFELGWFGFVAVSLFILILVVALIYELSTGALNW 119


>gi|110189753|gb|ABG49446.1| NADH dehydrogenase subunit 3 [Carthamus tinctorius]
 gi|110294537|gb|ABG66727.1| NADH dehydrogenase subunit 3 [Carthamus tinctorius]
          Length = 118

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|126657570|ref|ZP_01728726.1| NADH dehydrogenase subunit A [Cyanothece sp. CCY0110]
 gi|172036679|ref|YP_001803180.1| NADH dehydrogenase subunit A [Cyanothece sp. ATCC 51142]
 gi|223635350|sp|B1WZG2|NU3C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|126621274|gb|EAZ91987.1| NADH dehydrogenase subunit A [Cyanothece sp. CCY0110]
 gi|171698133|gb|ACB51114.1| NADH dehydrogenase subunit 3 [Cyanothece sp. ATCC 51142]
          Length = 120

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S I I+ + +  I+      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFSRLGLLAFVEALIFIAILVVALVYAWRKGALEW 119


>gi|8954369|ref|NP_059358.1| NADH dehydrogenase subunit 3 [Cyanidioschyzon merolae]
 gi|3927873|dbj|BAA34661.1| NADH-ubiquinone oxidoreductase chain 3 [Cyanidioschyzon merolae
           strain 10D]
          Length = 118

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   Y+ +L F+ +   +  ++ I  +I + +  D EK+S YECGF+PFDDAR  FDIRF
Sbjct: 1   MFKEYSILLTFICLTFLLATIVFILSYIFSVQKADAEKISAYECGFNPFDDARTTFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF+IFDLE++FL+PW+V    +   GF  +  FL ILT+GF+YEW KGAL+W+
Sbjct: 61  YLVAILFLIFDLEVSFLYPWSVCIGYLNNQGFYVICTFLFILTIGFLYEWFKGALDWE 118


>gi|302536168|ref|ZP_07288510.1| NuoA [Streptomyces sp. C]
 gi|302445063|gb|EFL16879.1| NuoA [Streptomyces sp. C]
          Length = 119

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  AI +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGAIGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDSLGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|166363917|ref|YP_001656190.1| NADH dehydrogenase subunit A [Microcystis aeruginosa NIES-843]
 gi|223635360|sp|B0JSV4|NU3C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|159026402|emb|CAO88931.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gi|166086290|dbj|BAG00998.1| NADH dehydrogenase subunit 3 [Microcystis aeruginosa NIES-843]
          Length = 120

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+   S + I+ + +  ++      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLKGYEYFLGFLLACSLVPILSLTASKVLRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEW 119


>gi|164421156|ref|YP_001648558.1| NADH dehydrogenase subunit 3 [Chondrilla aff. nucula CHOND]
 gi|158668117|gb|ABW76578.1| NADH dehydrogenase subunit 3 [Chondrilla aff. nucula CHOND]
          Length = 119

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 77/115 (66%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  I + + I+  +  V+  + +++  K PD EK+S YECGFDPF+ +R+ F +RF  V
Sbjct: 5   EFLGIFILLLISVVLSTVISSASYVLGVKKPDSEKVSAYECGFDPFESSRIPFSVRFFXV 64

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI++LF W V   QI  LGF  M++FL ILT+G IYEW  G L+W+
Sbjct: 65  GILFLIFDLEISYLFXWCVVSNQIELLGFWIMIIFLIILTLGLIYEWIXGGLDWE 119


>gi|15130812|emb|CAC48165.1| NADH dehydrogenase subunit 3 [Daucus carota]
          Length = 118

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ AF S   P+KLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFAFNSSTYPDKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|163854295|ref|YP_001633641.1| NADH dehydrogenase subunit 3 [Negombata magnifica]
 gi|163639450|emb|CAM06606.1| NADH dehydrogenase subunit 3 [Negombata magnifica]
          Length = 117

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 74/112 (66%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            + + +  +  +  ++  + +IV  K PD EK+S YECGFDPF  +RV F ++F LV +L
Sbjct: 6   YLGILILCSLILSTIIFGASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLVGIL 65

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F+IFDLEI+FLFPW V   QI   G   M +FL ILT+G IYEW +G LEW+
Sbjct: 66  FLIFDLEISFLFPWCVVLNQIKLFGVWVMYLFLIILTLGLIYEWVRGGLEWE 117


>gi|300775172|ref|ZP_07085034.1| NADH dehydrogenase (quinone) [Chryseobacterium gleum ATCC 35910]
 gi|300505912|gb|EFK37048.1| NADH dehydrogenase (quinone) [Chryseobacterium gleum ATCC 35910]
          Length = 123

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 71/121 (58%), Gaps = 2/121 (1%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAF--KSPDPEKLSTYECGFDPFDDARVKFD 60
           +L  SY PIL+   +A   V V ++    +    K  +  K  ++ECG     +AR  F 
Sbjct: 2   NLPESYIPILIQAGVAVGFVAVSLLGAHFLGPQQKKGNSVKNQSWECGVPVEGNARTPFS 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           I++ L +VLFV+FD+EI F +P+AV F++    GF +++ F+ I  + F Y WK+GAL+W
Sbjct: 62  IKYFLTAVLFVLFDIEIVFFYPYAVNFREFGMEGFLAVLTFVAIFFMAFFYVWKRGALDW 121

Query: 121 D 121
           D
Sbjct: 122 D 122


>gi|307154795|ref|YP_003890179.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7822]
 gi|306985023|gb|ADN16904.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7822]
          Length = 120

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+   S + I+ + +  ++      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLLTCSLVPILALTASKLLRPSGGGPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGVLAFIEALIFIAILVVALVYAWRKGALEW 119


>gi|146307435|ref|YP_001187900.1| NADH dehydrogenase subunit A [Pseudomonas mendocina ymp]
 gi|223635475|sp|A4XV02|NUOA_PSEMY RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|145575636|gb|ABP85168.1| NADH dehydrogenase subunit A [Pseudomonas mendocina ymp]
          Length = 137

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+      VF+     ++  ++    ++  K+    K   +E G  P  +AR++   +F 
Sbjct: 8   LSHDWAFAVFLLGVCGLIAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGNARLRLSAKFY 67

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LV++LFVIFD+E  FLF WAV  ++  W+G     VF+ IL  G +YE   GAL+W
Sbjct: 68  LVAMLFVIFDVEALFLFAWAVSVRESGWVGLVGATVFITILFAGLVYESAIGALDW 123


>gi|300508203|dbj|BAJ10941.1| NADH dehydrogenase subunit 3 [Amolops larutensis]
          Length = 137

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +L F  +A  I   L+   F +   +PD EKLS YECGFDP   AR+ + +RF LV++LF
Sbjct: 1   MLKFSILAVLISATLITLSFWIPSATPDGEKLSPYECGFDPLGSARLPYSVRFFLVAILF 60

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA + P     +    L         + +LT+GF YEW +G LEW
Sbjct: 61  LLFDLEIALILPSPWALQLPNPLVTTIWTSSIIILLTLGFAYEWSQGGLEW 111


>gi|323481959|ref|YP_004237302.1| NADH dehydrogenase subunit 3 [Lophelia pertusa]
 gi|323461312|emb|CBZ41200.1| NADH dehydrogenase subunit 3 [Lophelia pertusa]
          Length = 114

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 54/113 (47%), Positives = 69/113 (61%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
                F+ IA  +  V     F +  K PD EK+S YECGF PF      F +RF L+ +
Sbjct: 2   VGFFFFVLIAVVLAGVFSSISFFIGEKRPDREKVSAYECGFVPFSFLGRPFSVRFFLIGI 61

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LF+IFDLEI+FLFPW V +  +   GF +M+ FL ILTVG +YEW KG LEW+
Sbjct: 62  LFLIFDLEISFLFPWCVLYNSLGPFGFWAMVGFLFILTVGLVYEWLKGGLEWE 114


>gi|300869241|ref|ZP_07113835.1| NAD(P)H-quinone oxidoreductase subunit 3 [Oscillatoria sp. PCC
           6506]
 gi|300332786|emb|CBN59033.1| NAD(P)H-quinone oxidoreductase subunit 3 [Oscillatoria sp. PCC
           6506]
          Length = 120

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L+ Y   L F+ I+S I ++ + +  ++  KS   ++ +TYE G +P   A ++F+IR+ 
Sbjct: 4   LSGYEYFLGFLIISSLIPVLALTASKLLRPKSRPYDRRTTYESGVEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFSQLGLLAFIEALIFIAILVIALVYAWRKGALEW 119


>gi|254496121|ref|ZP_05109020.1| NADH dehydrogenase I, A subunit [Legionella drancourtii LLAP12]
 gi|254354662|gb|EET13298.1| NADH dehydrogenase I, A subunit [Legionella drancourtii LLAP12]
          Length = 97

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 73/97 (75%)

Query: 25  LMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWA 84
           ++ +  +++  SPD  K + YECGF  F+ + + FD+RF LV++LF+IFDLE AF FPWA
Sbjct: 1   MLGAGSLLSKHSPDAAKNAPYECGFGAFESSHIPFDVRFYLVAILFIIFDLETAFFFPWA 60

Query: 85  VYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +  ++I W GF  MM+FLG+L +GFIYEWK+GALEW+
Sbjct: 61  LALRKIGWFGFAGMMLFLGLLVIGFIYEWKRGALEWE 97


>gi|329944202|ref|ZP_08292461.1| NADH dehydrogenase subunit A [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328530932|gb|EGF57788.1| NADH dehydrogenase subunit A [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 119

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPF--DDARVKFDIR 62
           +  YA +L+  A+A  + I  +    IV+    +  K++ YECG DP   +    +F + 
Sbjct: 1   MNPYASLLIMAALALVVAIGGLALSAIVSPARRNRVKVANYECGIDPTPANTEHGRFPVS 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F LV + F+IFD+E+ FL+PWA  F ++ + G G+ ++F+G++TV ++ EW++G L+WD
Sbjct: 61  FYLVGMTFIIFDVEVVFLYPWATAFGRLGFFGLGAAVLFIGLITVPYVLEWRRGGLDWD 119


>gi|315605130|ref|ZP_07880181.1| NADH-quinone oxidoreductase subunit A [Actinomyces sp. oral taxon
           180 str. F0310]
 gi|315313166|gb|EFU61232.1| NADH-quinone oxidoreductase subunit A [Actinomyces sp. oral taxon
           180 str. F0310]
          Length = 119

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 62/118 (52%), Gaps = 2/118 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+L+  A A  +    + +  I+        K   YECG  P        +F +
Sbjct: 1   MTNPYVPLLIMSAAALVLAFGGLGASAILGPTKKSKTKADNYECGIQPTSAHLTDGRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ LV++ F+IFD+E+ F++PWAV F Q+   G   MM FL  L V + YEW++G L+
Sbjct: 61  RYYLVAMTFIIFDIEVVFMYPWAVSFNQLGLFGLIVMMSFLVTLCVPYAYEWRRGGLD 118


>gi|269955277|ref|YP_003325066.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269303958|gb|ACZ29508.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 120

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+LV MA+A+ + +  + +  ++  K  +  KL  YECG  P   A    +  I
Sbjct: 1   MTNPYVPVLVLMAVAAVLALGGVGASAVIGPKRYNRAKLEAYECGIMPTPHAVGGGRMPI 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++ LV++ F++FD+E+ FL+PWAV F  +   G  + + FL ++TV F+YEW++G  +W
Sbjct: 61  KYYLVAMTFIVFDIEVVFLYPWAVSFTWLAGFGVVAALTFLALITVPFVYEWRRGGFDW 119


>gi|112253891|ref|YP_717146.1| NADH dehydrogenase subunit 3 [Brassica napus]
 gi|37591093|dbj|BAC98895.1| NADH dehydrogenase subunit 3 [Brassica napus]
          Length = 118

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|57013906|ref|YP_173379.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|57013994|ref|YP_173466.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
 gi|1563730|emb|CAA65517.1| NADH-ubiquinone oxidoreductase subunit 3 [Nicotiana sylvestris]
 gi|1563735|emb|CAA65514.1| NADH-ubiquinone oxidoreductase subunit 3 [Nicotiana sylvestris]
 gi|56806630|dbj|BAD83531.1| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 118

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFI-VAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           ++ +API +++ I+  + ++ +  PF+  +  S  PEKLS YECGFDP  DAR +FDIRF
Sbjct: 1   MSEFAPICIYLVISPLVSLLPLGLPFLFSSNSSTYPEKLSAYECGFDPSGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
            LVS+LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 114


>gi|124024215|ref|YP_001018522.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9303]
 gi|223635377|sp|A2CCP7|NU3C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123964501|gb|ABM79257.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9303]
          Length = 134

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ +++A+ I+ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 18  LPGYDAFLGFLLVSAAVPILALVTNKLLAPRSRTGERELTYESGMEPIGGAWIQFNIRYY 77

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 78  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEW 133


>gi|86359326|ref|YP_471218.1| NADH-ubiquinone oxidoreductase chain A protein [Rhizobium etli CFN
           42]
 gi|190893213|ref|YP_001979755.1| NADH-ubiquinone oxidoreductase, chain A [Rhizobium etli CIAT 652]
 gi|86283428|gb|ABC92491.1| NADH-ubiquinone oxidoreductase chain A protein [Rhizobium etli CFN
           42]
 gi|190698492|gb|ACE92577.1| NADH-ubiquinone oxidoreductase protein, chain A [Rhizobium etli
           CIAT 652]
 gi|327191020|gb|EGE58074.1| NADH-ubiquinone oxidoreductase chain A protein [Rhizobium etli
           CNPAF512]
          Length = 121

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 47/122 (38%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV-KF 59
           M+ +   + P+LV +A    +    +    ++   +P PEK   YECG D   +A   +F
Sbjct: 1   MTAM--EFLPVLVMVAGVVLVAGATLFVSSLLRPSNPYPEKNMPYECGMDAAGEAAAGRF 58

Query: 60  DIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
            + F ++++L V+FD+E  FLFPWAV  K I  +G+  M VF+ +L VGF Y W KGALE
Sbjct: 59  RVPFFILAILLVVFDVETMFLFPWAVVLKDIGLVGYVEMFVFILLLLVGFAYAWLKGALE 118

Query: 120 WD 121
           W+
Sbjct: 119 WE 120


>gi|317968578|ref|ZP_07969968.1| NADH:ubiquinone oxidoreductase subunit A [Synechococcus sp. CB0205]
          Length = 120

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ IA+A+ ++ +++  IV+ KS   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLIAAAVPVLALVTNKIVSPKSRVGERDLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEW 119


>gi|313768522|ref|YP_004062197.1| NADH dehydrogenase subunit 3 [Gracilariopsis andersonii]
 gi|312844649|gb|ADR03213.1| NADH dehydrogenase subunit 3 [Gracilariopsis andersonii]
          Length = 121

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  + T Y+ IL+F+ I+  + + +    +++  +  D EK+S YECGF+PFDDAR  FD
Sbjct: 1   MKLIFTEYSIILIFLIISFILSVAIFSLSYLLIPQKADQEKVSAYECGFNPFDDARATFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +RF LV++LF+IFDLEI+FLFPW++    I   GF SM++FL ILT+GFIYEW KGALEW
Sbjct: 61  VRFYLVAILFLIFDLEISFLFPWSLVLGNIPLFGFWSMIIFLLILTIGFIYEWYKGALEW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|88607210|ref|YP_505114.1| NADH dehydrogenase I, A subunit [Anaplasma phagocytophilum HZ]
 gi|88598273|gb|ABD43743.1| NADH dehydrogenase I, A subunit [Anaplasma phagocytophilum HZ]
          Length = 120

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 79/115 (68%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            Y+ +L+F ++A+ +  +  + P  +A +    EKL  YECGFD  ++    FDI+FC++
Sbjct: 6   EYSSVLIFFSLAAVLSSLFAVLPIFLAKRRDSMEKLVPYECGFDQKEEVSSVFDIKFCII 65

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LFVIFD+E+ FLFPW+V    I + G+ SM+ FLG+LT+GFIYEW  GALEW+
Sbjct: 66  GILFVIFDVEVTFLFPWSVCLGSIGFAGYFSMLCFLGMLTIGFIYEWNSGALEWE 120


>gi|239905980|ref|YP_002952719.1| NADH-quinone oxidoreductase chain A [Desulfovibrio magneticus RS-1]
 gi|239795844|dbj|BAH74833.1| NADH-quinone oxidoreductase chain A [Desulfovibrio magneticus RS-1]
          Length = 139

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 66/113 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
            P++V++ I   ++ V++     +  + P P K   YECG  P    R ++ + F LV+V
Sbjct: 22  LPLVVYVGIVCGVMAVILFLSGFLTRRRPSPAKQQPYECGIIPTGPGRFRYPVPFFLVAV 81

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LF++FD+E A++  +A  + ++   G+  M VF+ IL +G  Y W KGAL+WD
Sbjct: 82  LFLLFDVETAYIIAYAAAWPELGLSGYLRMAVFIVILGLGLAYAWSKGALDWD 134


>gi|284794746|ref|YP_003412099.1| NADH dehydrogenase subunit 3 [Phaeoceros laevis]
 gi|254596066|gb|ACT75307.1| NADH dehydrogenase subunit 3 [Phaeoceros laevis]
          Length = 118

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 79/117 (67%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSP--DPEKLSTYECGFDPFDDARVKFDIRFC 64
            + PI V++ I+S + ++L+   F+ AF S    PEKLS +ECG DP DD R +FDIRF 
Sbjct: 2   EFVPICVYLVISSLLFLILIGVSFLFAFSSSLAYPEKLSAHECGSDPSDDVRSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            V +  +I DLE+  LFPWAV   +I   GF SMMVF  I T+GF+YEWKKGAL+W+
Sbjct: 62  FVLISSIISDLEVTSLFPWAVSPNKIGLFGFWSMMVFSLISTIGFVYEWKKGALDWE 118


>gi|318056636|ref|ZP_07975359.1| NADH dehydrogenase subunit NuoA2 [Streptomyces sp. SA3_actG]
 gi|318080917|ref|ZP_07988249.1| NADH dehydrogenase subunit NuoA2 [Streptomyces sp. SA3_actF]
          Length = 157

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S    +Y  + V  A     V     +  ++    P  EK  TYECG DP  +      +
Sbjct: 36  SGYFHAYTLVGVITAAGVLFVAFAFAAGRLLRPVVPTREKFLTYECGVDPVGEGWAHTQV 95

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L +G +Y WKKG LE
Sbjct: 96  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFVFLGFLAIGLLYAWKKGVLE 155

Query: 120 W 120
           W
Sbjct: 156 W 156


>gi|282897134|ref|ZP_06305136.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Raphidiopsis
           brookii D9]
 gi|281197786|gb|EFA72680.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Raphidiopsis
           brookii D9]
          Length = 120

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ + S +  + + +  I+   S  PE+ +TYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLILCSLVPALALSASKILRPSSYSPERRTTYESGMEPFGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVIALVYAWRKGALEW 119


>gi|197131011|gb|ACH47056.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|205277647|gb|ACI02096.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|209916089|gb|ACI95884.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|241912116|gb|ACS71779.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
 gi|314908394|gb|ADT62144.1| NADH dehydrogenase subunit 3 [Isoetes engelmannii]
          Length = 118

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 85/117 (72%), Gaps = 2/117 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFK--SPDPEKLSTYECGFDPFDDARVKFDIRFC 64
            + PI V + I+  + ++L+   F+ A    S  PEKLS YECGFDP DDAR +FDIRF 
Sbjct: 2   EFGPICVHLVISLLLSLILIGVSFLFAPAPFSSYPEKLSAYECGFDPLDDARSRFDIRFY 61

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           LVS+LF+IFDLE+ FLFPWA+   +I + GF SMMVFL ILT+GF YEW KGAL+W+
Sbjct: 62  LVSILFIIFDLEVTFLFPWAISLNRIGFRGFWSMMVFLLILTIGFTYEWTKGALDWE 118


>gi|78183814|ref|YP_376248.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9902]
 gi|123582228|sp|Q3B0C3|NU3C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78168108|gb|ABB25205.1| putative NADH dehydrogenase subunit [Synechococcus sp. CC9902]
          Length = 120

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEW 119


>gi|38638281|ref|NP_943679.1| NADH dehydrogenase subunit 3 [Chara vulgaris]
 gi|32966595|gb|AAP92178.1| NADH dehydrogenase subunit 3 [Chara vulgaris]
          Length = 118

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 63/84 (75%), Positives = 72/84 (85%)

Query: 38  DPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGS 97
            PEKLS YECGFDPFDDAR +FDIRF LVS+LF+IFDLE+ FLFPWAV F +I   GF S
Sbjct: 35  YPEKLSAYECGFDPFDDARSRFDIRFYLVSILFLIFDLEVTFLFPWAVSFNKIGLFGFWS 94

Query: 98  MMVFLGILTVGFIYEWKKGALEWD 121
           MMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 95  MMVFLLILTIGFVYEWKKGALDWE 118


>gi|269994174|dbj|BAI50176.1| NADH dehydrogenase subunit 3 [Bathytroctes breviceps]
          Length = 133

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I   +  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF L+++LF
Sbjct: 4   ITTVLLITITLSTILAMVSFWLPQMTPDAEKLSPYECGFDPLGSARLPFSLRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + ++ +  F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLLSPVNTFLWATAVLALLTLGLIYEWTQGGLEW 114


>gi|87123075|ref|ZP_01078926.1| NADH dehydrogenase alpha subunit [Synechococcus sp. RS9917]
 gi|86168795|gb|EAQ70051.1| NADH dehydrogenase alpha subunit [Synechococcus sp. RS9917]
          Length = 120

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQQGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEW 119


>gi|307328658|ref|ZP_07607831.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           violaceusniger Tu 4113]
 gi|306885770|gb|EFN16783.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           violaceusniger Tu 4113]
          Length = 140

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 60/121 (49%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
                 Y  + +  AI    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 19  DGYFYGYTVVGLLAAIGVIFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 78

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M +FLG L VG +Y WKKG LE
Sbjct: 79  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGFGAATLVEMFIFLGFLAVGLLYAWKKGVLE 138

Query: 120 W 120
           W
Sbjct: 139 W 139


>gi|238897505|ref|YP_002923184.1| NADH dehydrogenase I chain A [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465262|gb|ACQ67036.1| NADH dehydrogenase I chain A [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 150

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 59/118 (50%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
            +   +    +F   A  + + +++  F +  ++    K   YE G D      ++   +
Sbjct: 6   QIFAHHWAFAIFSISAIGLCLAMLLGAFFLGGRAKARSKNIPYESGIDSVGSTHMRLSAK 65

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F   ++ FVIFD+E  +L+ WA+  ++  W GF  + VF+ +L VG +Y  + GAL+W
Sbjct: 66  FYCFAMFFVIFDVEALYLYTWAISIRESGWTGFIEVSVFIFVLLVGLLYLSRIGALDW 123


>gi|78211755|ref|YP_380534.1| NADH dehydrogenase subunit A [Synechococcus sp. CC9605]
 gi|123770819|sp|Q3AN53|NU3C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78196214|gb|ABB33979.1| putative NADH dehydrogenase subunit [Synechococcus sp. CC9605]
          Length = 120

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  +VA KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLVAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEW 119


>gi|254821134|ref|ZP_05226135.1| NADH dehydrogenase subunit A [Mycobacterium intracellulare ATCC
           13950]
          Length = 159

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 8/125 (6%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------R 56
           L  Y PILV  AIA+A  +  ++   +      +  K++ YECG +P + +         
Sbjct: 35  LNVYIPILVLGAIAAAFAVGSVVIASLAGPSRFNKSKMAAYECGIEPTETSVSGPHATAG 94

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +F +++ L ++LF++FD+EI FL+PWAV +  +       M+VF+  + V + Y W++G
Sbjct: 95  QRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALVEMVVFMLTVFVAYAYVWRRG 154

Query: 117 ALEWD 121
            L WD
Sbjct: 155 GLTWD 159


>gi|77917821|ref|YP_355636.1| NADH dehydrogenase I subunit A [Pelobacter carbinolicus DSM 2380]
 gi|123575098|sp|Q3A826|NUOA_PELCD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|77543904|gb|ABA87466.1| NADH dehydrogenase subunit A [Pelobacter carbinolicus DSM 2380]
          Length = 141

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/101 (36%), Positives = 59/101 (58%)

Query: 20  AIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAF 79
            IV+ L+++   +  +S  P K   YECG +P   AR  + + F L ++ FV+FD+E+AF
Sbjct: 36  IIVVSLLLAARFLGHRSRTPLKNLPYECGVEPTGPARPGYPVPFYLTAIFFVVFDVEVAF 95

Query: 80  LFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +  WAV +  + W G   +  F+  L V  IY W++GAL+W
Sbjct: 96  IASWAVAYDLLGWAGLAQIAFFIITLLVALIYLWRRGALDW 136


>gi|280978049|ref|YP_003345002.1| NADH dehydrogenase subunit 3 [Pythonichthys microphthalmus]
 gi|271280216|dbj|BAI53166.1| NADH dehydrogenase subunit 3 [Pythonichthys microphthalmus]
          Length = 116

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I SA+  +L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITSALSCILIIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +  T    F      L +LTVG IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPTTTQTFFWATSILILLTVGLIYEWAQGGLEW 114


>gi|57639689|gb|AAW55691.1| NADH dehydrogenase subunit 3 [Calycanthus floridus]
          Length = 110

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 72/109 (66%), Gaps = 1/109 (0%)

Query: 10  PILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++ +  PF   +  S  PEKLS YECG DP  DAR +FDIRF LV +
Sbjct: 1   PICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAYECGSDPSGDARSRFDIRFYLVPI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 109


>gi|313206216|ref|YP_004045393.1| NADH dehydrogenase subunit a [Riemerella anatipestifer DSM 15868]
 gi|312445532|gb|ADQ81887.1| NADH dehydrogenase subunit A [Riemerella anatipestifer DSM 15868]
 gi|315023099|gb|EFT36112.1| NADH ubiquinone oxidoreductase chain A [Riemerella anatipestifer
           RA-YM]
 gi|325336337|gb|ADZ12611.1| NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Riemerella
           anatipestifer RA-GD]
          Length = 121

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 71/119 (59%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
            +  +Y PIL+  A+    V++ +++   +  +     K   +ECG +   DAR  F ++
Sbjct: 2   SIPENYIPILIQAAVGLGFVLISLVASHYLGPRLNGGVKDDAFECGVEIEGDARTPFSVK 61

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LFV+FD+EI F +P+AV F++    GF +++ F+ +  +GF Y  K+GAL+WD
Sbjct: 62  YFLTAILFVLFDIEIVFFYPYAVNFREFGVEGFLAVLTFVAVFFIGFFYVLKRGALDWD 120


>gi|6714875|gb|AAF26188.1| NADH dehydrogenase subunit III [Scytalopus magellanicus]
          Length = 116

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            IL  + ++ ++  +L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   TILFMLTVSISLSTILTTLNFWLAQTNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     + Q         M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPLTTLTWAMTIIILLTLGLVYEWTQGGLEW 114


>gi|256390055|ref|YP_003111619.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Catenulispora
           acidiphila DSM 44928]
 gi|256356281|gb|ACU69778.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Catenulispora
           acidiphila DSM 44928]
          Length = 142

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
              ++Y+ + + + +  A V     +  ++   +P PEKL TYECG DP  +      +R
Sbjct: 22  SYFSAYSVVGILLLLGVAFVATAFGANRLLRPHAPSPEKLLTYECGVDPVGEGWAHTQVR 81

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + + L+ IF ++  +LFPWA  F    +       M VFLG L VG +Y +KKG L W
Sbjct: 82  YYVYAFLYAIFAVDAVYLFPWATIFAAPGFKGTTLVEMFVFLGFLAVGLLYAYKKGVLAW 141


>gi|239980152|ref|ZP_04702676.1| NADH dehydrogenase subunit A [Streptomyces albus J1074]
 gi|291452007|ref|ZP_06591397.1| NADH dehydrogenase subunit A [Streptomyces albus J1074]
 gi|291354956|gb|EFE81858.1| NADH dehydrogenase subunit A [Streptomyces albus J1074]
          Length = 119

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +A  +  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAAFAVFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVSFDALGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|320095548|ref|ZP_08027212.1| NADH-quinone oxidoreductase subunit A [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977526|gb|EFW09205.1| NADH-quinone oxidoreductase subunit A [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 119

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 62/118 (52%), Gaps = 2/118 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +   Y P+L+  A A  +    + +  ++        K   YECG  P        +F +
Sbjct: 1   MTNPYVPLLIMSAAALVLAFGGLAASAVLGPTKKSTTKADNYECGIQPTSAHLTEGRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ LV++ F+IFD+E+ F++PWAV F Q+   G   MM FL  L V + YEW++G L+
Sbjct: 61  RYYLVAMTFIIFDIEVVFMYPWAVSFNQLGLFGLAVMMSFLVTLAVPYAYEWRRGGLD 118


>gi|57639695|gb|AAW55694.1| NADH dehydrogenase subunit 3 [Liriodendron tulipifera]
          Length = 111

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF  VS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYPVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|150026263|ref|YP_001297089.1| NADH dehydrogenase I, A subunit [Flavobacterium psychrophilum
           JIP02/86]
 gi|223635462|sp|A6H1R4|NUOA_FLAPJ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|149772804|emb|CAL44288.1| NADH dehydrogenase I, A subunit [Flavobacterium psychrophilum
           JIP02/86]
          Length = 121

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 71/121 (58%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M      Y PI + M +A   V++ +I    +  K     K   +E G +   +ARV F 
Sbjct: 1   MQSNQLDYLPIFMQMGLAVGFVVLTIIGSSFLGPKRSSVNKDKNFESGIESIGNARVPFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LFV+FD+E+ FL+PWA+ F+++   G   M++F+ +L VGF Y  KK ALEW
Sbjct: 61  VKYFLVAILFVLFDVEVIFLYPWAINFQELGMQGMIKMVIFMSLLLVGFFYIIKKKALEW 120

Query: 121 D 121
           D
Sbjct: 121 D 121


>gi|296040779|gb|ADG85357.1| NADH dehydrogenase subunit 3 [Silene noctiflora]
          Length = 118

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ +   S  PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPIFIYLVISLLVSLILLGLPFLFSSNTSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|218440673|ref|YP_002379002.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 7424]
 gi|218173401|gb|ACK72134.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7424]
          Length = 120

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S + I+ + +  ++      PE+L+TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLTCSLVPILALTASKLLRPSGGGPERLTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGILAFVEALIFIAILVVALVYAWRKGALEW 119


>gi|259907927|ref|YP_002648283.1| NADH dehydrogenase subunit A [Erwinia pyrifoliae Ep1/96]
 gi|292488844|ref|YP_003531731.1| NADH dehydrogenase I subunit A [Erwinia amylovora CFBP1430]
 gi|292899994|ref|YP_003539363.1| NADH dehydrogenase I chain A [Erwinia amylovora ATCC 49946]
 gi|224963549|emb|CAX55039.1| NADH dehydrogenase I chain A [Erwinia pyrifoliae Ep1/96]
 gi|283477808|emb|CAY73724.1| NADH dehydrogenase I chain A [Erwinia pyrifoliae DSM 12163]
 gi|291199842|emb|CBJ46966.1| NADH dehydrogenase I chain A [Erwinia amylovora ATCC 49946]
 gi|291554278|emb|CBA21601.1| NADH dehydrogenase I chain A [Erwinia amylovora CFBP1430]
 gi|310768165|gb|ADP13115.1| NADH dehydrogenase subunit A [Erwinia sp. Ejp617]
 gi|312173003|emb|CBX81258.1| NADH dehydrogenase I chain A [Erwinia amylovora ATCC BAA-2158]
          Length = 145

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ ++  +  +++   + +  K+      + +E G      A+++   
Sbjct: 5   TEVVAHHWAFAVFLIVSIGLCCLMLAGAWFLGGKARGRHTNTPFESGIASVGTAKLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSTAIRESGWVGFVEAAIFILVLLAGLFYLVRIGALDW 123


>gi|56692435|ref|YP_163914.1| NADH dehydrogenase subunit 3 [Anguilla dieffenbachii]
 gi|56565394|dbj|BAD78069.1| NADH dehydrogenase subunits 3 [Anguilla dieffenbachii]
          Length = 116

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISVLIITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDTTHTFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|166895604|ref|YP_001661398.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
 gi|166706936|dbj|BAF98400.1| NADH dehydrogenase subunit 3 [Cycas taitungensis]
          Length = 118

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+S + ++ +  PF  A  S   PEKLS +ECG DP  DAR +FDIR 
Sbjct: 1   MLEFAPIRIYLVISSLVPLIPLGVPFPFAPNSSTYPEKLSAHECGSDPSGDARSRFDIRS 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
             V + F+I D E+ F FP AV   +I   G  SMMVF  I T+G  +EWKKGA +W+
Sbjct: 61  HPVPISFIISDPEVTFSFPRAVPPNKIDPFGSRSMMVFSLIPTIGSPHEWKKGASDWE 118


>gi|28202177|ref|NP_777418.1| NADH dehydrogenase subunit 3 [Anthoceros formosae]
 gi|29337180|sp|Q31792|NU3C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|27807879|dbj|BAC55354.1| NADH dehydrogenase ND3 subunit [Anthoceros formosae]
 gi|27808005|dbj|BAC55449.1| NADH dehydrogenase ND3 subunit [Anthoceros formosae]
          Length = 120

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L++ Y    +F+ IAS I  +      ++A  S  PEK ++YECG +P  DA ++F IR+
Sbjct: 3   LVSKYNYFWIFLLIASLIPTIAFSISRVIAPISKGPEKFTSYECGIEPMGDAWIQFQIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWA+ FKQ+    F  + +F+ IL +G IY W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAMSFKQLGIPAFIEVFIFVFILIIGLIYAWRKGALEW 119


>gi|56692492|ref|YP_163953.1| NADH dehydrogenase subunit 3 [Anguilla megastoma]
 gi|56565436|dbj|BAD78108.1| NADH dehydrogenase subunits 3 [Anguilla megastoma]
          Length = 116

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I +A+  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILIITTALSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTHAFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|254382443|ref|ZP_04997802.1| NADH dehydrogenase subunit A [Streptomyces sp. Mg1]
 gi|194341347|gb|EDX22313.1| NADH dehydrogenase subunit A [Streptomyces sp. Mg1]
          Length = 119

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPVPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+E+ FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEVVFLYPWAVTFDSLGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|116071576|ref|ZP_01468844.1| NADH dehydrogenase alpha subunit [Synechococcus sp. BL107]
 gi|116065199|gb|EAU70957.1| NADH dehydrogenase alpha subunit [Synechococcus sp. BL107]
          Length = 120

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ ++ +++  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPVLALVTNKLLAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEW 119


>gi|302521250|ref|ZP_07273592.1| NADH dehydrogenase subunit NuoA2 [Streptomyces sp. SPB78]
 gi|302430145|gb|EFL01961.1| NADH dehydrogenase subunit NuoA2 [Streptomyces sp. SPB78]
          Length = 154

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S    +Y  + V  A     V     +  ++    P  EK  TYECG DP  +      +
Sbjct: 33  SGYFHAYTLVGVITAAGVLFVAFAFAAGRLLRPVVPTREKFLTYECGVDPVGEGWAHTQV 92

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L +G +Y WKKG LE
Sbjct: 93  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFVFLGFLAIGLLYAWKKGVLE 152

Query: 120 W 120
           W
Sbjct: 153 W 153


>gi|57639701|gb|AAW55697.1| NADH dehydrogenase subunit 3 [Platanus occidentalis]
          Length = 111

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF LVS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|159902861|ref|YP_001550205.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9211]
 gi|223635378|sp|A9BDU1|NU3C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|159888037|gb|ABX08251.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9211]
          Length = 120

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I++A+ ++ +++  +++ KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LQGYDAFLGFLLISAAVPVLALVTNKLLSPKSQTGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALIFIAILIVALAYAWRKGALEW 119


>gi|57639687|gb|AAW55690.1| NADH dehydrogenase subunit 3 [Agave attenuata]
          Length = 114

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +API +++ ++  + ++ +  PF   +  S  P+KLS +ECG DP  DAR +FDIRF  
Sbjct: 2   EFAPICIYLVMSPLVSLIPLGVPFPFASNSSTYPDKLSAHECGSDPSGDARSRFDIRFYP 61

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           VS+LF+I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 62  VSILFIIPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 113


>gi|290958207|ref|YP_003489389.1| NADH dehydrogenase subunit NuoA2 [Streptomyces scabiei 87.22]
 gi|260647733|emb|CBG70838.1| NADH dehydrogenase subunit NuoA2 [Streptomyces scabiei 87.22]
          Length = 139

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 63/121 (52%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +D   SY+ + +  A+    V V   +  ++  + P  EKL TYECG DP  +      +
Sbjct: 18  ADYFQSYSVVGLLAAVGVLFVAVAFGAGRLLRPEVPTREKLLTYECGVDPVGEGWAHTQV 77

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M VFLG L VG +Y +KKG L 
Sbjct: 78  RYYVYAFLYVIFAIDSIFLFPWATVFADPGYGATTLVEMFVFLGFLAVGLLYAYKKGVLT 137

Query: 120 W 120
           W
Sbjct: 138 W 138


>gi|238062211|ref|ZP_04606920.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Micromonospora sp. ATCC 39149]
 gi|237884022|gb|EEP72850.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Micromonospora sp. ATCC 39149]
          Length = 121

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           L+ YAPI+   A+A+A  +  + +      +  +  KL  YECG +P        +F ++
Sbjct: 3   LSPYAPIVGLFALAAAFSLFSVAAARFAGPRRYNKAKLEAYECGIEPSPQPVGGGRFPVK 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F L ++LF++FD+EI FL+PWAV F  +   GF  M++F+  + V + Y W++G L+WD
Sbjct: 63  FYLTAMLFIVFDIEIIFLYPWAVSFDALPIFGFVEMVLFIVAVFVAYAYVWRRGGLDWD 121


>gi|225871985|ref|YP_002753439.1| NADH dehydrogenase I, A subunit [Acidobacterium capsulatum ATCC
           51196]
 gi|225792982|gb|ACO33072.1| NADH dehydrogenase I, A subunit [Acidobacterium capsulatum ATCC
           51196]
          Length = 135

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 70/120 (58%), Gaps = 6/120 (5%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           +Y P+L+ + +A  +   +    +++        KL+ YECG     DAR +F +RF +V
Sbjct: 9   NYLPLLIQVVVAVGMGCSMATVSWLIGRHRNSKVKLAAYECGVPVEGDARGRFSVRFYMV 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQIT------WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++FD+E  F+ PWAV ++++         GF  M+V+LG + +G  Y WKKG L+W
Sbjct: 69  AMLFILFDVEAVFMLPWAVIYRRLPAITGSRMFGFWEMVVYLGFVVIGIFYVWKKGILDW 128


>gi|254432341|ref|ZP_05046044.1| NADH dehydrogenase i domain protein [Cyanobium sp. PCC 7001]
 gi|197626794|gb|EDY39353.1| NADH dehydrogenase i domain protein [Cyanobium sp. PCC 7001]
          Length = 120

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y   L F+ I++A+ ++ +++  +++  S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYDAFLGFLLISAAVPVLALVANKLLSPDSRQGERELTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALAYAWRKGALEW 119


>gi|280978287|ref|YP_003345223.1| NADH dehydrogenase subunit 3 [Thalassenchelys sp. Tht2]
 gi|271280735|dbj|BAI53490.1| NADH dehydrogenase subunit 3 [Thalassenchelys sp. Tht2]
          Length = 116

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P++  + I +A+  +L+I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PVISTLMITTALSCILIIVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F      L +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPIPWGDQLPDPAQTFFWATSILVLLTLGLVYEWIQGGLEW 114


>gi|9280620|gb|AAF86498.1|AF279451_1 NADH dehydrogenase subunit 3 [Lupinus albus]
          Length = 118

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 87/118 (73%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIILDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE 118


>gi|254391137|ref|ZP_05006344.1| NADH dehydrogenase subunit A [Streptomyces clavuligerus ATCC 27064]
 gi|294814394|ref|ZP_06773037.1| NADH-quinone oxidoreductase subunit A [Streptomyces clavuligerus
           ATCC 27064]
 gi|326442784|ref|ZP_08217518.1| NADH dehydrogenase subunit A [Streptomyces clavuligerus ATCC 27064]
 gi|197704831|gb|EDY50643.1| NADH dehydrogenase subunit A [Streptomyces clavuligerus ATCC 27064]
 gi|294326993|gb|EFG08636.1| NADH-quinone oxidoreductase subunit A [Streptomyces clavuligerus
           ATCC 27064]
          Length = 119

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVSFDALGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|188533347|ref|YP_001907144.1| NADH dehydrogenase subunit A [Erwinia tasmaniensis Et1/99]
 gi|223635461|sp|B2VIV3|NUOA_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|188028389|emb|CAO96250.1| NADH dehydrogenase I chain A [Erwinia tasmaniensis Et1/99]
          Length = 145

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 63/119 (52%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++++  +    VF+ ++  +  +++   + +  K+      + +E G      A+++   
Sbjct: 5   TEVVAHHWAFAVFLIVSIGLCCLMLAGAWFLGGKARGRHTNTPFESGIASVGTAKLRLSA 64

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +F LV++ FVIFD+E  +L+ W+   ++  W+GF    +F+ +L  G  Y  + GAL+W
Sbjct: 65  KFYLVAMFFVIFDVEALYLYAWSTAIRESGWVGFVEAAIFILVLLAGLFYLVRIGALDW 123


>gi|326800574|ref|YP_004318393.1| NAD(P)H-quinone oxidoreductase subunit 3 [Sphingobacterium sp. 21]
 gi|326551338|gb|ADZ79723.1| NAD(P)H-quinone oxidoreductase subunit 3 [Sphingobacterium sp. 21]
          Length = 194

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 71/125 (56%), Gaps = 9/125 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +T +  + +++ + + +V+  ++   +++ + P   K STYECG      + V+F+ RF 
Sbjct: 7   ITEFGKVFIYLIVGTFLVLFTLLLGKLLSPRKPSSAKSSTYECGEVARGSSWVQFNSRFY 66

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQ---------ITWLGFGSMMVFLGILTVGFIYEWKK 115
           +++++F++FD+E+ F+FPW   F             W     M +F+GIL VG +Y WKK
Sbjct: 67  VIALVFLLFDVEMVFIFPWTTIFGAADLIHADGRWGWYTLAEMFIFIGILLVGLLYVWKK 126

Query: 116 GALEW 120
           G LEW
Sbjct: 127 GDLEW 131


>gi|88808083|ref|ZP_01123594.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 7805]
 gi|88788122|gb|EAR19278.1| NADH dehydrogenase alpha subunit [Synechococcus sp. WH 7805]
          Length = 120

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   L F+ IA+A+ ++ +++  ++A +S   E+  TYE G +P   A ++F+IR+
Sbjct: 3   VLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQAGERQLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEW 119


>gi|256831779|ref|YP_003160506.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Jonesia
           denitrificans DSM 20603]
 gi|256685310|gb|ACV08203.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Jonesia
           denitrificans DSM 20603]
          Length = 120

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--ARVKFDI 61
           +   Y P+L+ M IA  + I  +++  ++  K  +  KL  YECG  P        KF +
Sbjct: 1   MTNPYVPLLILMGIALILAIGGVVASALIGPKKYNKAKLEAYECGIQPTPHAAEGGKFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++ LV++ F++FD+EI FL+PWAV F  +   G  +M+ FL ++TV F+YEW++G  +W
Sbjct: 61  KYYLVAMTFIVFDIEIIFLYPWAVDFAHLATFGVVAMLSFLALITVPFLYEWRRGGFDW 119


>gi|260434300|ref|ZP_05788270.1| NADH dehydrogenase i, subunit 3 [Synechococcus sp. WH 8109]
 gi|260412174|gb|EEX05470.1| NADH dehydrogenase i, subunit 3 [Synechococcus sp. WH 8109]
          Length = 120

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+  + +I+  +VA KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPTLALITNKLVAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILLVALAYAWRKGALEW 119


>gi|86606637|ref|YP_475400.1| NADH dehydrogenase subunit A [Synechococcus sp. JA-3-3Ab]
 gi|123505802|sp|Q2JT70|NU3C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|86555179|gb|ABD00137.1| NADH-ubiquinone/plastoquinone oxidoreductase, subunit 3
           [Synechococcus sp. JA-3-3Ab]
          Length = 120

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +LVF+ + + + ++ + +  ++A K     + STYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLVFLIVCALLPVLALGASALLAPKRRGSLRRSTYESGMEPFGQAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFVEALIFIAILVVGLVYAWRKGALEW 119


>gi|29831380|ref|NP_826014.1| NADH dehydrogenase subunit A [Streptomyces avermitilis MA-4680]
 gi|294630796|ref|ZP_06709356.1| NADH dehydrogenase I, A subunit [Streptomyces sp. e14]
 gi|295837125|ref|ZP_06824058.1| NADH dehydrogenase I, A subunit [Streptomyces sp. SPB74]
 gi|297201623|ref|ZP_06919020.1| NADH dehydrogenase subunit A [Streptomyces sviceus ATCC 29083]
 gi|302521195|ref|ZP_07273537.1| NADH dehydrogenase subunit A [Streptomyces sp. SPB78]
 gi|318057843|ref|ZP_07976566.1| NADH dehydrogenase subunit A [Streptomyces sp. SA3_actG]
 gi|318078941|ref|ZP_07986273.1| NADH dehydrogenase subunit A [Streptomyces sp. SA3_actF]
 gi|29608495|dbj|BAC72549.1| putative NADH dehydrogenase I chain A (complex I) [Streptomyces
           avermitilis MA-4680]
 gi|197697235|gb|EDY44168.1| NADH dehydrogenase I, A subunit [Streptomyces sp. SPB74]
 gi|197711006|gb|EDY55040.1| NADH dehydrogenase subunit A [Streptomyces sviceus ATCC 29083]
 gi|292834129|gb|EFF92478.1| NADH dehydrogenase I, A subunit [Streptomyces sp. e14]
 gi|302430090|gb|EFL01906.1| NADH dehydrogenase subunit A [Streptomyces sp. SPB78]
          Length = 119

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDALGVFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|111022872|ref|YP_705844.1| NADH dehydrogenase subunit A [Rhodococcus jostii RHA1]
 gi|110822402|gb|ABG97686.1| probable NADH dehydrogenase subunit A [Rhodococcus jostii RHA1]
          Length = 119

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PILV  AIA A  +  +I   IV  +  +  KL  YECG +P        +  ++
Sbjct: 1   MNVYVPILVLGAIAVAFAVFSVIVARIVGPRRYNRAKLDAYECGIEPTLSPLGAGRIPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV+F  + + G G+M +F+  ++V + YEW++G L WD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVHFDALGFFGLGAMALFIFNVSVAYAYEWRRGGLSWD 119


>gi|56692376|ref|YP_163966.1| NADH dehydrogenase subunit 3 [Anguilla mossambica]
 gi|56565450|dbj|BAD78121.1| NADH dehydrogenase subunits 3 [Anguilla mossambica]
          Length = 116

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILVITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +   T   F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDTTYAFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|67925381|ref|ZP_00518731.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Crocosphaera
           watsonii WH 8501]
 gi|67852777|gb|EAM48186.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Crocosphaera
           watsonii WH 8501]
          Length = 120

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S I I+ + +  I+      PE+++TYE G +P   A ++F+IR+
Sbjct: 3   ILNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERVTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   +VF+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGLLAFVEALVFISILVVALVYAWRKGALEW 119


>gi|317134295|ref|YP_004123150.1| NADH dehydrogenase subunit 3 [Plakina trilopha]
 gi|308912667|gb|ADO51429.1| NADH dehydrogenase subunit 3 [Plakina trilopha]
          Length = 122

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + I+  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCISIGLSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QI+  G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQISLFGYWTMIIFLIILTLGLVYEWIKGGLEWE 122


>gi|56692464|ref|YP_163836.1| NADH dehydrogenase subunit 3 [Anguilla australis australis]
 gi|56692478|ref|YP_163849.1| NADH dehydrogenase subunit 3 [Anguilla australis schmidti]
 gi|56565310|dbj|BAD77991.1| NADH dehydrogenase subunits 3 [Anguilla australis australis]
 gi|56565324|dbj|BAD78004.1| NADH dehydrogenase subunits 3 [Anguilla australis schmidti]
          Length = 116

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISVLIITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDTTHAFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|317097392|ref|YP_004123599.1| NADH dehydrogenase subunit 3 [Plakina crypta]
 gi|308912605|gb|ADO51371.1| NADH dehydrogenase subunit 3 [Plakina crypta]
          Length = 122

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 84/117 (71%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + I+  + I++  + +I+  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCISIGLSIIISGASYILGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|182436777|ref|YP_001824496.1| NADH dehydrogenase subunit A [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|239943476|ref|ZP_04695413.1| NADH dehydrogenase subunit A [Streptomyces roseosporus NRRL 15998]
 gi|239989930|ref|ZP_04710594.1| NADH dehydrogenase subunit A [Streptomyces roseosporus NRRL 11379]
 gi|291446947|ref|ZP_06586337.1| NuoA [Streptomyces roseosporus NRRL 15998]
 gi|326777372|ref|ZP_08236637.1| NAD(P)H-quinone oxidoreductase subunit 3 [Streptomyces cf. griseus
           XylebKG-1]
 gi|178465293|dbj|BAG19813.1| putative NADH dehydrogenase chain A [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|291349894|gb|EFE76798.1| NuoA [Streptomyces roseosporus NRRL 15998]
 gi|326657705|gb|EGE42551.1| NAD(P)H-quinone oxidoreductase subunit 3 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 119

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVSFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|56692320|ref|YP_163823.1| NADH dehydrogenase subunit 3 [Anguilla anguilla]
 gi|56692334|ref|YP_164031.1| NADH dehydrogenase subunit 3 [Anguilla rostrata]
 gi|56565296|dbj|BAD77978.1| NADH dehydrogenase subunits 3 [Anguilla anguilla]
 gi|56565520|dbj|BAD78186.1| NADH dehydrogenase subunits 3 [Anguilla rostrata]
          Length = 116

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISVLIITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTNAFFWAMSIIILLTLGLVYEWMQGGLEW 114


>gi|86609772|ref|YP_478534.1| NADH dehydrogenase subunit A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123501308|sp|Q2JJB0|NU3C_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|86558314|gb|ABD03271.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 120

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 78/117 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +LVF+ + S + I+ + +  ++A K     + STYE G +PF  A ++F+IR+
Sbjct: 3   VLSGYEYLLVFLIVCSLLPILALGASALLAPKRRGSLRRSTYESGMEPFGQAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFVEALIFIAILVVGLVYAWRKGALEW 119


>gi|57864901|gb|AAW57075.1| NADH dehydrogenase subunit C [cyanobacterium endosymbiont of
           Rhopalodia gibba]
          Length = 120

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+  +S + I+ + +  ++      PE+++TYE G +P D A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLASSLVPILALTASKLLRPSGGGPERVTTYESGMEPIDGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F Q+  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFSQLGLLAFVEALIFIAILVIALVYAWRKGALEW 119


>gi|15806518|ref|NP_295229.1| NADH dehydrogenase I subunit A [Deinococcus radiodurans R1]
 gi|6459267|gb|AAF11072.1|AE001994_8 NADH dehydrogenase I, A subunit [Deinococcus radiodurans R1]
          Length = 160

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD---ARVKFDI 61
           +  YA  L+ + +   I I+ ++   ++  K     KL  YE G DP         +F +
Sbjct: 41  IVQYANFLIMLLVGIGIGILAIVVSGLLGPKKATRTKLMAYESGNDPERGGVGTGQRFPV 100

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F LV++LF++FD+E AF +P AV ++++    F   + F+ +L VG++Y  KK  LEW
Sbjct: 101 HFYLVAMLFIVFDIETAFFYPLAVAYQKLPQFAFFEALTFVLLLLVGYVYVLKKKVLEW 159


>gi|280978413|ref|YP_003345340.1| NADH dehydrogenase subunit 3 [Serrivomer beanii]
 gi|271280553|dbj|BAI53361.1| NADH dehydrogenase subunit 3 [Serrivomer beanii]
          Length = 116

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 66/112 (58%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITTTLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +           +  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGNQLPDTTHTLFWALAIIILLTLGLVYEWTQGGLEW 114


>gi|307328621|ref|ZP_07607794.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           violaceusniger Tu 4113]
 gi|306885733|gb|EFN16746.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           violaceusniger Tu 4113]
          Length = 119

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDP--FDDARVKFDIR 62
           + +YAPILV  A+ +   I  ++   I+  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVLMAAIIGPKRYNRAKLEAYECGIEPTPHPSGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDALGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|239943527|ref|ZP_04695464.1| putative NADH dehydrogenase chain A [Streptomyces roseosporus NRRL
           15998]
 gi|239989981|ref|ZP_04710645.1| putative NADH dehydrogenase chain A [Streptomyces roseosporus NRRL
           11379]
 gi|291446995|ref|ZP_06586385.1| NADH dehydrogenase subunit NuoA2 [Streptomyces roseosporus NRRL
           15998]
 gi|291349942|gb|EFE76846.1| NADH dehydrogenase subunit NuoA2 [Streptomyces roseosporus NRRL
           15998]
          Length = 138

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S+   SY+ I +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 17  SEYFQSYSVIGLLALVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 76

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M +FLG L VG +Y WKKG L 
Sbjct: 77  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGATTLVEMFIFLGFLAVGLLYAWKKGVLA 136

Query: 120 W 120
           W
Sbjct: 137 W 137


>gi|213136341|gb|ACJ43876.1| NADH dehydrogenase subunit 3 [Taricha rivularis]
          Length = 115

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 65/110 (59%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + + I +A+   L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITLMLIITTALSTALITVGFWLPQNNPDTEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +           + L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMAPTNTMLWSTIILLLLTMGLIYEWAQGGLEW 113


>gi|56692362|ref|YP_163901.1| NADH dehydrogenase subunit 3 [Anguilla celebesensis]
 gi|56565380|dbj|BAD78056.1| NADH dehydrogenase subunits 3 [Anguilla celebesensis]
          Length = 116

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILIITTVLSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTHAFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|317176713|dbj|BAJ54513.1| NADH dehydrogenase subunit 3 [Mormyrus rume]
          Length = 116

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA  +  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTTVAIAVLLSCVLAVISFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  +    F      L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLPSPTHTFLWATAILALLTLGLVYEWVQGGLEW 114


>gi|218245901|ref|YP_002371272.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 8801]
 gi|257058949|ref|YP_003136837.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 8802]
 gi|218166379|gb|ACK65116.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 8801]
 gi|256589115|gb|ACV00002.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 8802]
          Length = 120

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F+   S + I+ + +  ++      PE+++TYE G +P   A ++F+IR+
Sbjct: 3   VLNGYEYLLGFLLACSLVPILALTASKLLRPSGGGPERVTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNRLGLLAFVEALIFIAILVIALVYAWRKGALEW 119


>gi|311896700|dbj|BAJ29108.1| putative NADH-quinone oxidoreductase subunit A [Kitasatospora setae
           KM-6054]
          Length = 135

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S    +YA I +   I    V+V   +  ++      PEKL  YECG DP  +      I
Sbjct: 14  SGYFDAYAAIGLLAVIGVLFVVVSFTANRLLRPVVDTPEKLLAYECGVDPVGEGWAHTQI 73

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  +LFPWA  F    +       M VF+G L VG +Y WKKG LE
Sbjct: 74  RYYVYAFLYVIFAVDAIYLFPWATVFSAAGFGATTLVEMFVFVGFLAVGLLYAWKKGVLE 133

Query: 120 W 120
           W
Sbjct: 134 W 134


>gi|317097376|ref|YP_004123585.1| NADH dehydrogenase subunit 3 [Plakina monolopha]
 gi|308912590|gb|ADO51357.1| NADH dehydrogenase subunit 3 [Plakina monolopha]
          Length = 122

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 83/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + I+  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCISIGLSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+F+FPW+V F QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISFIFPWSVVFNQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|33864159|ref|NP_895719.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9313]
 gi|81711998|sp|Q7TUM3|NU3C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33635743|emb|CAE22068.1| putative NADH Dehydrogenase subunit [Prochlorococcus marinus str.
           MIT 9313]
          Length = 120

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 75/116 (64%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I++A+ I+ +++  ++A +S   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLISAAVPILALVTNKLLAPRSRTGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILLVALAYAWRKGALEW 119


>gi|282860719|ref|ZP_06269785.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           sp. ACTE]
 gi|302553427|ref|ZP_07305769.1| NADH dehydrogenase subunit A [Streptomyces viridochromogenes DSM
           40736]
 gi|329935997|ref|ZP_08285797.1| NADH dehydrogenase subunit A [Streptomyces griseoaurantiacus M045]
 gi|282564455|gb|EFB69991.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           sp. ACTE]
 gi|302471045|gb|EFL34138.1| NADH dehydrogenase subunit A [Streptomyces viridochromogenes DSM
           40736]
 gi|320009204|gb|ADW04054.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Streptomyces
           flavogriseus ATCC 33331]
 gi|329304475|gb|EGG48353.1| NADH dehydrogenase subunit A [Streptomyces griseoaurantiacus M045]
          Length = 119

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|189162276|ref|YP_001936522.1| NADH dehydrogenase subunit 3 [Fagopyrum esculentum subsp.
           ancestrale]
 gi|223635353|sp|B2XWK9|NU3C_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|166065362|gb|ABY79737.1| NADH dehydrogenase subunit C [Fagopyrum esculentum subsp.
           ancestrale]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   I+A    DPEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLLISSVIPILAFLLSGILAPIRKDPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|124302911|ref|YP_001023706.1| NADH dehydrogenase subunit 3 [Angiopteris evecta]
 gi|223635379|sp|A2T338|NU3C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|110628309|gb|ABG79605.1| NADH-plastoquinone oxidoreductase subunit 3 [Angiopteris evecta]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    +F+ IAS I +       I+A  S  PEKL++YE G +P  DA ++F IR+
Sbjct: 3   LLPKYDSFWLFLLIASLIPVSAFSISKILAPVSQGPEKLTSYESGIEPMGDAWIQFQIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWA+ FK++    F   ++F+ IL +G IY W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAMSFKELGISAFIEALIFVLILIIGLIYAWRKGALEW 119


>gi|139387257|ref|YP_001123378.1| NADH dehydrogenase subunit 3 [Capsella bursa-pastoris]
 gi|223635397|sp|A4QKJ7|NU3C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286578|dbj|BAF50202.1| NADH dehydrogenase D3 [Capsella bursa-pastoris]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G DP  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIDPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|56416680|ref|YP_153754.1| NADH dehydrogenase I chain A [Anaplasma marginale str. St. Maries]
 gi|222475045|ref|YP_002563460.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Florida]
 gi|56387912|gb|AAV86499.1| NADH dehydrogenase I chain A [Anaplasma marginale str. St. Maries]
 gi|222419181|gb|ACM49204.1| NADH dehydrogenase I chain A (nuoA) [Anaplasma marginale str.
           Florida]
          Length = 135

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFD-DARVKFDIRFCL 65
            Y+ IL+F+ +A+ +  V  + P  +A K     KLS YECGFD  +      FDI+FC+
Sbjct: 20  DYSSILLFIMLAAMVSSVFAVLPAFLAGKRGSLGKLSPYECGFDQGEAPDSSSFDIKFCV 79

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V++LFVIFD+E+AFLFPWAV    I   GF SM+ F G+L VGF+YEW  GALEW+
Sbjct: 80  VAILFVIFDVEVAFLFPWAVCLGAIGAFGFWSMVFFAGLLAVGFVYEWGVGALEWE 135


>gi|88910855|gb|ABD58734.1| NADH dehydrogenase subunit 3 [Catharacta skua]
          Length = 116

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + ++  + I+L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ITFMLTLSLTLSIILTTLNFWLAQTNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q          V + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAVQLQSPSTTLTWASVIIALLTLGLIYEWTQGGLEW 114


>gi|186685600|ref|YP_001868796.1| NADH dehydrogenase subunit A [Nostoc punctiforme PCC 73102]
 gi|223635362|sp|B2J6S7|NU3C_NOSP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|186468052|gb|ACC83853.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Nostoc
           punctiforme PCC 73102]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F  I S +  + + +  ++      PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFFIICSLVPALALSASKLLRPSGYAPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   +VF+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALVYAWRKGALEW 119


>gi|308746041|ref|YP_003934563.1| NADH-plastoquinone oxidoreductase subunit 3 [Cheilanthes
           lindheimeri]
 gi|302375474|gb|ADL29848.1| NADH-plastoquinone oxidoreductase subunit 3 [Cheilanthes
           lindheimeri]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 69/117 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L   Y    +F+ ++ +I  +    P  +A     PEKL++YE G +P  D  ++F IR 
Sbjct: 3   LFHQYDSFRIFLLVSISIPFLAFSIPRFIAPTREGPEKLASYESGIEPKGDTWIRFQIRH 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++F + D+E  FL+PWA+ F+++    F  ++VF+ IL VG +Y W+KGA EW
Sbjct: 63  YMFALVFTVSDVETVFLYPWAIAFEKLGLFAFIEVIVFIFILVVGLVYAWRKGASEW 119


>gi|290958260|ref|YP_003489442.1| NADH dehydrogenase subunit NuoA [Streptomyces scabiei 87.22]
 gi|260647786|emb|CBG70891.1| NuoA, NADH dehydrogenase subunit [Streptomyces scabiei 87.22]
          Length = 119

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  +I   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVIMASLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDALGVFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|297563967|ref|YP_003682940.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|296848416|gb|ADH70434.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 121

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 73/116 (62%), Gaps = 2/116 (1%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIRFCL 65
           Y PI V   I +A V+V M++  ++  K  +  K+  YECG +P        +F +++ +
Sbjct: 6   YTPIFVLGGIGAAFVVVSMVAGAVLGPKRYNRAKMQAYECGIEPTPQPAGGGRFTVKYYM 65

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +++F++FD+EI FL PWAV+F  + W G  ++++FL  +++ + YEW++G LEWD
Sbjct: 66  TAMMFIVFDIEIIFLIPWAVHFDALGWFGLVAIVLFLVNVSIAYAYEWRRGGLEWD 121


>gi|290790853|gb|ADD63109.1| NADH-plastoquinone oxidoreductase subunit 3 [Microlaena stipoides]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 70/117 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A     PEKLS+YE G +P   A ++F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILAFWISGLLAPAREGPEKLSSYESGIEPMGGAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEW 119


>gi|297159508|gb|ADI09220.1| NADH dehydrogenase subunit A [Streptomyces bingchenggensis BCW-1]
          Length = 119

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   I+  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVLMAAIIGPKRYNRAKLEAYECGIEPTPHPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDAMGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|212640518|ref|YP_002317038.1| NADH dehydrogenase subunit A [Anoxybacillus flavithermus WK1]
 gi|212561998|gb|ACJ35053.1| NADH dehydrogenase subunit A [Anoxybacillus flavithermus WK1]
          Length = 132

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/106 (37%), Positives = 69/106 (65%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + +   + IV + +   +   +P+  K +TYE G DPF D+RV+F++R+ + ++LFVIFD
Sbjct: 26  LCLGILLPIVALTAGRFLRPHAPNAAKQTTYESGLDPFHDSRVQFNVRYYIFALLFVIFD 85

Query: 75  LEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +E  FL+PWAV F+++       M++F+ +L +G +Y WKK  L+W
Sbjct: 86  VETVFLYPWAVAFEKLGAFALIEMLIFVVMLLIGLVYAWKKKVLKW 131


>gi|5835786|ref|NP_008595.1|ND3_15063 NADH dehydrogenase subunit 3 [Carassius auratus]
 gi|6647610|sp|O78686|NU3M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|3288694|dbj|BAA31245.1| NADH dehydrogenase subunit 3 [Carassius auratus]
          Length = 116

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|57639697|gb|AAW55695.1| NADH dehydrogenase subunit 3 [Berberis bealei]
          Length = 111

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 57/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF   +  S  PEKLS +ECGFDP  DAR +FDIRF LVS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGFDPSGDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  ILFIIPDPEVTFFFPWAVSPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 110


>gi|51338760|sp|P16265|NU3M_MAIZE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
          Length = 118

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 86/118 (72%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL IL +G +YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILFIGSLYEWKRGALDWE 118


>gi|89095633|ref|ZP_01168527.1| NADH dehydrogenase subunit A [Bacillus sp. NRRL B-14911]
 gi|89089379|gb|EAR68486.1| NADH dehydrogenase subunit A [Bacillus sp. NRRL B-14911]
          Length = 122

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 71/115 (61%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y  + VF+ +   + +V +    ++    P   K +TYE G +PF D+RV+F++R+ +
Sbjct: 7   NNYLIVFVFLCLGVLLPVVALFMGKLLRPSKPSEAKYTTYESGIEPFHDSRVQFNVRYYI 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +++FVIFD+E  FL+PWAV ++++       M++F  +L +G IY WKK  L+W
Sbjct: 67  FALMFVIFDVETVFLYPWAVAYEKLGIFALIEMLIFTIMLVIGLIYAWKKKVLKW 121


>gi|262186708|ref|YP_003275967.1| NADH dehydrogenase subunit 3 [Pleurozia purpurea]
 gi|237780705|gb|ACR19351.1| NADH dehydrogenase subunit 3 [Pleurozia purpurea]
          Length = 118

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 69/84 (82%)

Query: 38  DPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGS 97
            PEKLS +ECGFDPFDDAR +FDIRF LVS+LF+IFD E+  LFPWAV   +I   GF S
Sbjct: 35  YPEKLSAHECGFDPFDDARSRFDIRFYLVSILFIIFDSEVTSLFPWAVSLNKIGSFGFWS 94

Query: 98  MMVFLGILTVGFIYEWKKGALEWD 121
           MMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 95  MMVFLLILTIGFVYEWKKGALDWE 118


>gi|149909805|ref|ZP_01898456.1| NuoA2 NADH I CHAIN A [Moritella sp. PE36]
 gi|149807137|gb|EDM67093.1| NuoA2 NADH  I CHAIN A [Moritella sp. PE36]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV-KFDIR 62
           +   + P+ + +A+   +   ++    ++   +P PEK   YECG D   +A    F ++
Sbjct: 1   MPIDFLPVFLMVAVVIMLAAFILTVSRLLRPDNPYPEKNRPYECGIDHVGEASAGLFKVQ 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + ++++LFV+FD+E  FLFPWAV    +   G+  M +F+ +L VGFIY W KGALEW+
Sbjct: 61  YFVIAILFVVFDVETMFLFPWAVVLADLGLFGYIEMFIFIMMLLVGFIYAWIKGALEWE 119


>gi|57639703|gb|AAW55698.1| NADH dehydrogenase subunit 3 [Eschscholzia californica]
          Length = 110

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 55/109 (50%), Positives = 73/109 (66%), Gaps = 1/109 (0%)

Query: 10  PILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           PI +++ I+  + ++ +  PF   +  S  PEKLS +ECG DP  DAR +FDIRF LVS+
Sbjct: 1   PICIYLVISPLVSLIPLGLPFPFASNSSTYPEKLSAHECGSDPSGDARSRFDIRFYLVSI 60

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           LF+I D E+ F FPWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 61  LFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 109


>gi|326382763|ref|ZP_08204453.1| NADH dehydrogenase subunit A [Gordonia neofelifaecis NRRL B-59395]
 gi|326198353|gb|EGD55537.1| NADH dehydrogenase subunit A [Gordonia neofelifaecis NRRL B-59395]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 71/120 (59%), Gaps = 3/120 (2%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDAR---VKFDI 61
           + +Y PIL+   +A A  +V ++   ++  +  +  KL  YECG +P         +F +
Sbjct: 1   MNAYGPILILGGVALAFAVVSVVISSVIGPRRRNRAKLEAYECGIEPLPPTAGLVQRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ L ++LF+IFD+EI FL+PWAV    + W G  ++ +F+  ++V + YEW++G L WD
Sbjct: 61  KYYLTAMLFIIFDIEIVFLYPWAVASDSLGWFGLIAVALFIVNVSVAYAYEWRRGGLRWD 120


>gi|317097476|ref|YP_004123692.1| NADH dehydrogenase subunit 3 [Plakina sp. DVL-2010]
 gi|308912636|gb|ADO51400.1| NADH dehydrogenase subunit 3 [Plakina sp. DVL-2010]
          Length = 122

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 82/117 (70%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  +  I + + I+  + I++  + + +  K PD EK+S YECGFDPF+ +R+ F +RF 
Sbjct: 6   ILEFFVIFIMLCISIGLSIIISGASYTLGAKQPDSEKVSVYECGFDPFESSRIPFSVRFF 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           L+ +LF+IFDLEI+ +FPW+V F QI   G+ +M++FL ILT+G +YEW KG LEW+
Sbjct: 66  LIGILFMIFDLEISXIFPWSVVFNQIPLFGYWTMIIFLFILTLGLVYEWVKGGLEWE 122


>gi|284928646|ref|YP_003421168.1| NADH dehydrogenase subunit A [cyanobacterium UCYN-A]
 gi|284809105|gb|ADB94810.1| NADH dehydrogenase subunit A [cyanobacterium UCYN-A]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+   + I ++ + +  I+   +  PE L+TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLIACNLIPVLALTASKILRPSNGGPETLTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F  +  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFNSLGLLAFVEALIFIAILVIALVYAWRKGALEW 119


>gi|213135991|gb|ACJ43551.1| NADH dehydrogenase subunit 3 [Cynops cyanurus]
          Length = 115

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 67/110 (60%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + + +A++ A+   L++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   VTLMLAMSVALSTALIMVSFWLPLSNPDTEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +           + L ILTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMHPVNTLFWSTIILLILTVGLVYEWAQGGLEW 113


>gi|152988279|ref|YP_001348763.1| putative NADH-ubiquinone/plastoquinone oxidoreductase [Pseudomonas
           aeruginosa PA7]
 gi|223635404|sp|A6V6S8|NUOA2_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit A 2; AltName:
           Full=NADH dehydrogenase I subunit A 2; AltName:
           Full=NDH-1 subunit A 2; AltName: Full=NUO1 2
 gi|150963437|gb|ABR85462.1| probable NADH-ubiquinone/plastoquinone oxidoreductase [Pseudomonas
           aeruginosa PA7]
          Length = 132

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              + ++  A A+ +V++    ++  +S    K   +E G D    AR++F +++ LV++
Sbjct: 10  WAFIAYVLGAVALCLVMLGLGRVLGGRSHGRAKNLPFESGVDSTGSARLRFPVKYALVAM 69

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LFVIF +E+ FL+ WAV  ++  W GF  + +F+ +L  G  Y  + GAL+W
Sbjct: 70  LFVIFGIEMPFLYLWAVSVRENGWAGFVEVALFVSLLLAGLFYLHRVGALDW 121


>gi|21222945|ref|NP_628724.1| NADH dehydrogenase subunit A [Streptomyces coelicolor A3(2)]
 gi|239929614|ref|ZP_04686567.1| NADH dehydrogenase subunit A [Streptomyces ghanaensis ATCC 14672]
 gi|256785941|ref|ZP_05524372.1| NADH dehydrogenase subunit A [Streptomyces lividans TK24]
 gi|289769833|ref|ZP_06529211.1| NuoA [Streptomyces lividans TK24]
 gi|291437938|ref|ZP_06577328.1| NuoA [Streptomyces ghanaensis ATCC 14672]
 gi|297192788|ref|ZP_06910186.1| NADH-quinone oxidoreductase subunit A [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|5042277|emb|CAB44531.1| NuoA, NADH dehydrogenase subunit [Streptomyces coelicolor A3(2)]
 gi|197721025|gb|EDY64933.1| NADH-quinone oxidoreductase subunit A [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|289700032|gb|EFD67461.1| NuoA [Streptomyces lividans TK24]
 gi|291340833|gb|EFE67789.1| NuoA [Streptomyces ghanaensis ATCC 14672]
          Length = 119

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIIFDIEIVFLYPWAVTFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|229118796|ref|ZP_04248146.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock1-3]
 gi|228664666|gb|EEL20158.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock1-3]
          Length = 122

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 68/115 (59%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y  +L+F+ +   + +V +    ++    P   K +TYE G +PF DA ++F  R+ +
Sbjct: 7   NNYMIVLIFLLVGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYI 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV + ++       M++F+ +L VG  Y WKK  L+W
Sbjct: 67  FALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQW 121


>gi|78221377|ref|YP_383124.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Geobacter
           metallireducens GS-15]
 gi|123572942|sp|Q39ZC5|NUOA1_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit A 1; AltName:
           Full=NADH dehydrogenase I subunit A 1; AltName:
           Full=NDH-1 subunit A 1; AltName: Full=NUO1 1
 gi|78192632|gb|ABB30399.1| NADH dehydrogenase subunit A [Geobacter metallireducens GS-15]
          Length = 138

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 67/114 (58%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            + P+ ++   A+ ++ VL+++ + +  K+ +  K   YE G  P   AR+ + + F L+
Sbjct: 18  EFLPLALYTVAATVLIGVLLLAAWWLGAKTTNRNKELPYESGVIPTGSARLAYPVPFYLI 77

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++ F++FD+E AF+F WA  ++++   G   +  F+ IL +G ++ W KG L+W
Sbjct: 78  AIFFIVFDVEAAFIFAWATAWRELGLAGLIHITFFIVILLLGLVWLWMKGGLDW 131


>gi|254525437|ref|ZP_05137489.1| NAD(P)H-quinone oxidoreductase chain 3 [Prochlorococcus marinus
           str. MIT 9202]
 gi|221536861|gb|EEE39314.1| NAD(P)H-quinone oxidoreductase chain 3 [Prochlorococcus marinus
           str. MIT 9202]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K  + E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRNGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|72383496|ref|YP_292851.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL2A]
 gi|124025087|ref|YP_001014203.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL1A]
 gi|123621503|sp|Q46M04|NU3C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|223635398|sp|A2C0C8|NU3C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|72003346|gb|AAZ59148.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. NATL2A]
 gi|123960155|gb|ABM74938.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. NATL1A]
          Length = 120

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 73/116 (62%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I+ A+ I+ + +  ++A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LQGYEYFLGFLLISGAVPILALTTNKLIAPKSKAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   +VF+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALVFITILVVALAYAWRKGALEW 119


>gi|284054940|ref|ZP_06385150.1| NADH dehydrogenase subunit A [Arthrospira platensis str. Paraca]
 gi|291566378|dbj|BAI88650.1| NADH dehydrogenase subunit 3 [Arthrospira platensis NIES-39]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 71/117 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y   L F+ I S + I+ + +  I+  +S    +  TYE G +P   A ++F+IR+
Sbjct: 3   FLNGYEYFLGFLIICSLVPILALGASKILRPQSRSATRRITYESGCEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFITILVIALVYAWRKGALEW 119


>gi|72163094|ref|YP_290751.1| NADH dehydrogenase subunit A [Thermobifida fusca YX]
 gi|71916826|gb|AAZ56728.1| putative NADH dehydrogenase chain A [Thermobifida fusca YX]
          Length = 119

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           +  Y PI V   I +A VIV MI   I   K  +  KL  YECG +P        +F I+
Sbjct: 1   MELYTPIFVLGGIGAAFVIVSMIVGAIAGPKRYNRTKLQAYECGIEPTPQPVGGGRFTIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+E+ FL PWAV+   +   G   M++FL  +++ + YEW++G LEW+
Sbjct: 61  YYLTAMLFIVFDIEVIFLVPWAVHLDALGIFGLVVMILFLVNVSIAYAYEWRRGGLEWN 119


>gi|297192752|ref|ZP_06910150.1| NADH dehydrogenase subunit NuoA2 [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721060|gb|EDY64968.1| NADH dehydrogenase subunit NuoA2 [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 132

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           ++   SY+ + +   I    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 11  TEYFRSYSVVGLLALIGVLFVAVAFTAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 70

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYF--KQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F            M +FLG L VG +Y WKKG L 
Sbjct: 71  RYYVYAFLYVIFAVDSIFLFPWATVFAADGYGATTLVEMFIFLGFLAVGLLYAWKKGVLT 130

Query: 120 W 120
           W
Sbjct: 131 W 131


>gi|108796790|ref|YP_636386.1| NADH dehydrogenase subunit 3 [Staurastrum punctulatum]
 gi|122211807|sp|Q32RZ0|NU3C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|61393558|gb|AAX45699.1| subunit 3 of NADH-plastoquinone oxidoreductase [Staurastrum
           punctulatum]
          Length = 121

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 75/118 (63%), Gaps = 1/118 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIR 62
           +L  Y     F+ IA  I ++ +    +VA   S +PEK +TYE G +P  ++ ++F IR
Sbjct: 3   ILPKYESFWAFLLIACLIPVLAISVSNLVAPSTSKNPEKSTTYESGIEPMGESWIQFQIR 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + +++FVIFD+E  FL+PWA+ F  +  + F  ++VF+ IL +G IY W+KGALEW
Sbjct: 63  YYMFALVFVIFDVETVFLYPWAMSFDDLGIIAFAEVLVFVIILIIGLIYAWRKGALEW 120


>gi|119360729|ref|YP_913712.1| NADH dehydrogenase subunit 3 [Leptobotia mantschurica]
 gi|119225437|dbj|BAF41786.1| NADH dehydrogenase subunit 3 [Leptobotia mantschurica]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IITILVITTALSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|298490488|ref|YP_003720665.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3 ['Nostoc
           azollae' 0708]
 gi|298232406|gb|ADI63542.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 ['Nostoc
           azollae' 0708]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y  +L F  + S +  + + +  ++   S  PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLKGYEYLLGFFLLCSLVPALALSASKLLRPSSFSPERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALVYAWRKGALEW 119


>gi|301061278|ref|ZP_07202060.1| putative NADH dehydrogenase subunit A [delta proteobacterium
           NaphS2]
 gi|300444597|gb|EFK08580.1| putative NADH dehydrogenase subunit A [delta proteobacterium
           NaphS2]
          Length = 133

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/112 (36%), Positives = 66/112 (58%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
             + ++ A+  A+V V++     +  K P+ EK + YECG  P  +AR ++ + F  V++
Sbjct: 18  FSLALYTALVLALVSVMLFLCTWLGEKKPNSEKTTPYECGILPTGNARFRYPVPFYRVAL 77

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            F+IFDLE  F+F WAV FK++ W G+  +  F+ +L +   Y WKKG L W
Sbjct: 78  FFLIFDLEAVFIFAWAVAFKELGWAGWVQITFFILVLLLSLFYVWKKGGLHW 129


>gi|295697421|ref|YP_003590659.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
 gi|295413023|gb|ADG07515.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           tusciae DSM 2912]
          Length = 122

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 58/112 (51%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
             I +F+AI   + IV      ++       EK  TYE G      + V+F +++ L ++
Sbjct: 10  LLIALFVAIGVGLPIVAFSLSRLLRPHHAYREKGETYESGNLTVGTSWVRFHVKYYLFAL 69

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LFV+FD+E  FL+PWAV +  +       + +FL IL  G  Y W++  LEW
Sbjct: 70  LFVVFDVETLFLYPWAVAYDALGTFALAEVGIFLFILVFGLYYAWRQEVLEW 121


>gi|94502644|ref|YP_588354.1| NADH dehydrogenase subunit 3 [Zea mays subsp. mays]
 gi|40795083|gb|AAR91127.1| NADH dehydrogenase subunit 3 [Zea mays]
          Length = 118

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 86/118 (72%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ A  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL IL +G +YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILMIGSLYEWKRGALDWE 118


>gi|304312240|ref|YP_003811838.1| NADH dehydrogenase I, chain A [gamma proteobacterium HdN1]
 gi|301797973|emb|CBL46195.1| NADH dehydrogenase I, chain A [gamma proteobacterium HdN1]
          Length = 139

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 60/118 (50%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
            ++    P+  +      IV V++     +  K  +P  +  +E G      AR +  I 
Sbjct: 8   SVIPPIWPLAAYFVATLLIVCVILALSHFLGHKRRNPATIEPFESGIVSVGTARYRVPIP 67

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F L+++ FVIFDLE  FLF WA+ F++  W G+   M+F+ IL     Y WK GAL+W
Sbjct: 68  FYLLAIFFVIFDLEAIFLFAWAIAFREAGWAGYIEAMIFISILGATLAYLWKLGALDW 125


>gi|84508583|ref|YP_448631.1| NADH dehydrogenase subunit 3 [Fucus vesiculosus]
 gi|39653306|gb|AAR29325.1| NADH dehydrogenase subunit 3 [Fucus vesiculosus]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 80/118 (67%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            L  Y P L+++  +  +  V+  + + +A    D EKLS+YECGFDP++DAR  FD+RF
Sbjct: 3   FLKEYYPALIYLCFSLLLASVIFGASYTLAMSEADSEKLSSYECGFDPYEDARNAFDVRF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FD+E  FLFPWA    Q+  +G+ SM+ FL  L +GFIY W+ G+L+W+
Sbjct: 63  YLVAILFLLFDIETVFLFPWAASLSQLPAIGYWSMIDFLFELVIGFIYAWQIGSLDWE 120


>gi|22711912|ref|NP_683808.1| NADH dehydrogenase subunit 3 [Chaetosphaeridium globosum]
 gi|75302099|sp|Q8M9X8|NU3C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|22416916|gb|AAM96516.1| subunit 3 of NADH-plastoquinone oxidoreductase [Chaetosphaeridium
           globosum]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           + + Y     F+ I + I  +   +  ++A     PEK ++YE G +P  +A ++F IR+
Sbjct: 3   VFSKYKTFWFFLIIGAIIPTLAFTTSKLLAPTVTTPEKKTSYESGIEPIGEAWIQFQIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWA+ F Q+   GF   ++F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETIFLYPWAMSFDQLGVYGFIEALIFVLILVIGLVYAWRKGALEW 119


>gi|118617946|ref|YP_906278.1| NADH dehydrogenase subunit A [Mycobacterium ulcerans Agy99]
 gi|118570056|gb|ABL04807.1| NADH dehydrogenase I (chain a) NuoA (NADH- ubiquinone
           oxidoreductase chain a) [Mycobacterium ulcerans Agy99]
          Length = 127

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 68/127 (53%), Gaps = 10/127 (7%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--------- 55
           + +Y PILV   +A+   +V ++   +V     +  KL+ YECG +P +           
Sbjct: 1   MNAYIPILVLATLAAGFAVVSVVIASLVGPTRFNRSKLAAYECGIEPTEAQAGASGRETA 60

Query: 56  -RVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWK 114
              +F +++ L ++LF++FD+EI FL+PWAV F  +       M +F+  + V + Y W+
Sbjct: 61  SGQRFPVKYYLTAMLFIVFDIEIVFLYPWAVSFDALGTFALVEMAIFMLTVFVAYAYVWR 120

Query: 115 KGALEWD 121
           +G L WD
Sbjct: 121 RGGLTWD 127


>gi|305666196|ref|YP_003862483.1| proton-translocating NADH-quinone oxidoreductase subunit A
           [Maribacter sp. HTCC2170]
 gi|88707695|gb|EAQ99936.1| proton-translocating NADH-quinone oxidoreductase, A subunit
           [Maribacter sp. HTCC2170]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 66/112 (58%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            I+VF+     +V        +++ KS +P K   YE G        V+F + + L ++L
Sbjct: 5   AIIVFLIAGIVLVAGANFLSNLISHKSDNPSKREPYESGMKTIGPTWVQFKVGYYLFAIL 64

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           F+IFD+E+AFL PWAV FK    + F  +++FL IL +G +Y WKKGAL+W+
Sbjct: 65  FLIFDVEVAFLIPWAVVFKDFGAIAFIEVLIFLVILGLGLLYAWKKGALKWE 116


>gi|128714|sp|P18630|NU3M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|66159|pir||DNOBU3 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 3 - evening
           primrose mitochondrion
 gi|13179|emb|CAA36454.1| nad3 protein (AA 1 - 118) [Oenothera berteroana]
          Length = 118

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API + + I+  + ++L++ PF+ +  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICISLVISLLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV F +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSFNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|134299892|ref|YP_001113388.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Desulfotomaculum reducens MI-1]
 gi|223635452|sp|A4J660|NUOA_DESRM RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|134052592|gb|ABO50563.1| NADH dehydrogenase subunit A [Desulfotomaculum reducens MI-1]
          Length = 117

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 67/116 (57%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ +  + +F+ +        M++ F++  +S +  KL TYECG        V+F  ++ 
Sbjct: 1   MSDWIGVALFIVVGIVFGAGGMLTSFLIHPRSKNKFKLETYECGLPTEGATWVRFKTQYF 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
             +++FVIFD+E+ +L+PWAV F  +   G   M +F+ IL +G  Y WK+GALEW
Sbjct: 61  TYALMFVIFDVEVIYLYPWAVSFVDLGLAGLIKMFLFIFILVLGLWYAWKEGALEW 116


>gi|332887064|dbj|BAK23167.1| NADH dehydrogenase subunit 3 [Leptocypris sp. CBM ZF 11419]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   + IA+A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTAMIIIATALSVILATVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G        L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTLFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|164421183|ref|YP_001648569.1| NADH dehydrogenase subunit 3 [Ptilocaulis walpersi]
 gi|158938965|gb|ABW83890.1| NADH dehydrogenase subunit 3 [Ptilocaulis walpersi]
          Length = 118

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 79/118 (66%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +   +  I + +  +  +  V+    +I+  K PD EK+S YECG+DPF  +R+ F ++F
Sbjct: 1   MNLEFIGIFLLLLFSIILSSVISGVSYIIGIKQPDSEKVSVYECGYDPFGSSRILFSVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV +LF+IFDLEI+FLFPWAV ++QI   G+  M +FL ILT+G IYEW +G LEW+
Sbjct: 61  FLVGILFLIFDLEISFLFPWAVTYQQIGLFGYWVMYLFLIILTIGLIYEWVQGGLEWE 118


>gi|139388915|ref|YP_001123642.1| NADH dehydrogenase subunit 3 [Lepidium virginicum]
 gi|139389423|ref|YP_001123120.1| NADH dehydrogenase subunit 3 [Olimarabidopsis pumila]
 gi|223635369|sp|A4QJT8|NU3C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635413|sp|A4QLB1|NU3C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286317|dbj|BAF49944.1| NADH dehydrogenase D3 [Olimarabidopsis pumila]
 gi|134286845|dbj|BAF50466.1| NADH dehydrogenase D3 [Lepidium virginicum]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEALIFVLILILGLVYAWRKGALEW 119


>gi|302543444|ref|ZP_07295786.1| NADH dehydrogenase I, A subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302461062|gb|EFL24155.1| NADH dehydrogenase I, A subunit [Streptomyces himastatinicus ATCC
           53653]
          Length = 119

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   I+  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMAAIIGPKRYNRAKLEAYECGIEPTPHPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIVFLYPWAVTFDALGLFGLVEMLLFVLTVFVAYGYVWRRGGLEWD 119


>gi|33864743|ref|NP_896302.1| NADH dehydrogenase subunit A [Synechococcus sp. WH 8102]
 gi|81712323|sp|Q7U9P6|NU3C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33632266|emb|CAE06722.1| NADH dehydrogenase I chain 3 (or A) [Synechococcus sp. WH 8102]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 73/116 (62%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+  + +I+   +A KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLIAAAVPALALITNKFLAPKSRAGERQLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHRLGVLAFIEALIFITILLVALAYAWRKGALEW 119


>gi|280978147|ref|YP_003345093.1| NADH dehydrogenase subunit 3 [Nessorhamphus ingolfianus]
 gi|271280425|dbj|BAI53270.1| NADH dehydrogenase subunit 3 [Nessorhamphus ingolfianus]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           P++  + I +A+  +L+I  F +    PD EKLS YECGFDP   AR+ F +RF L+++L
Sbjct: 3   PVISILMITTALSCILIIVSFWLPQMKPDSEKLSPYECGFDPLGSARLPFSMRFFLIAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F      L +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPIPWGNQLPNPTQSFFWATSILILLTLGLVYEWVQGGLEW 114


>gi|313199707|ref|YP_004021321.1| NADH-plastoquinone oxidoreductase subunit 3 [Theobroma cacao]
 gi|309321271|gb|ADO64814.1| NADH-plastoquinone oxidoreductase subunit 3 [Theobroma cacao]
 gi|328924788|gb|ADO64895.2| NADH-plastoquinone oxidoreductase subunit 3 [Theobroma cacao]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI I+  +   ++A     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPILAFLISGVLAPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|196167861|ref|YP_002128429.1| NADH dehydrogenase subunit 3 [Mylopharyngodon piceus]
 gi|63081829|gb|AAY30691.1| NADH dehydrogenase subunit 3 [Mylopharyngodon piceus]
 gi|195969571|gb|ACG60616.1| NADH dehydrogenase subunit 3 [Mylopharyngodon piceus]
 gi|195969599|gb|ACG60642.1| NADH dehydrogenase subunit 3 [Mylopharyngodon piceus]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I  A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILTITVALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|296169192|ref|ZP_06850845.1| NADH-quinone oxidoreductase subunit A [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295896090|gb|EFG75757.1| NADH-quinone oxidoreductase subunit A [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 125

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 8/125 (6%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD--------AR 56
           +  Y PILV  AIA+A  +  ++   +      +  K++ YECG +P +           
Sbjct: 1   MNVYIPILVLGAIAAAFAVGSVVIASLAGPSRYNKSKMAPYECGIEPTETSVSGPHATPG 60

Query: 57  VKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKG 116
            +F +++ L ++LF++FD+EI FL+PWAV +  +       M+VF+  + V + Y W++G
Sbjct: 61  QRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALVEMVVFMLTVFVAYAYVWRRG 120

Query: 117 ALEWD 121
            L WD
Sbjct: 121 GLTWD 125


>gi|280978217|ref|YP_003345158.1| NADH dehydrogenase subunit 3 [Anarchias sp. Ansp]
 gi|271280198|dbj|BAI53179.1| NADH dehydrogenase subunit 3 [Anarchias sp. Ansp]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITTTLSCVLITVSFWLPQMNPDLEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +   T        + L +LT G  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGNQLPDTTQTLTWAALILILLTAGLAYEWAQGGLEW 114


>gi|139389806|ref|YP_001123467.1| NADH dehydrogenase subunit 3 [Crucihimalaya wallichii]
 gi|139390157|ref|YP_001123730.1| NADH dehydrogenase subunit 3 [Lobularia maritima]
 gi|223635358|sp|A4QLJ9|NU3C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635391|sp|A4QKT6|NU3C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286668|dbj|BAF50291.1| NADH dehydrogenase D3 [Crucihimalaya wallichii]
 gi|134286934|dbj|BAF50554.1| NADH dehydrogenase D3 [Lobularia maritima]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|296940259|ref|YP_003667941.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|146142365|gb|ABQ01628.1| NADH dehydrogenase subunit 3 [Carassius auratus]
 gi|269849168|gb|ACZ49736.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|326320984|gb|ADZ53485.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|326320998|gb|ADZ53498.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITTALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|157412656|ref|YP_001483522.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9215]
 gi|223635399|sp|A8G2V5|NU3C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|157387231|gb|ABV49936.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9215]
          Length = 120

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL+ Y   L F+ IA+A+ I+ +++  IVA K  + E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLSGYEYFLGFLLIAAAVPILALVTNLIVAPKGRNGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|110637787|ref|YP_677994.1| NADH dehydrogenase I subunit A [Cytophaga hutchinsonii ATCC 33406]
 gi|123354650|sp|Q11VB2|NUOA_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|110280468|gb|ABG58654.1| NADH dehydrogenase subunit A [Cytophaga hutchinsonii ATCC 33406]
          Length = 126

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/126 (37%), Positives = 75/126 (59%), Gaps = 5/126 (3%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M++    Y PI + + +    + V ++S +++  K    +KL  +E G DP  +ARV+F 
Sbjct: 1   MNNKYAEYLPIAIQLMVTLGFISVTLLSSWLLGPKVKSKKKLDAFESGLDPVGNARVQFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQ-----ITWLGFGSMMVFLGILTVGFIYEWKK 115
           I++ LV+ LFV+FD+E+ F +PWAV F         W GF  M++F+  L +GFIY  KK
Sbjct: 61  IKYFLVATLFVLFDVEVIFFYPWAVNFNYFAEAVNKWEGFVKMLLFMTSLLIGFIYVIKK 120

Query: 116 GALEWD 121
            AL+W+
Sbjct: 121 KALDWE 126


>gi|45388037|ref|NP_991087.1| NADH dehydrogenase subunit 3 [Synaphobranchus kaupii]
 gi|280978511|ref|YP_003345431.1| NADH dehydrogenase subunit 3 [Ilyophis brunneus]
 gi|45259671|dbj|BAD12345.1| NADH dehydrogenase subunit 3 [Synaphobranchus kaupii]
 gi|271280389|dbj|BAI53244.1| NADH dehydrogenase subunit 3 [Ilyophis brunneus]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 64/112 (57%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+    I  A+  +L+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISVFMITIALSCILITISFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F      L +LT+G  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDPAQTFFWATSILVLLTLGLAYEWAQGGLEW 114


>gi|301322955|gb|ADK70249.1| NADH dehydrogenase subunit 3 [Thamnomanes schistogynus]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 70/112 (62%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            IL  + ++S++ I+L +  F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   TILFMLTLSSSLSIILTLLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     + Q          V + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPLTTLTWSSVIILLLTLGLVYEWTQGGLEW 114


>gi|122935337|gb|ABM68376.1| NADH dehydrogenase subunit 3 [Thamnomanes caesius]
          Length = 109

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/107 (43%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           + ++S++ I+L +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LTLSSSLSIILTLLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L P     + Q            + +LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLTTLTWSSAIILLLTLGLVYEWTQGGLEW 107


>gi|5835026|ref|NP_007089.1|ND3_10464 NADH dehydrogenase subunit 3 [Cyprinus carpio]
 gi|128706|sp|P24974|NU3M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|12836|emb|CAA43334.1| NADH ubiquinone oxidoreductase subunit 3 [Cyprinus carpio]
 gi|110238765|dbj|BAE97656.1| NADH dehydrogenase subunit 3 [Cyprinus carpio]
          Length = 116

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|332886784|dbj|BAK22907.1| NADH dehydrogenase subunit 3 [Macrochirichthys macrochirus]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI +A+  +L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTTLAITTALSSILAFVSFWLPQINPDTEKLSPYECGFDPVGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|7525038|ref|NP_051064.1| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|6685677|sp|P56751|NU3C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|5881699|dbj|BAA84390.1| NADH dehydrogenase D3 [Arabidopsis thaliana]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLLISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|17231334|ref|NP_487882.1| NADH dehydrogenase subunit A [Nostoc sp. PCC 7120]
 gi|75908079|ref|YP_322375.1| NADH dehydrogenase subunit A [Anabaena variabilis ATCC 29413]
 gi|61228933|sp|P0A3S5|NU3C_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|61228934|sp|P0A3S6|NU3C_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|5139324|emb|CAB45639.1| NDH-C protein [Nostoc sp. PCC 7120]
 gi|5139341|emb|CAB45646.1| NDH-C protein [Anabaena variabilis]
 gi|17132976|dbj|BAB75541.1| NADH dehydrogenase subunit 3 [Nostoc sp. PCC 7120]
 gi|75701804|gb|ABA21480.1| NADH dehydrogenase subunit A [Anabaena variabilis ATCC 29413]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ I S +  + + +  ++       E+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLIICSLVPALALSASKLLRPTGNSLERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   ++F+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALVYAWRKGALEW 119


>gi|319901165|ref|YP_004160893.1| NADH dehydrogenase subunit A [Bacteroides helcogenes P 36-108]
 gi|319416196|gb|ADV43307.1| NADH dehydrogenase subunit A [Bacteroides helcogenes P 36-108]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 71/114 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++  ++V +  A A V +++     +A +S +P+K+  YECG      + ++F + + L 
Sbjct: 2   NFTLLVVVLLTAIAFVGIVIALSNAIAPRSYNPQKMEPYECGIPTRGKSWMQFRVGYYLF 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++F++E  FLFPWAV  +++   G  S++ FL IL +G  Y W+KGALEW
Sbjct: 62  AILFLMFEVETVFLFPWAVITRELGVTGLFSILFFLTILVLGLAYAWRKGALEW 115


>gi|11467110|ref|NP_054411.1| NADH dehydrogenase subunit 3 [Marchantia polymorpha]
 gi|464236|sp|P26847|NU3M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 3; AltName:
           Full=NADH dehydrogenase subunit 3
 gi|404358|gb|AAB27399.1| NADH dehydrogenase subunit 3=nad3 gene product [Marchantia
           polymorpha=liverworts, Peptide Mitochondrial, 118 aa]
 gi|786195|gb|AAC09408.1| nad3 [Marchantia polymorpha]
          Length = 118

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 62/84 (73%), Positives = 71/84 (84%)

Query: 38  DPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGS 97
            PEKLS YECGFDPFDDAR +FDIRF LVS+LF+IFDLE+ FLFPWAV   +I   GF S
Sbjct: 35  YPEKLSAYECGFDPFDDARSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWS 94

Query: 98  MMVFLGILTVGFIYEWKKGALEWD 121
           MMVFL ILT+GF+YEWKKGAL+W+
Sbjct: 95  MMVFLFILTIGFVYEWKKGALDWE 118


>gi|284794681|ref|YP_003412038.1| NADH dehydrogenase subunit 3 [Gila conspersa]
 gi|284507235|dbj|BAI67664.1| NADH dehydrogenase subunit-3 [Gila conspersa]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + +  AI +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTIIFAITAALSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|297837945|ref|XP_002886854.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297837991|ref|XP_002886877.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297840987|ref|XP_002888375.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297332695|gb|EFH63113.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297332718|gb|EFH63136.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297334216|gb|EFH64634.1| NADH dehydrogenase subunit 3 [Arabidopsis lyrata subsp. lyrata]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLLISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGASAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|11466212|ref|NP_066535.1| NADH dehydrogenase subunit 3 [Naegleria gruberi]
 gi|10444247|gb|AAG17813.1|AF288092_38 NADH dehydrogenase subunit 3 [Naegleria gruberi]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 83/118 (70%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
            LT Y     +  +  AI  ++++  +I+ FK+P  EK   YECGFDPF DAR  F ++F
Sbjct: 3   FLTEYYEYYFYGVLILAISFIILLLCYIITFKNPYTEKNYGYECGFDPFSDARNPFHVKF 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            L+S++F+IFD+E+AF FPWA+  K++ + G+ +M +F+ IL VGF+YEWKKGALEW+
Sbjct: 63  YLISIIFIIFDVEVAFFFPWAISIKELMFFGYYTMYLFIFILLVGFVYEWKKGALEWE 120


>gi|256985413|ref|YP_003162843.1| NADH dehydrogenase subunit 3 [Sinocyclocheilus grahami]
 gi|238683591|gb|ACR54077.1| NADH dehydrogenase subunit 3 [Sinocyclocheilus grahami]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ +VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITTALSLVLAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +              L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTETLFWATTVLILLTLGLVYEWTQGGLEW 114


>gi|198276151|ref|ZP_03208682.1| hypothetical protein BACPLE_02340 [Bacteroides plebeius DSM 17135]
 gi|198270963|gb|EDY95233.1| hypothetical protein BACPLE_02340 [Bacteroides plebeius DSM 17135]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 65/113 (57%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  I+V +  A  +V+  M    ++A +S +P+K   YECG      + V+F   + L +
Sbjct: 3   FTFIIVVILTAIVLVVAAMTIAKLLAPRSFNPQKGEPYECGIPTRGQSWVQFKAGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLFPWAV   Q+      S+  FL +L +G  Y W+KGALEW
Sbjct: 63  ILFLMFDIETVFLFPWAVVADQVGVYALVSVGFFLVVLILGLAYAWRKGALEW 115


>gi|120586760|ref|YP_961337.1| NADH dehydrogenase subunit 3 [Opsariichthys bidens]
 gi|86450356|gb|ABC96653.1| NADH dehydrogenase subunit 3 [Opsariichthys bidens]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+    IA A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIFTIAVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|75755664|ref|YP_319770.1| NADH dehydrogenase subunit 3 [Acorus calamus]
 gi|161622315|ref|YP_001586187.1| NADH dehydrogenase subunit 3 [Acorus americanus]
 gi|122217413|sp|Q3V529|NU3C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635383|sp|A9LYA6|NU3C_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|74381714|emb|CAI53799.1| NADH dehydrogenase D3 [Acorus calamus]
 gi|156573639|gb|ABU85153.1| NADH-plastoquinone oxidoreductase subunit 3 [Acorus americanus]
 gi|160369858|gb|ABX38749.1| NADH-plastoquinone oxidoreductase subunit 3 [Acorus americanus]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++A     PEKLS+YE G +P  DA V+F IR+
Sbjct: 3   LLHEYDIFWAFLLISSVIPILAFLISGVLAPTREGPEKLSSYESGIEPIGDAWVQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFLEALIFVLILIVGSVYAWRKGALEW 119


>gi|229076514|ref|ZP_04209475.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock4-18]
 gi|229099733|ref|ZP_04230659.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock3-29]
 gi|229105892|ref|ZP_04236517.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock3-28]
 gi|229164246|ref|ZP_04292179.1| NADH-quinone oxidoreductase subunit [Bacillus cereus R309803]
 gi|228619186|gb|EEK76079.1| NADH-quinone oxidoreductase subunit [Bacillus cereus R309803]
 gi|228677523|gb|EEL31775.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock3-28]
 gi|228683703|gb|EEL37655.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock3-29]
 gi|228706606|gb|EEL58818.1| NADH-quinone oxidoreductase subunit [Bacillus cereus Rock4-18]
          Length = 122

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 68/115 (59%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            SY  +L+F+ +   + +V +    ++    P   K +TYE G +PF DA ++F  R+ +
Sbjct: 7   NSYMIVLIFLLVGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYI 66

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            ++LFVIFD+E  FL+PWAV + ++       M++F+ +L VG  Y WKK  L+W
Sbjct: 67  FALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQW 121


>gi|316996004|dbj|BAD83443.2| NADH dehydrogenase subunit 3 [Nicotiana tabacum]
          Length = 118

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 1/118 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRF 63
           +  +API +++ I+  + ++L+  PF+ +  S   PEKLS YECGFDPF DAR +FDIRF
Sbjct: 1   MLEFAPICIYLVISLLVSLLLLGLPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LVS+LF+IFDLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GAL+W+
Sbjct: 61  YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE 118


>gi|301353486|ref|YP_003795706.1| NADH dehydrogenase subunit 3 [Morone saxatilis]
 gi|300069614|gb|ADJ66716.1| NADH dehydrogenase subunit 3 [Morone saxatilis]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA+ + I+L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTMIAIATTLSIILAVVSFWLPQMTPDHEKLSPYECGFDPLGTARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F    + L +LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLPAPLATFTWATIVLALLTLGLAYEWVQGGLEW 114


>gi|209427680|ref|YP_002274339.1| NADH dehydrogenase subunit 3 [Micropterus dolomieu]
 gi|208972967|dbj|BAG74324.1| NADH dehydrogenase subunit 3 [Micropterus dolomieu]
 gi|208972981|dbj|BAG74337.1| NADH dehydrogenase subunit 3 [Micropterus dolomieu]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   + IA+A+ I+L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTTIICIATALCIILAIVSFWLPQMNPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLTSPLTTFLWASAVLILLTLGLIYEWTQGGLEW 114


>gi|51235012|ref|YP_063502.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
 gi|52221018|ref|YP_087038.1| NADH dehydrogenase subunit 3 [Carassius carassius]
 gi|55338286|ref|YP_133900.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio x
           Carassius cuvieri]
 gi|56912175|ref|YP_173343.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|254033653|ref|YP_003058372.1| NADH dehydrogenase subunit 3 [natural gynogenetic Carassius auratus
           red var.]
 gi|261866631|ref|YP_003264285.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala tetraploid hybrid]
 gi|261866645|ref|YP_003264298.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala triploid hybrid]
 gi|50657569|gb|AAT79573.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
 gi|51339769|gb|AAU00636.1| NADH dehydrogenase subunit 3 [Carassius carassius]
 gi|54288027|gb|AAV31462.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio x
           Carassius cuvieri]
 gi|56798136|dbj|BAD82936.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|251765224|gb|ACT15379.1| NADH dehydrogenase subunit 3 [natural gynogenetic Carassius auratus
           red var.]
 gi|260595467|gb|ACX46723.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala tetraploid hybrid]
 gi|260595481|gb|ACX46736.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala triploid hybrid]
 gi|262211490|gb|ACY35578.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|262211504|gb|ACY35591.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|262211518|gb|ACY35604.1| NADH dehydrogenase subunit 3 [Carassius auratus auratus]
 gi|268373358|gb|ACZ03931.1| NADH dehydrogenase subunit 3 [Carassius gibelio]
 gi|270301399|gb|ACZ69579.1| NADH dehydrogenase subunit 3 [Carassius auratus x Cyprinus carpio]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLNNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|13116548|ref|NP_076863.1| NADH dehydrogenase subunit 3 [Aulopus japonicus]
 gi|12964655|dbj|BAB32683.1| NADH dehydrogenase subunit 3 [Aulopus japonicus]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA+A+  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IATVLLIATALSSVLALVSFWLPQMNPDTEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  T +  F    + L +LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLTTPISTFCWTTIVLSLLTLGLAYEWTQGGLEW 114


>gi|302559107|ref|ZP_07311449.1| NADH dehydrogenase I, A subunit [Streptomyces griseoflavus Tu4000]
 gi|302476725|gb|EFL39818.1| NADH dehydrogenase I, A subunit [Streptomyces griseoflavus Tu4000]
          Length = 119

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + +YAPILV  A+ +   I  ++   ++  K  +  KL  YECG +P        +F I+
Sbjct: 1   MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF+IFD+EI F +PWAV F  +   G   M++F+  + V + Y W++G LEWD
Sbjct: 61  YYLTAMLFIIFDIEIVFFYPWAVTFDALGLFGLVEMLLFVLTVFVAYAYVWRRGGLEWD 119


>gi|325105667|ref|YP_004275321.1| NADH dehydrogenase subunit A [Pedobacter saltans DSM 12145]
 gi|324974515|gb|ADY53499.1| NADH dehydrogenase subunit A [Pedobacter saltans DSM 12145]
          Length = 125

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPE-KLSTYECGFDPFDDARVKFDIRFCL 65
            Y PI++ +A+A   VI+ M    ++  K    + KL+ +E G +   +AR  F I++ +
Sbjct: 9   DYLPIVIQLAVALGFVILTMTITHLIGPKRKTTDVKLTPFESGIESIGNARQPFSIKYFI 68

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           V+++FVIFD+E+ F++PWAV F++    G   M +F+G L +GFIY  KK  LEW+
Sbjct: 69  VAIMFVIFDIEVIFMYPWAVNFREFGINGLIEMFIFMGTLLLGFIYILKKKVLEWN 124


>gi|213135963|gb|ACJ43525.1| NADH dehydrogenase subunit 3 [Calotriton asper]
          Length = 115

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 65/110 (59%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I + +A   ++ + L+   F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ISLMLAFTVSLSMALITVGFWLPQNNPDTEKLSPYECGFDPIGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  T        V L +LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPAPWASQMSTANTLLWSTVILILLTLGLAYEWAQGGLEW 113


>gi|56692548|ref|YP_163888.1| NADH dehydrogenase subunit 3 [Anguilla malgumora]
 gi|56565366|dbj|BAD78043.1| NADH dehydrogenase subunits 3 [Anguilla malgumora]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  +AI + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILAITTTLSFVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPNTTNAFFWAMSIIILLTLGLVYEWIQGGLEW 114


>gi|167752199|ref|ZP_02424326.1| hypothetical protein ALIPUT_00441 [Alistipes putredinis DSM 17216]
 gi|167660440|gb|EDS04570.1| hypothetical protein ALIPUT_00441 [Alistipes putredinis DSM 17216]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 66/113 (58%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A  +V + +     ++ +S +P+K   YECG      + ++F + + L +
Sbjct: 3   FVLLMVVILTAIGLVAIALGVARAISPRSYNPQKGEAYECGIPTRGKSWMQFKVGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLF WAV  ++I   G  S + FL ILT G  Y W+KGALEW
Sbjct: 63  ILFLMFDVETVFLFAWAVVVQEIGVFGLVSALFFLLILTFGLAYAWRKGALEW 115


>gi|139389955|ref|YP_001123555.1| NADH dehydrogenase D3 [Draba nemorosa]
 gi|223635412|sp|A4QL24|NU3C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286757|dbj|BAF50379.1| NADH dehydrogenase D3 [Draba nemorosa]
          Length = 120

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFLEAFIFVLILILGLVYAWRKGALEW 119


>gi|280978357|ref|YP_003345288.1| NADH dehydrogenase subunit 3 [Hoplunnis punctata]
 gi|271280771|dbj|BAI53464.1| NADH dehydrogenase subunit 3 [Hoplunnis punctata]
          Length = 116

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/112 (45%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I S +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIIPILMITSILSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +   T   F      L +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPETTQTFFWATSILVLLTLGLIYEWMQGGLEW 114


>gi|148828673|gb|ABR13959.1| NDH-C [Thuja plicata]
          Length = 120

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 71/117 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L + Y    ++++I+S I I+       +A  S  PEK ++YE G +P  D  ++F IR+
Sbjct: 3   LFSEYDTFWIYLSISSLIPILAFSISRSLAPISKRPEKATSYESGIEPMGDTWIQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDILGLFTFIEAFIFVIILIVGLVYAWRKGALEW 119


>gi|68164808|ref|YP_247604.1| NADH dehydrogenase subunit 3 [Cucumis sativus]
 gi|75317260|sp|Q4VZH0|NU3C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|67511403|emb|CAJ00763.1| NADH dehydrogenase subunit C [Cucumis sativus]
 gi|74027106|gb|AAZ94656.1| NADH dehydrogenase subunit 3 [Cucumis sativus]
 gi|115432809|gb|ABI97422.1| NADH-plastoquinone oxidoreductase subunit 3 [Cucumis sativus]
 gi|115498308|gb|ABI98750.1| NADH-plastoquinone oxidoreductase subunit 3 [Cucumis sativus]
          Length = 120

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    VF+ I+S I I+  +   ++A  S +PEKLS+YE G +P  DA V+F IR+
Sbjct: 3   LLYEYDIFWVFLIISSVIPILAFLISGVLAPLSKEPEKLSSYESGIEPMGDAWVQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|220909535|ref|YP_002484846.1| NADH dehydrogenase subunit A [Cyanothece sp. PCC 7425]
 gi|219866146|gb|ACL46485.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Cyanothece
           sp. PCC 7425]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 77/117 (65%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+ I S + ++ + +  IV  KS    +++TYE G +P  +A ++F+IR+
Sbjct: 3   VLSGYEYLLGFLLICSLVPVLALGASAIVRPKSQGVSRVTTYESGMEPIGEAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL  G +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFHRLGVLAFIEALIFIAILVFGLVYAWRKGALEW 119


>gi|71065151|ref|YP_263878.1| NADH dehydrogenase I, A subunit [Psychrobacter arcticus 273-4]
 gi|123649366|sp|Q4FU64|NUOA_PSYA2 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|71038136|gb|AAZ18444.1| NADH dehydrogenase I, A subunit [Psychrobacter arcticus 273-4]
          Length = 207

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 60/99 (60%)

Query: 22  VIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFDLEIAFLF 81
           V+ +++ P ++  +S   +K   +E G     +AR++   +F LV++ FVIFDLE  +L+
Sbjct: 19  VVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKFYLVAIFFVIFDLEALYLY 78

Query: 82  PWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +AV  ++  WLGF +  +F+ IL +G +YE   GA+ W
Sbjct: 79  AYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNW 117


>gi|119360318|ref|YP_913777.1| NADH dehydrogenase subunit 3 [Xenocypris argentea]
 gi|119360533|ref|YP_913790.1| NADH dehydrogenase subunit 3 [Chanodichthys mongolicus]
 gi|162382075|ref|YP_001604431.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys molitrix]
 gi|164414458|ref|YP_001648364.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys nobilis]
 gi|198400369|ref|YP_002221309.1| NADH dehydrogenase subunit 3 [Distoechodon tumirostris]
 gi|280978259|ref|YP_003345197.1| NADH dehydrogenase subunit 3 [Culter alburnus]
 gi|63081773|gb|AAY30639.1| NADH dehydrogenase subunit 3 [Distoechodon tumirostris]
 gi|119225535|dbj|BAF41877.1| NADH dehydrogenase subunit 3 [Xenocypris argentea]
 gi|119225549|dbj|BAF41890.1| NADH dehydrogenase subunit 3 [Culter mongolicus]
 gi|161824400|gb|ABX79774.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys molitrix]
 gi|163658607|gb|ABY28398.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys nobilis]
 gi|269996116|gb|ACZ57380.1| NADH dehydrogenase subunit 3 [Culter alburnus]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|139389647|ref|YP_001123204.1| NADH dehydrogenase D3 [Arabis hirsuta]
 gi|223635376|sp|A4QK23|NU3C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286402|dbj|BAF50028.1| NADH dehydrogenase D3 [Arabis hirsuta]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F  + +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEVFIFVLILILGLVYAWRKGALEW 119


>gi|139388099|ref|YP_001123291.1| NADH dehydrogenase D3 [Barbarea verna]
 gi|139389101|ref|YP_001123819.1| NADH dehydrogenase subunit 3 [Nasturtium officinale]
 gi|223635361|sp|A4QLT8|NU3C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635375|sp|A4QKB0|NU3C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286490|dbj|BAF50115.1| NADH dehydrogenase D3 [Barbarea verna]
 gi|134287024|dbj|BAF50643.1| NADH dehydrogenase D3 [Nasturtium officinale]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++      +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFFISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|37361564|gb|AAQ91100.1| NADH dehydrogenase subunit 3 [Acanthisitta chloris]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + ++ A+  +L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTLSLALSTILTAVNFWLAQTNPDTEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +              + +LT+G  YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLHSPLTTLTWTSTIILLLTIGLAYEWTQGGLEW 114


>gi|329962483|ref|ZP_08300483.1| putative NADH dehydrogenase subunit A [Bacteroides fluxus YIT
           12057]
 gi|328530039|gb|EGF56927.1| putative NADH dehydrogenase subunit A [Bacteroides fluxus YIT
           12057]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 71/114 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++  ++V +  A A V +++     +A +S +P+K+  YECG      + ++F + + L 
Sbjct: 2   NFTLLVVVLLTAIAFVGIVIALSNAIAPRSYNPQKMEPYECGIPTRGKSWMQFRVGYYLF 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++F++E  FLFPWAV  +++   G  S++ FL IL +G  Y W+KGALEW
Sbjct: 62  AILFLMFEVETVFLFPWAVITRELGVAGLFSVLFFLIILVLGLAYAWRKGALEW 115


>gi|320353961|ref|YP_004195300.1| NADH dehydrogenase subunit A [Desulfobulbus propionicus DSM 2032]
 gi|320122463|gb|ADW18009.1| NADH dehydrogenase subunit A [Desulfobulbus propionicus DSM 2032]
          Length = 122

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 68/121 (56%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M  +   Y  IL+ +       ++ +          P  EKL  YE G +P    R++F 
Sbjct: 1   MDAIPGEYLGILLLLIFGILFGVLTLFVGRFFRLSRPYREKLIAYESGNEPTAAPRMRFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F L+++LFV+FD+E  +L+PWAV + ++       M++F+ +L VG++Y WKKG L+W
Sbjct: 61  VKFYLIAILFVVFDVECIYLYPWAVSYDRLGLFALVEMLLFIALLLVGYVYAWKKGVLQW 120

Query: 121 D 121
           +
Sbjct: 121 E 121


>gi|122893995|ref|YP_001004191.1| NADH-plastoquinone oxidoreductase subunit 3 [Ranunculus macranthus]
 gi|223635385|sp|A1XGP3|NU3C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|85540809|gb|ABC70761.1| NADH-plastoquinone oxidoreductase subunit 3 [Ranunculus macranthus]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++A  +  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLHEYDIFWAFLIISSVIPILAFLISGVLAPINEGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEW 119


>gi|11466397|ref|NP_038401.1| NADH dehydrogenase subunit 3 [Mesostigma viride]
 gi|14423816|sp|Q9MUQ9|NU3C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|7259540|gb|AAF43841.1|AF166114_53 subunit 3 of NADH-plastoquinoneoxidoreductase [Mesostigma viride]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L  Y   +VF  +A  + I+ +    ++  K    EK  TYE G +P  +A V+F+IR+
Sbjct: 3   ILEGYDSFVVFFIVACLVPILALSGSKLIRPKLSGIEKKMTYESGIEPMGEAWVQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWA+ FK +    F   ++FL IL +G +Y W+KGALEW
Sbjct: 63  YMFALIFVIFDVETLFLYPWAIVFKDLGITAFLETLIFLSILIIGLVYAWRKGALEW 119


>gi|325126698|ref|YP_004285847.1| NADH dehydrogenase subunit 3 [Labeo bata]
 gi|325053250|dbj|BAJ83452.1| NADH dehydrogenase subunit 3 [Labeo bata]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILVITVALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|108767332|ref|YP_636051.1| NADH dehydrogenase subunit 3 [Gila robusta]
 gi|105873577|gb|ABF74807.1| NADH dehydrogenase subunit 3 [Gila robusta]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I    AI +A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIFAITAALSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPAGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|57639685|gb|AAW55689.1| NADH dehydrogenase subunit 3 [Amborella trichopoda]
          Length = 111

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 13  VFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFV 71
           +++ I+  + ++ +  PF   +  S  PEKLS +ECGFDP  DAR +FDIRF  V +LF+
Sbjct: 2   IYLVISPLVSLIPLGVPFPFASNSSTYPEKLSAHECGFDPSGDARSRFDIRFYPVPILFI 61

Query: 72  IFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           I D E+ F  PWAV   +I   G  SMM FL ILT+G +YEWK+GA
Sbjct: 62  IPDPEVTFSSPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGA 107


>gi|78042776|ref|YP_360257.1| proton-translocating NADH-quinone oxidoreductase subunit A
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|123576171|sp|Q3AC77|NUOA_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|77994891|gb|ABB13790.1| proton-translocating NADH-quinone oxidoreductase, A subunit
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 118

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 70/117 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+    IL+F      + I++++  ++++ KS    K  TYECG +      V+F   +
Sbjct: 1   MLSPKGAILIFFLTGFFLSIIILVLNYLLSPKSKSLIKRETYECGLETIGPTWVQFKGNY 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F  +    F  M++F+GIL +G  Y WK+GALEW
Sbjct: 61  FMYALVFVLFDVETIFLYPWAVRFNVLGLFAFVEMVIFIGILVLGLWYAWKEGALEW 117


>gi|14017577|ref|NP_114264.1| NADH dehydrogenase subunit 3 [Triticum aestivum]
 gi|118430393|ref|YP_874658.1| NADH-plastoquinone oxidoreductase subunit 3 [Hordeum vulgare subsp.
           vulgare]
 gi|128693|sp|P26303|NU3C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635355|sp|A1E9J6|NU3C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|556459|gb|AAA84730.1| NADPH-plastoquinone oxireductase [Triticum aestivum]
 gi|13928210|dbj|BAB47039.1| NADH dehydrogenase ND3 [Triticum aestivum]
 gi|118201047|gb|ABK79418.1| NADH-plastoquinone oxidoreductase subunit 3 [Hordeum vulgare subsp.
           vulgare]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A  S  PEKLS+YE G +P   A V+F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEPMGGAWVQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILVVGLVYAWRKGALEW 119


>gi|299758225|dbj|BAJ09896.1| NADH dehydrogenase subunit 3 [Setipinna melanochir]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I++ + +VLM   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTVLVISTTLSLVLMTVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +            + +G+LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLSDPTNTLIWATIVIGLLTLGLVYEWLQGGLEW 114


>gi|224026052|ref|ZP_03644418.1| hypothetical protein BACCOPRO_02805 [Bacteroides coprophilus DSM
           18228]
 gi|224019288|gb|EEF77286.1| hypothetical protein BACCOPRO_02805 [Bacteroides coprophilus DSM
           18228]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 66/113 (58%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A A+V   M    ++A +S +P+K   YECG      + V+F + + L +
Sbjct: 3   FTFLVVVVLTAIALVAAAMTIAKLIAPRSFNPQKGEPYECGIPTRGQSWVQFKVGYYLYA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLFPWAV   ++        ++FL IL +G  Y W+KGALEW
Sbjct: 63  ILFLMFDIETVFLFPWAVTAGELGSSALVCGILFLVILIIGLAYAWRKGALEW 115


>gi|255535795|ref|YP_003096166.1| NADH ubiquinone oxidoreductase chain A [Flavobacteriaceae bacterium
           3519-10]
 gi|255341991|gb|ACU08104.1| NADH ubiquinone oxidoreductase chain A [Flavobacteriaceae bacterium
           3519-10]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 73/121 (60%), Gaps = 2/121 (1%)

Query: 3   DLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPE--KLSTYECGFDPFDDARVKFD 60
           ++  +Y PIL+  A+    V++ ++    +  K  +    K  ++ECG D   +AR  F 
Sbjct: 2   NIPENYIPILITFAVGFGFVMLCVLGTHFLGPKQKESSFKKNESFECGIDVEGNARSPFS 61

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ L +VLFV+FD+EI F +P+AV  ++    GF +++ F+ +  + F+Y WK+GAL+W
Sbjct: 62  VKYFLTAVLFVLFDIEIVFFYPYAVNLREFGVEGFFAVLTFISVFLLAFVYVWKRGALDW 121

Query: 121 D 121
           D
Sbjct: 122 D 122


>gi|189095550|ref|YP_001936257.1| NADH dehydrogenase subunit 3 [Carassius cuvieri]
 gi|261866673|ref|YP_003264324.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
 gi|13516945|dbj|BAB40355.1| NADH dehydrogenase subunit 3 [Carassius cuvieri]
 gi|260595495|gb|ACX46749.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
 gi|311087979|gb|ADP68057.1| NADH dehydrogenase subunit 3 [Carassius auratus x Megalobrama
           amblycephala pentaploid hybrid]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITAALSLILATISFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLDNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|297585417|ref|YP_003701197.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           selenitireducens MLS10]
 gi|297143874|gb|ADI00632.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Bacillus
           selenitireducens MLS10]
          Length = 124

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLM-ISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
              +Y  +L+F+ +   + +  + I   +V  K+P  EK++TYE G  P  DA V++ + 
Sbjct: 6   YYDNYILVLMFIGLGVLLPVATVSIIGPLVRPKNPYREKITTYESGIAPEGDATVRYHVA 65

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + LV++ F+IFD+E  FL PWAV    + W G   M++F+ IL +G  Y WKK  LEW+
Sbjct: 66  YYLVALEFIIFDVETVFLIPWAVALGDLGWDGLNLMLIFIFILVLGLAYSWKKRVLEWN 124


>gi|119360255|ref|YP_913387.1| NADH dehydrogenase subunit 3 [Opsariichthys uncirostris]
 gi|119225073|dbj|BAF41448.1| NADH dehydrogenase subunit 3 [Opsariichthys uncirostris]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+    IA A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIFIIAVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|57639683|gb|AAW55688.1| NADH dehydrogenase subunit 3 [Amborella trichopoda]
          Length = 112

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 62/109 (56%), Positives = 80/109 (73%), Gaps = 2/109 (1%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPD--PEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           V++ I+    ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF LVS+LF
Sbjct: 2   VYLVISLLFSLILIGVSFLFASSSNSAHPEKLSAYECGFDPFDDARSRFDIRFSLVSILF 61

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           +IFDLE+ FLFPWAV   +I   G  S+++FL ILT+G +YEWKKGAL+
Sbjct: 62  IIFDLEVTFLFPWAVSLSKIGLFGSWSIILFLSILTIGSLYEWKKGALD 110


>gi|56707211|ref|YP_169107.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669681|ref|YP_666238.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118498241|ref|YP_899291.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           novicida U112]
 gi|134301246|ref|YP_001121214.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187930988|ref|YP_001890972.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194324425|ref|ZP_03058198.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           novicida FTE]
 gi|208780268|ref|ZP_03247610.1| NADH-quinone oxidoreductase chain 7 [Francisella novicida FTG]
 gi|224456272|ref|ZP_03664745.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254371427|ref|ZP_04987428.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373582|ref|ZP_04989068.1| NADH dehydrogenase I [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254375049|ref|ZP_04990529.1| hypothetical protein FTDG_01237 [Francisella novicida GA99-3548]
 gi|254874049|ref|ZP_05246759.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|54114113|gb|AAV29690.1| NT02FT1736 [synthetic construct]
 gi|56603703|emb|CAG44664.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320014|emb|CAL08047.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           tularensis FSC198]
 gi|118424147|gb|ABK90537.1| NADH dehydrogenase I, A subunit [Francisella novicida U112]
 gi|134049023|gb|ABO46094.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151569666|gb|EDN35320.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           FSC033]
 gi|151571306|gb|EDN36960.1| NADH dehydrogenase I [Francisella novicida GA99-3549]
 gi|151572767|gb|EDN38421.1| hypothetical protein FTDG_01237 [Francisella novicida GA99-3548]
 gi|187711897|gb|ACD30194.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|194321490|gb|EDX18975.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           novicida FTE]
 gi|208743917|gb|EDZ90219.1| NADH-quinone oxidoreductase chain 7 [Francisella novicida FTG]
 gi|254840048|gb|EET18484.1| NADH dehydrogenase I [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158319|gb|ADA77710.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           tularensis NE061598]
 gi|332184796|gb|AEE27050.1| NADH ubiquinone oxidoreductase chain A [Francisella cf. novicida
           3523]
 gi|332678977|gb|AEE88106.1| NADH ubiquinone oxidoreductase chain A [Francisella cf. novicida
           Fx1]
          Length = 132

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 53/130 (40%), Positives = 78/130 (60%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMI----SPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           + +   +APIL+F+ IA  +     I       IV   +P+  K  T+ECGF  F DAR 
Sbjct: 3   TSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGDARE 62

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWL------GFGSMMVFLGILTVGFIY 111
           K D+RF L++VLF++FDLE+AF+ PW +  +    +       F +M++FL +L +G IY
Sbjct: 63  KLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIY 122

Query: 112 EWKKGALEWD 121
            WKKGALEW+
Sbjct: 123 AWKKGALEWE 132


>gi|319650862|ref|ZP_08004999.1| NADH-quinone oxidoreductase subunit [Bacillus sp. 2_A_57_CT2]
 gi|317397460|gb|EFV78161.1| NADH-quinone oxidoreductase subunit [Bacillus sp. 2_A_57_CT2]
          Length = 124

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 72/115 (62%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
            +Y  + VF+ +   + +V +    ++    P   K +TYE G +PF D+RV+F++R+ +
Sbjct: 9   NNYLIVFVFLCLGVLLPVVALFLGKLLRPYKPYDTKYTTYESGIEPFHDSRVQFNVRYYI 68

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            +++FVIFD+E  FL+PWAV ++++       M++F+ +L +G +Y WKK  L+W
Sbjct: 69  FALMFVIFDVETVFLYPWAVAYEKLGIFALIEMLIFVFMLVIGLVYAWKKKVLKW 123


>gi|119511863|ref|ZP_01630963.1| NADH dehydrogenase alpha subunit [Nodularia spumigena CCY9414]
 gi|119463505|gb|EAW44442.1| NADH dehydrogenase alpha subunit [Nodularia spumigena CCY9414]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F  I S +  + + +  ++       E+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFFIICSLVPALALSASKLLRPSGNSLERRTTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWAV F ++  L F   +VF+ IL V  +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALVFISILVVALVYAWRKGALEW 119


>gi|293652709|gb|ADE61208.1| NADH dehydrogenase subunit 3 [Ixonotus guttatus]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +A++  + I L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ITFMIALSLTLSIALTALNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q            + +LT G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQTPSTTLAWASTLILLLTAGLVYEWTQGGLEW 114


>gi|271962233|ref|YP_003336429.1| oxidored_q4, NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Streptosporangium roseum DSM 43021]
 gi|270505408|gb|ACZ83686.1| oxidored_q4, NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Streptosporangium roseum DSM 43021]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           MS   +SY  +L   AI  AIV+  +    ++    P PEKL TYECG DP      +  
Sbjct: 1   MSGYFSSYGVVLALFAIGVAIVVGALTVNRLLRPHRPTPEKLLTYECGVDPVGADWAQSQ 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF--KQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           +R+ + + L+V+F ++  FLFPWA  F            M VFLG + +G +Y W+K  L
Sbjct: 61  VRYYVFTYLYVVFAVDAVFLFPWATVFAAPGFGMTTLVEMFVFLGFIALGILYAWRKRVL 120

Query: 119 EW 120
            W
Sbjct: 121 AW 122


>gi|119365175|ref|YP_913426.1| NADH dehydrogenase subunit 3 [Barbonymus gonionotus]
 gi|119225115|dbj|BAF41487.1| NADH dehydrogenase subunit 3 [Barbonymus gonionotus]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI +A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILAITTALSLILGIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q     F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLQNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|91069904|gb|ABE10833.1| putative NADH dehydrogenase complex I subunit chain 3 [uncultured
           Prochlorococcus marinus clone ASNC2150]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLNGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|110227084|ref|YP_665563.1| NADH dehydrogenase subunit 3 [Populus alba]
 gi|134093204|ref|YP_001109506.1| NADH dehydrogenase subunit 3 [Populus trichocarpa]
 gi|224099653|ref|XP_002334454.1| predicted protein [Populus trichocarpa]
 gi|122237044|sp|Q14FF2|NU3C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635373|sp|A4GYR5|NU3C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|109945522|dbj|BAE97210.1| NADH dehydrogenase subunit C [Populus alba]
 gi|133712066|gb|ABO36709.1| NADH dehydrogenase D3 [Populus trichocarpa]
 gi|222872367|gb|EEF09498.1| predicted protein [Populus trichocarpa]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSVIPILAFLISGLLSPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|197121689|ref|YP_002133640.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter sp. K]
 gi|220916485|ref|YP_002491789.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|223635415|sp|B4UIA6|NUOA_ANASK RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|196171538|gb|ACG72511.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter sp. K]
 gi|219954339|gb|ACL64723.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 129

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PI V + +A  +   ++    ++  + P   K + +ECG +P   AR +F 
Sbjct: 1   MLTPLQIYFPIGVVLLVAVVLAFTMLGLANVLGPRRPSLVKQTPFECGSEPVGSARERFG 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF-------KQITWLGFGSMMVFLGILTVGFIYEW 113
           ++F +V++LF++FD+E  FL+PWAV           + W GF SM +F+  L  G +Y W
Sbjct: 61  VKFYVVALLFIVFDIEAIFLYPWAVLLLPDGQGYPGLGWPGFVSMGIFVFTLVAGLVYVW 120

Query: 114 KKGALEW 120
           KKG L+W
Sbjct: 121 KKGVLDW 127


>gi|123967854|ref|YP_001008712.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. AS9601]
 gi|223635411|sp|A2BP94|NU3C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123197964|gb|ABM69605.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. AS9601]
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|11466792|ref|NP_039388.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|50233976|ref|YP_052754.1| NADH dehydrogenase subunit 3 [Oryza nivara]
 gi|109156600|ref|YP_654219.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|297727765|ref|NP_001176246.1| Os10g0526301 [Oryza sativa Japonica Group]
 gi|68565735|sp|Q6ENG9|NU3C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|148872792|sp|P0C320|NU3C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|148872793|sp|P0C321|NU3C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|148872794|sp|P0C322|NU3C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|20146745|gb|AAM12481.1|AC074232_8 NADH dehydrogenase ND3 [Oryza sativa Japonica Group]
 gi|11989|emb|CAA34001.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|42795492|gb|AAS46059.1| NADH dehydrogenase subunit 3 [Oryza sativa Indica Group]
 gi|42795559|gb|AAS46125.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|42795623|gb|AAS46188.1| NADH dehydrogenase subunit 3 [Oryza sativa Japonica Group]
 gi|49615000|dbj|BAD26783.1| NADH dehydrogenase subunit 3 [Oryza nivara]
 gi|255679576|dbj|BAH94974.1| Os10g0526301 [Oryza sativa Japonica Group]
 gi|290790578|gb|ADD62838.1| NADH-plastoquinone oxidoreductase subunit 3 [Oryza sativa Japonica
           Group]
 gi|290790647|gb|ADD62906.1| NADH-plastoquinone oxidoreductase subunit 3 [Oryza meridionalis]
 gi|290790716|gb|ADD62974.1| NADH-plastoquinone oxidoreductase subunit 3 [Oryza australiensis]
 gi|290790785|gb|ADD63042.1| NADH-plastoquinone oxidoreductase subunit 3 [Potamophila
           parviflora]
 gi|226610|prf||1603356AG NADH dehydrogenase ND3
          Length = 120

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 70/117 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A     PEKLS+YE G +P   A ++F IR+
Sbjct: 3   LLHEYDIFWAFLIIASLIPILAFWISALLAPVREGPEKLSSYESGIEPMGGAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGISVFIEAFIFVLILVVGLVYAWRKGALEW 119


>gi|189459785|ref|ZP_03008570.1| hypothetical protein BACCOP_00414 [Bacteroides coprocola DSM 17136]
 gi|189433514|gb|EDV02499.1| hypothetical protein BACCOP_00414 [Bacteroides coprocola DSM 17136]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 67/113 (59%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A A+V+V M    ++A +S +P+K   YECG      + V+F + + L +
Sbjct: 3   FTFLIVVILTAIALVVVAMTIAKLIAPRSFNPQKGEPYECGIPTRGQSWVQFKVGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLFPWAV   ++       +  FL +L +G  Y W+KGALEW
Sbjct: 63  ILFLMFDIETVFLFPWAVVVNEVGTYALVCVAFFLLVLILGLAYAWRKGALEW 115


>gi|108762570|ref|YP_630951.1| putative NADH dehydrogenase I subunit A [Myxococcus xanthus DK
           1622]
 gi|122389225|sp|Q1D8S2|NUOA_MYXXD RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|108466450|gb|ABF91635.1| putative NADH dehydrogenase I, A subunit [Myxococcus xanthus DK
           1622]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/117 (37%), Positives = 73/117 (62%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           LT Y P+ V + +A  + +++      +  + P   K +++E G +    AR +F ++F 
Sbjct: 6   LTPYLPLAVVLLLAGGMAMLIPQITTRLGPRRPSAIKATSFEAGSESSGPARQRFAVKFY 65

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +V++LF++FD+E  FL+PWAV F+ + W G+  M+VF   L VG IY WKKGAL+W+
Sbjct: 66  VVALLFIVFDVEAVFLYPWAVNFQALGWFGYVEMLVFAVTLVVGLIYIWKKGALDWE 122


>gi|108767360|ref|YP_636090.1| NADH dehydrogenase subunit 3 [Chondrostoma lemmingii]
 gi|105873619|gb|ABF74846.1| NADH dehydrogenase subunit 3 [Chondrostoma lemmingii]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I     IA+ +  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIFVIAATLSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHSPTATFFWATAVLVLLTLGLIYEWTQGGLEW 114


>gi|312890396|ref|ZP_07749933.1| NADH dehydrogenase subunit A [Mucilaginibacter paludis DSM 18603]
 gi|311297166|gb|EFQ74298.1| NADH dehydrogenase subunit A [Mucilaginibacter paludis DSM 18603]
          Length = 123

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 72/115 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++ PI+  M +A   V++ M +   +  K    +KLST+E G +   +AR    I++ LV
Sbjct: 9   NFLPIIFQMIVAIGFVVITMFATHKLGPKRVTSDKLSTFESGIEVIGNARTPISIKYFLV 68

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+E+ F++PWAV FK +   G   M +F+G L +GFIY  KK AL+WD
Sbjct: 69  AILFVLFDVEVIFMYPWAVNFKDLGTDGMMEMFIFMGTLLLGFIYILKKKALDWD 123


>gi|297159539|gb|ADI09251.1| NADH dehydrogenase subunit NuoA2 [Streptomyces bingchenggensis
           BCW-1]
          Length = 137

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +D    Y+ + +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 16  ADYFQGYSVVGLLAVVGVLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 75

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITW--LGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F    +       M +FLG L VG +Y WKKG LE
Sbjct: 76  RYYVYAFLYVIFAVDSIFLFPWATVFAAPGYGGTTLVEMFIFLGFLAVGLLYAWKKGVLE 135

Query: 120 W 120
           W
Sbjct: 136 W 136


>gi|197935804|ref|YP_002213573.1| NADH dehydrogenase subunit 3 [Procypris rabaudi]
 gi|154818379|gb|ABS87667.1| NADH dehydrogenase subunit 3 [Procypris rabaudi]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I +A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITTALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|53686440|ref|YP_097213.1| NADH dehydrogenase subunit 3 [Gyrinophilus porphyriticus]
 gi|51980003|gb|AAU20663.1| NADH dehydrogenase subunit 3 [Gyrinophilus porphyriticus]
          Length = 115

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            IL+ M I   +  +L++  F +   SPD EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   SILLMMLITVTLSTILIMVGFWLPINSPDAEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +      F      L +LT G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPTPWAAQTTPTNMFLWSTTILILLTAGLVYEWMQGGLEW 113


>gi|218295760|ref|ZP_03496556.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermus
           aquaticus Y51MC23]
 gi|218243919|gb|EED10446.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Thermus
           aquaticus Y51MC23]
          Length = 119

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           +  Y  IL+++ +A  I +  +    ++  K P   KL  YE G DP  + + +F + F 
Sbjct: 4   IAEYVNILIYLGVALFIGVAALAVGALLGPKKPGRAKLMPYESGNDPAGEVK-RFPVHFY 62

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +V++LF++FD+E+AFL+P+AV   ++   GF  ++ F  +L VGF+YEW KG + W
Sbjct: 63  VVAMLFILFDVEVAFLWPYAVSAGELGLYGFLGVLGFTLLLLVGFLYEWWKGVMRW 118


>gi|108767290|ref|YP_636116.1| NADH dehydrogenase subunit 3 [Notropis stramineus]
 gi|105873647|gb|ABF74872.1| NADH dehydrogenase subunit 3 [Notropis stramineus]
          Length = 116

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 52/111 (46%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I     IA A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIFIIAVALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  +  G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHSPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|167716858|ref|YP_001686731.1| NADH dehydrogenase subunit 3 [Megalobrama amblycephala]
 gi|292486427|ref|YP_003541065.1| NADH dehydrogenase subunit 3 [diploid Megalobrama amblycephala x
           Xenocypris davidi]
 gi|292486441|ref|YP_003541078.1| NADH dehydrogenase subunit 3 [triploid Megalobrama amblycephala x
           Xenocypris davidi]
 gi|63081801|gb|AAY30665.1| NADH dehydrogenase subunit 3 [Megalobrama amblycephala]
 gi|166897652|gb|ABZ01951.1| NADH dehydrogenase subunit 3 [Megalobrama amblycephala]
 gi|291463788|gb|ADE05495.1| NADH dehydrogenase subunit 3 [diploid Megalobrama amblycephala x
           Xenocypris davidi]
 gi|291463802|gb|ADE05508.1| NADH dehydrogenase subunit 3 [triploid Megalobrama amblycephala x
           Xenocypris davidi]
          Length = 116

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWAATVLILLTLGLIYEWTQGGLEW 114


>gi|126695656|ref|YP_001090542.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9301]
 gi|223635394|sp|A3PB16|NU3C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|126542699|gb|ABO16941.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9301]
          Length = 120

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ ++ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPVLALVTNLIVAPKGRAGERRLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|332886756|dbj|BAK22881.1| NADH dehydrogenase subunit 3 [Raiamas guttatus]
          Length = 116

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA+A+ ++L    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITAMIIIATALSLILATVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G        L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPAGTLFWATAVLILLTLGLVYEWTQGGLEW 114


>gi|166091628|ref|YP_001654973.1| NADH dehydrogenase subunit 3 [Ctenopharyngodon idella]
 gi|165935035|gb|ABY74758.1| NADH dehydrogenase subunit 3 [Ctenopharyngodon idella]
 gi|322506174|gb|ADX01629.1| NADH dehydrogenase subunit 3 [Ctenopharyngodon idella]
          Length = 116

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILIITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|255691138|ref|ZP_05414813.1| NADH dehydrogenase, A subunit [Bacteroides finegoldii DSM 17565]
 gi|260623231|gb|EEX46102.1| NADH dehydrogenase, A subunit [Bacteroides finegoldii DSM 17565]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 68/114 (59%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++  ++V +  A A V V++     ++ +S + +K   YECG      + ++F + + L 
Sbjct: 2   NFTFLVVVLLTALAFVGVVIALSRAISPRSYNAQKFEAYECGIPTRGKSWMQFRVGYYLF 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++FD+E AFLFPWAV  + +   G  S++ F  IL +G  Y W+KGALEW
Sbjct: 62  AILFLMFDVETAFLFPWAVVMQDLGPQGLVSILFFFIILVLGLAYAWRKGALEW 115


>gi|194132107|gb|ACF33361.1| NADH-plastoquinone oxidoreductase subunit 3 [Gonystylus bancanus]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 71/117 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++      PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWPFLIISSVIPILAFLISGVLGPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIVGLVYAWRKGALEW 119


>gi|1396039|dbj|BAA07793.1| ndhC [Anthoceros formosae]
          Length = 125

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L++ Y    +F+ IAS I  +      ++A  S  PEK ++YECG +P  DA ++F IR+
Sbjct: 3   LVSKYNYFWIFLLIASLIPTIAFSISRVIAPISKGPEKFTSYECGIEPMGDAWIQFXIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E   L+PWA+ FKQ+       + +F+ IL +G IY W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVSLYPWAMSFKQLGIPASIEVSIFVSILIIGLIYAWRKGALEW 119


>gi|317134184|ref|YP_004123436.1| NADH dehydrogenase subunit 3 [Pseudopungtungia tenuicorpus]
 gi|223951250|gb|ACN29545.1| NADH dehydrogenase subunit 3 [Pseudopungtungia tenuicorpus]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA A+  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILIIALALSSVLAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G        L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTLFWATSVLVLLTLGLIYEWTQGGLEW 114


>gi|172072906|ref|YP_001806667.1| NADH dehydrogenase subunit 3 [Cryptomeria japonica]
 gi|223635359|sp|B1VKF4|NU3C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|171854925|dbj|BAG16665.1| NADH-plastoquinone oxidoreductase subunit 3 [Cryptomeria japonica]
 gi|239794294|dbj|BAH73291.1| NADH-plastoquinone oxidoreductase subunit 3 [Cryptomeria japonica]
 gi|239794376|dbj|BAH73372.1| NADH-plastoquinone oxidoreductase subunit 3 [Cryptomeria japonica]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 70/117 (59%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           L + Y    ++++I+S I I+       +A  S   EK ++YE G +P  D  ++F IR+
Sbjct: 3   LFSEYDTFWIYLSISSLIPILAFSISRSLAPISKGAEKATSYESGIEPMGDTWIQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDILGLFTFIEAFIFVIILIVGLVYAWRKGALEW 119


>gi|57639711|gb|AAW55702.1| NADH dehydrogenase subunit 3 [Pinus thunbergii]
          Length = 111

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFK-SPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+S + ++ +  PF  A   S  PEKLS +ECG DP  DAR +FDIRF  V 
Sbjct: 1   APICIYLVISSLVSLIPLGVPFPFAPNGSTYPEKLSAHECGSDPSGDARSRFDIRFYPVP 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           + F+I D E+ F  P AV   +I   G  SMMVF  I T+GF +EWKKGA
Sbjct: 61  ISFIISDPEVTFSSPRAVPLNKIDSFGSRSMMVFSLISTIGFPHEWKKGA 110


>gi|86990369|ref|YP_492601.1| NADH dehydrogenase subunit 3 [Hemibarbus labeo]
 gi|119360379|ref|YP_913283.1| NADH dehydrogenase subunit 3 [Hemibarbus barbus]
 gi|78368596|gb|ABB42990.1| NADH dehydrogenase subunit 3 [Hemibarbus labeo]
 gi|84372109|gb|ABC56400.1| NADH dehydrogenase subunit 3 [Hemibarbus labeo]
 gi|119224961|dbj|BAF41344.1| NADH dehydrogenase subunit 3 [Hemibarbus barbus]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA A+  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILIIAMALSSVLALVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|119360519|ref|YP_913582.1| NADH dehydrogenase subunit 3 [Ischikauia steenackeri]
 gi|119225283|dbj|BAF41643.1| NADH dehydrogenase subunit 3 [Ischikauia steenackeri]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+    I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTIFTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|119360547|ref|YP_913452.1| NADH dehydrogenase subunit 3 [Labeo senegalensis]
 gi|119225143|dbj|BAF41513.1| NADH dehydrogenase subunit 3 [Labeo senegalensis]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+ ++L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITVALSLILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|325126712|ref|YP_004285860.1| NADH dehydrogenase subunit 3 [Paralaubuca typus]
 gi|325053264|dbj|BAJ83465.1| NADH dehydrogenase subunit 3 [Paralaubuca typus]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITLALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTATFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|325298882|ref|YP_004258799.1| NAD(P)H-quinone oxidoreductase subunit 3 [Bacteroides salanitronis
           DSM 18170]
 gi|324318435|gb|ADY36326.1| NAD(P)H-quinone oxidoreductase subunit 3 [Bacteroides salanitronis
           DSM 18170]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 63/113 (55%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A  +V+  +    ++A +S +P+K   YECG      + V+F   + L +
Sbjct: 3   FTFLVVAILTAVVLVVAALTISRLIAPRSFNPQKGEPYECGIPTRGQSWVQFKAGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLFPWA    ++       +  FL +L +G  Y W+KGALEW
Sbjct: 63  ILFLMFDIETVFLFPWANVVNEVGAYALVCVSFFLLVLILGLAYAWRKGALEW 115


>gi|290489960|gb|ADD31387.1| NADH-plastoquinone oxidoreductase subunit 3 protein [Ehretia
           acuminata]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++A  S  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSLIPILAFLISGVLAPTSKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|119360491|ref|YP_913647.1| NADH dehydrogenase subunit 3 [Gyrinocheilus aymonieri]
 gi|119225353|dbj|BAF41708.1| NADH dehydrogenase subunit 3 [Gyrinocheilus aymonieri]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILLITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|325003724|ref|ZP_08124836.1| NADH dehydrogenase I chain A [Pseudonocardia sp. P1]
          Length = 121

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 69/121 (57%), Gaps = 3/121 (2%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA---RVKFD 60
           +L  Y P+++  A+A+   +  + +  ++  +  +  KL +YECG +P         +  
Sbjct: 1   MLDPYLPLVLLFALAAGFAVFSVAAAPLIGPRRFNRAKLDSYECGIEPSPQPVVGGGRVP 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + L ++LF++FD+E+ F++P+AV    +   GF ++ +++  +   + YEW++G LEW
Sbjct: 61  VAYYLTAMLFILFDIELVFMYPYAVVADAVGVFGFVAITLYIATIAFAYAYEWRRGGLEW 120

Query: 121 D 121
           +
Sbjct: 121 N 121


>gi|295792443|gb|ADG29217.1| NADH dehydrogenase subunit 3 [Hypophthalmichthys nobilis]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I   +  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVTLSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|113171316|gb|ABI30704.1| NADH dehydrogenase subunit 3 [Yuhina everetti]
 gi|220900370|gb|ACL82385.1| NADH dehydrogenase subunit 3 [Yuhina everetti]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +A++  + I L    F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ITFMIALSLTLSIALTALNFWIAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q            +  LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQNPTTTLIWTSTLIITLTLGLVYEWTQGGLEW 114


>gi|153807452|ref|ZP_01960120.1| hypothetical protein BACCAC_01732 [Bacteroides caccae ATCC 43185]
 gi|149129814|gb|EDM21026.1| hypothetical protein BACCAC_01732 [Bacteroides caccae ATCC 43185]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 68/114 (59%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++  ++V +  A A V V++     ++ +S + +K   YECG      + ++F + + L 
Sbjct: 2   NFTFLVVVLLTALAFVGVVIALSRAISPRSYNEQKFEAYECGIPTRGKSWMQFRVGYYLF 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++FD+E AFLFPWAV  + +   G  S++ F  IL +G  Y W+KGALEW
Sbjct: 62  AILFLMFDVETAFLFPWAVVMRDMGPQGLISILFFFIILVLGLAYAWRKGALEW 115


>gi|317046178|ref|YP_004072467.1| NADH dehydrogenase subunit 3 [Corynocarpus laevigata]
 gi|309252895|gb|ADO60315.1| NADH dehydrogenase subunit 3 [Corynocarpus laevigata]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    VF+ I+S I I+  +   ++A    +PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWVFLIISSVIPILAFLISGVLAPIRKEPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEW 119


>gi|280978329|ref|YP_003345262.1| NADH dehydrogenase subunit 3 [Facciolella oxyrhyncha]
 gi|271280753|dbj|BAI53477.1| NADH dehydrogenase subunit 3 [Facciolella oxyrhyncha]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I S +  +L++  F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILMITSTLSCILIVVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +       F   M  L +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPEATQTFFWAMSILILLTLGLVYEWIQGGLEW 114


>gi|139389269|ref|YP_001123035.1| NADH dehydrogenase D3 [Aethionema grandiflorum]
 gi|223635381|sp|A4QJK4|NU3C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286231|dbj|BAF49859.1| NADH dehydrogenase D3 [Aethionema grandiflorum]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI  +  +   +++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPFLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    VF+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFVFVLILILGLVYAWRKGALEW 119


>gi|268317700|ref|YP_003291419.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodothermus
           marinus DSM 4252]
 gi|262335234|gb|ACY49031.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Rhodothermus
           marinus DSM 4252]
          Length = 123

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 5/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +LT + P+ + + +A+ +   L+    I+    P+P K   YE G DP   AR ++ ++F
Sbjct: 1   MLTDFLPLFIMIVLAAGLAFSLLKLAEILGPHRPNPIKRMPYESGMDPVGSARERYTVKF 60

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQI-----TWLGFGSMMVFLGILTVGFIYEWKKGAL 118
            LV+++F++FD+EI FL+PWAV ++              ++ FL IL VG +Y+ KKG L
Sbjct: 61  YLVAMIFIVFDVEIVFLYPWAVSYRDFLEAGAGLGVLAVVVFFLIILAVGLLYDIKKGGL 120

Query: 119 EWD 121
           E+D
Sbjct: 121 EFD 123


>gi|256422835|ref|YP_003123488.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chitinophaga
           pinensis DSM 2588]
 gi|256037743|gb|ACU61287.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chitinophaga
           pinensis DSM 2588]
          Length = 148

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 61/111 (54%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
            P+L++  +   ++  ++   +I+     D      YE G +    AR++F  +F LV++
Sbjct: 11  WPLLLYACLVVVLLAAILTLSYILGQHHNDHATNRPYEGGIEQTGSARIRFSAQFYLVAM 70

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           LFVIFD+E  F+  WA+ F ++ W G+    +F+G L V  IYEW  GAL 
Sbjct: 71  LFVIFDVEAVFIMLWALGFYELGWPGYIGAAIFIGQLVVVLIYEWGIGALN 121


>gi|119360199|ref|YP_913517.1| NADH dehydrogenase subunit 3 [Gobio gobio]
 gi|119225213|dbj|BAF41578.1| ND3 [Gobio gobio]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I +A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILLITAALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPAGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|300122801|emb|CBK23816.2| unnamed protein product [Blastocystis hominis]
          Length = 119

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 82/118 (69%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
                  +LV+   A  +  +  +  +I   ++ D  KLS YECGF PF+DAR  F+I F
Sbjct: 2   FFNDLYALLVYFICAIVVSYIAFLISYIFGIRANDSNKLSAYECGFTPFEDARNTFEIHF 61

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            LV++LF++FDLEI+FL+PWAV    I+++G+ +M+VFL ILT+GF+YE+KKGALEW+
Sbjct: 62  YLVAILFLMFDLEISFLYPWAVSLSAISFVGYFAMVVFLIILTLGFVYEYKKGALEWE 119


>gi|213136033|gb|ACJ43590.1| NADH dehydrogenase subunit 3 [Cynops orphicus]
          Length = 115

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 66/110 (60%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           + + +  +  + IVL++  F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   VTLMLMFSVTLSIVLILVSFWLPLNNPDTEKLSPYECGFDPVGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +           + L ILTVG +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPTPWASQMHPVNTLFWSTIILIILTVGLVYEWAQGGLEW 113


>gi|194277552|ref|YP_492614.2| NADH dehydrogenase subunit 3 [Hemibarbus mylodon]
 gi|78057591|gb|ABB17289.1| NADH dehydrogenase subunit 3 [Hemibarbus mylodon]
 gi|190888451|gb|ABC56413.2| NADH dehydrogenase subunit 3 [Hemibarbus mylodon]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I   + +VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILVITMTLSLVLAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|326910742|gb|AEA11189.1| NADH dehydrogenase subunit 3 [Selaginella moellendorffii]
 gi|327176858|gb|AEA29866.1| NADH dehydrogenase subunit 3 [Selaginella moellendorffii]
          Length = 122

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 2/112 (1%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
           API  ++ I+  + ++L+   F+ A     PEK+S YECGFDPFDDAR +F+IRF LVS+
Sbjct: 4   APIGFYVVISLLLSLILIGVSFLGAGS--GPEKVSAYECGFDPFDDARNRFEIRFYLVSI 61

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LF+IFDLE+ F FPWA+  K I   GF SM+VF  ILT+GF YEW++GAL+W
Sbjct: 62  LFIIFDLEVTFFFPWAISLKWIDLFGFWSMIVFFLILTIGFFYEWRQGALDW 113


>gi|57639707|gb|AAW55700.1| NADH dehydrogenase subunit 3 [Nymphaea sp. Bergthorsson 0401]
          Length = 111

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 9   APILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           API +++ I+  + ++ +  PF   +  S  P KLS +ECGFDP  DAR + DIRF  VS
Sbjct: 1   APICIYLVISPLVSLIPLGVPFPFASNSSTYPAKLSAHECGFDPSGDARSRSDIRFYPVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+I D E+ F FPWAV   +I   G  SMM FL ILT+GF+YEWK+GA
Sbjct: 61  ILFIIPDPEVTFSFPWAVPPNKIDLFGSWSMMAFLFILTIGFLYEWKRGA 110


>gi|332886924|dbj|BAK23037.1| NADH dehydrogenase subunit 3 [Yaoshanicus arcus]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAMVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|150004313|ref|YP_001299057.1| NADH dehydrogenase I chain A [Bacteroides vulgatus ATCC 8482]
 gi|212693811|ref|ZP_03301939.1| hypothetical protein BACDOR_03332 [Bacteroides dorei DSM 17855]
 gi|237709339|ref|ZP_04539820.1| NADH dehydrogenase subunit I A [Bacteroides sp. 9_1_42FAA]
 gi|237724573|ref|ZP_04555054.1| NADH dehydrogenase subunit I A [Bacteroides sp. D4]
 gi|254883412|ref|ZP_05256122.1| NADH dehydrogenase subunit I A [Bacteroides sp. 4_3_47FAA]
 gi|265755014|ref|ZP_06089928.1| NADH dehydrogenase subunit I A [Bacteroides sp. 3_1_33FAA]
 gi|294776876|ref|ZP_06742339.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Bacteroides
           vulgatus PC510]
 gi|319644248|ref|ZP_07998761.1| NADH-quinone oxidoreductase subunit [Bacteroides sp. 3_1_40A]
 gi|223635418|sp|A6L171|NUOA_BACV8 RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|149932737|gb|ABR39435.1| NADH dehydrogenase I chain A [Bacteroides vulgatus ATCC 8482]
 gi|212663700|gb|EEB24274.1| hypothetical protein BACDOR_03332 [Bacteroides dorei DSM 17855]
 gi|229437132|gb|EEO47209.1| NADH dehydrogenase subunit I A [Bacteroides dorei 5_1_36/D4]
 gi|229456724|gb|EEO62445.1| NADH dehydrogenase subunit I A [Bacteroides sp. 9_1_42FAA]
 gi|254836205|gb|EET16514.1| NADH dehydrogenase subunit I A [Bacteroides sp. 4_3_47FAA]
 gi|263234625|gb|EEZ20204.1| NADH dehydrogenase subunit I A [Bacteroides sp. 3_1_33FAA]
 gi|294449352|gb|EFG17889.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 [Bacteroides
           vulgatus PC510]
 gi|317384239|gb|EFV65211.1| NADH-quinone oxidoreductase subunit [Bacteroides sp. 3_1_40A]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 67/113 (59%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A A+V V +     ++ +S + +K   YECG      + ++F + + L +
Sbjct: 3   FTLLVVVILTAIALVAVALGIARAISPRSYNSQKGEAYECGIPTRGRSWMQFKVGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLFPWAV  + +   G  S++ FL IL +G  Y WKKGALEW
Sbjct: 63  ILFLMFDVETVFLFPWAVVVQDLGVYGLFSILFFLVILVLGLAYAWKKGALEW 115


>gi|119360701|ref|YP_913660.1| NADH dehydrogenase subunit 3 [Homaloptera leonardi]
 gi|119225367|dbj|BAF41721.1| NADH dehydrogenase subunit 3 [Homaloptera leonardi]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AI +A+ ++L  + F +   +PD EKLS YECGFDP   AR+ F IRF L+++LF
Sbjct: 4   ITTILAITTALSVLLATASFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLIAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  + +  F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLYSPVETFIWAATVLALLTLGLIYEWTQGGLEW 114


>gi|195969585|gb|ACG60629.1| NADH dehydrogenase subunit 3 [Mylopharyngodon piceus]
          Length = 116

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I  A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILTITMALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|33239777|ref|NP_874719.1| NADH dehydrogenase subunit A [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|81712844|sp|Q7VDP3|NU3C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33237303|gb|AAP99371.1| NAD(P)H-quinone oxidoreductase chain 3 [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ I++A+  + +++  +++ KS   E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYDAFLGFLLISAAVPALALVTNKLISPKSQPGERELTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL V   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALIFISILIVALAYAWRKGALEW 119


>gi|26557002|ref|NP_085553.2| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
 gi|15215919|emb|CAA69839.3| NADH dehydrogenase subunit 3 [Arabidopsis thaliana]
          Length = 119

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 62/115 (53%), Positives = 83/115 (72%), Gaps = 1/115 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPF-IVAFKSPDPEKLSTYECGFDPFDDARVKFDIR 62
           +++ +API +++ I+  + ++L+  PF   +  S  PEKLS YECGFDP  DAR +FDIR
Sbjct: 1   MMSEFAPISIYLVISLLVSLILLGVPFPFASNSSTYPEKLSAYECGFDPSGDARSRFDIR 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           F LVS+LF+I DLE+ F FPWAV   +I   GF SMM FL ILT+GF+YEWK+GA
Sbjct: 61  FYLVSILFLIPDLEVTFFFPWAVPPNKIDLFGFWSMMAFLFILTIGFLYEWKRGA 115


>gi|78778681|ref|YP_396793.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9312]
 gi|123554666|sp|Q31CN8|NU3C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|78712180|gb|ABB49357.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9312]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 76/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LLT Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+
Sbjct: 3   LLTGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|10802939|gb|AAG23687.1|AF288091_32 NADH dehydrogenase subunit 3 [Thraustochytrium aureum]
          Length = 120

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 57/120 (47%), Positives = 85/120 (70%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M+ L + YAPI++++ I+  +  ++  + + +A ++P  EKLS YECGFDPFDDAR +FD
Sbjct: 1   MTFLFSEYAPIVIYIGISMILSFIIFFASYSIAIQNPYSEKLSAYECGFDPFDDARNEFD 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++F LV++LF++FDLE +FLFPWA+    +   GF S++ F   L +GF Y WK GALEW
Sbjct: 61  VKFYLVALLFLVFDLETSFLFPWALNISYLNSFGFWSIIDFFFELVIGFFYVWKIGALEW 120


>gi|139390353|ref|YP_001122951.1| NADH dehydrogenase D3 [Aethionema cordifolium]
 gi|223635382|sp|A4QJC0|NU3C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|134286146|dbj|BAF49775.1| NADH dehydrogenase D3 [Aethionema cordifolium]
          Length = 120

 Score = 90.9 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI  +  +   I++     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPFLAFLISGILSPIRKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|280978385|ref|YP_003345314.1| NADH dehydrogenase subunit 3 [Nettastoma parviceps]
 gi|271280789|dbj|BAI53451.1| NADH dehydrogenase subunit 3 [Nettastoma parviceps]
          Length = 116

 Score = 90.9 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AI S +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IISILAITSILSCVLVTLSFWLPQMTPDSEKLSPYECGFDPLGSARLPFSMRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +   T   F   M  L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLPDTTQTFFWAMSILILLTLGLVYEWIQGGLEW 114


>gi|157098397|gb|ABV23445.1| NADH dehydrogenase subunit 3 [Myrmotherula axillaris]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 69/112 (61%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            IL  +A++S++ I+L    F +A  +P+ EKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   TILFMLALSSSLSIILTFLNFWLAQTNPNSEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     + Q            + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLQSPLTTLTWSFAIIILLTLGLVYEWTQGGLEW 114


>gi|123965562|ref|YP_001010643.1| NADH dehydrogenase subunit A [Prochlorococcus marinus str. MIT
           9515]
 gi|223635403|sp|A2BUS5|NU3C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|123199928|gb|ABM71536.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus str. MIT 9515]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/116 (41%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ I+ +++  IVA K    E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYEYFLGFLIIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEW 119


>gi|89212930|gb|ABD63935.1| NADH dehydrogenase subunit 3 [Xanthomixis cinereiceps]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + ++  + I+L    + +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   IMFMITMSLTLSIILTALNYWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q            + +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPIPWATQLQNPTTTLTWASTLIFLLTLGLIYEWTQGGLEW 114


>gi|198400383|ref|YP_002221335.1| NADH dehydrogenase subunit 3 [Psilorhynchus homaloptera]
 gi|63081843|gb|AAY30704.1| NADH dehydrogenase subunit 3 [Psilorhynchus homaloptera]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + IA A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIIALALSSILAIVSFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +   G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLLNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|91208907|ref|YP_538940.1| NADH dehydrogenase subunit 3 [Gossypium hirsutum]
 gi|325210935|ref|YP_004286009.1| NADH-plastoquinone oxidoreductase subunit 3 [Gossypium thurberi]
 gi|122201394|sp|Q2L912|NU3C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|85687421|gb|ABC73633.1| NADH-plastoquinone oxidoreductase subunit 3 [Gossypium hirsutum]
 gi|290775797|gb|ADD62293.1| NADH-plastoquinone oxidoreductase subunit 3 [Gossypium thurberi]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI I+  +   ++A     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPILAFLISGVLAPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEAFIFVLILIVGSVYAWRKGALEW 119


>gi|295065733|ref|YP_003587673.1| NADH dehydrogenase subunit 3 [Anomochloa marantoidea]
 gi|251765257|gb|ACT15411.1| NADH dehydrogenase subunit 3 [Anomochloa marantoidea]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A  S  PEKLS+YE G +P  +A ++F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILAFWISGLLAPVSEGPEKLSSYESGIEPMGEAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIVGLVYAWRKGALEW 119


>gi|322422501|ref|YP_004222078.1| NADH dehydrogenase subunit 3 [Genyomyrus donnyi]
 gi|317176405|dbj|BAJ54227.1| NADH dehydrogenase subunit 3 [Genyomyrus donnyi]
 gi|317176629|dbj|BAJ54435.1| NADH dehydrogenase subunit 3 [Campylomormyrus numenius]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA  +  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTTVAIAVLLSCVLAMISFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +T    F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLLTPTYTFLWATAILALLTLGLIYEWTQGGLEW 114


>gi|89257090|ref|YP_514452.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica LVS]
 gi|115315447|ref|YP_764170.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156503304|ref|YP_001429369.1| NADH dehydrogenase I, subunit A [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009482|ref|ZP_02274413.1| NADH-quinone oxidoreductase chain 7 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254368965|ref|ZP_04984978.1| hypothetical protein FTAG_00795 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290952989|ref|ZP_06557610.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313809|ref|ZP_06804382.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89144921|emb|CAJ80269.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica LVS]
 gi|115130346|gb|ABI83533.1| NADH dehydrogenase I, A subunit [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156253907|gb|ABU62413.1| NADH dehydrogenase I subunit A [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157121886|gb|EDO66056.1| hypothetical protein FTAG_00795 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 132

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 53/130 (40%), Positives = 79/130 (60%), Gaps = 10/130 (7%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMI----SPFIVAFKSPDPEKLSTYECGFDPFDDARV 57
           + +   +APIL+F+ IA  +     I       IV   +P+  K  T+ECGF  F +AR 
Sbjct: 3   TSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGNARE 62

Query: 58  KFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWL------GFGSMMVFLGILTVGFIY 111
           KFD+RF L++VLF++FDLE+AF+ PW +  +    +       F +M++FL +L +G IY
Sbjct: 63  KFDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIY 122

Query: 112 EWKKGALEWD 121
            WKKGALEW+
Sbjct: 123 AWKKGALEWE 132


>gi|239929564|ref|ZP_04686517.1| NADH dehydrogenase subunit NuoA2 [Streptomyces ghanaensis ATCC
           14672]
 gi|291437890|ref|ZP_06577280.1| NADH dehydrogenase subunit NuoA2 [Streptomyces ghanaensis ATCC
           14672]
 gi|291340785|gb|EFE67741.1| NADH dehydrogenase subunit NuoA2 [Streptomyces ghanaensis ATCC
           14672]
          Length = 135

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           +D   SY+ + +   +    V V   +  ++    P PEKL TYECG DP  +      +
Sbjct: 14  ADYFQSYSVVGLLAVVGLLFVAVAFGAGRLLRPVVPTPEKLLTYECGVDPVGEGWAHTQV 73

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYF--KQITWLGFGSMMVFLGILTVGFIYEWKKGALE 119
           R+ + + L+VIF ++  FLFPWA  F            M +FLG L VG +Y +KKG L 
Sbjct: 74  RYYVYAFLYVIFAVDSIFLFPWATVFAADGYGATTLVEMFIFLGFLAVGLLYAYKKGVLT 133

Query: 120 W 120
           W
Sbjct: 134 W 134


>gi|332706505|ref|ZP_08426566.1| NADH dehydrogenase subunit A [Lyngbya majuscula 3L]
 gi|332354389|gb|EGJ33868.1| NADH dehydrogenase subunit A [Lyngbya majuscula 3L]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 75/117 (64%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           +L+ Y  +L F+   S + ++ + +  ++     +PE+ +TYE G +P   A ++F+IR+
Sbjct: 3   VLSGYEYLLGFILACSLVPLLALSASKLLRPSHREPERRTTYESGMEPVGGAWIQFNIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +  +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAVAFNRLGLLAFVEALIFIAILVLALVYAWRKGALEW 119


>gi|325280123|ref|YP_004252665.1| NAD(P)H-quinone oxidoreductase subunit 3 [Odoribacter splanchnicus
           DSM 20712]
 gi|324311932|gb|ADY32485.1| NAD(P)H-quinone oxidoreductase subunit 3 [Odoribacter splanchnicus
           DSM 20712]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 65/110 (59%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           ++V +  A A+V + +    IV+ +S + +K   YECG      + ++F   + L ++LF
Sbjct: 6   LIVVILTAIALVGIALGVARIVSPRSYNRQKGEAYECGIPTRGRSWMQFKAGYYLFAILF 65

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FD+E  FLFPWAV  +     G  +++ F+ IL +G  Y W+KGALEW
Sbjct: 66  LMFDVEAVFLFPWAVTVQDAGIDGLINILFFMVILILGLAYAWRKGALEW 115


>gi|238550517|gb|ACR44373.1| NADH dehydrogenase subunit 3 [Bambusicola fytchii]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            +   ++++  +   L +  F +A  +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   TLTFMLSLSFTLSTALTLVNFWLAQTTPDTEKLSPYECGFDPLGSARLPFSVRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +              + +LT+G IYEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWAIQLTSPTTTLTWAATIITLLTLGLIYEWTQGGLEW 114


>gi|158317836|ref|YP_001510344.1| NADH dehydrogenase subunit A [Frankia sp. EAN1pec]
 gi|158113241|gb|ABW15438.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Frankia sp.
           EAN1pec]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 45/120 (37%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDI 61
           +L SY PILV +AIA    +  +    +V  K  +  K+  YECG +P        +F +
Sbjct: 1   MLDSYVPILVLLAIAMLFAVGSVAVSALVGPKRFNRAKVDIYECGIEPEPTPAGPHRFPV 60

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++ + ++LF++FD+EI FLFPWAV F  +   G G+M+ F+  + V + Y W++G LEWD
Sbjct: 61  KYYITAMLFIVFDIEIIFLFPWAVTFDSLAVFGLGAMVSFMATIFVAYAYIWRRGGLEWD 120


>gi|159106869|ref|YP_001531288.1| NADH-plastoquinone oxidoreductase subunit 3 [Lolium perenne]
 gi|223635389|sp|A8Y9H5|NU3C_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|158934403|emb|CAO85981.1| NADH-plastoquinone oxidoreductase subunit 3 [Lolium perenne]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 71/117 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A  S  PEKLS+YE G +P   A ++F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILAFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEW 119


>gi|290489994|gb|ADD31404.1| NADH-plastoquinone oxidoreductase subunit 3 protein [Quercus nigra]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IASAI I+  +   ++A     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIIASAIPILAFLISGVLAPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGISVFIEAFIFVLILIVGSVYAWRKGALEW 119


>gi|324309723|gb|ADY18504.1| NADH dehydrogenase subunit 3 [Phaeodactylum tricornutum]
          Length = 126

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 51/120 (42%), Positives = 79/120 (65%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDI 61
           S +   Y  +L ++  A  + ++++   + +  ++PD EKLS YECGF+P++D R  FDI
Sbjct: 7   SSVKNEYLTLLFYLVFAVFLTVLIIGLSYFLVRQNPDSEKLSAYECGFEPYEDTRHVFDI 66

Query: 62  RFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           +FC++ +LF+IFD+EI FL PW +   ++  LGF SM+ FL  L +GF Y W  GAL+WD
Sbjct: 67  KFCVIGILFLIFDIEIMFLVPWCISISKLDILGFWSMIDFLVELGIGFFYVWYVGALDWD 126


>gi|313199633|ref|YP_004021249.1| NADH-plastoquinone oxidoreductase subunit 3 [Isoetes flaccida]
 gi|291575362|gb|ADE18075.1| NADH-plastoquinone oxidoreductase subunit 3 [Isoetes flaccida]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 47/113 (41%), Positives = 72/113 (63%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           Y   L+F+ IAS I +V       +A  S  PEK  +YE G +P  DAR++F IR+ + +
Sbjct: 7   YNFFLLFLPIASLIPLVAFPISGALAPVSKGPEKFISYESGIEPMGDARIQFQIRYYMFA 66

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FVIFD+E  F +PWA+ F+++    F   ++F+ IL VG +Y W++GALEW
Sbjct: 67  LVFVIFDVETVFPYPWAMSFRELGIPAFIEALIFVIILIVGLVYAWRRGALEW 119


>gi|126215481|ref|YP_001054822.1| NADH dehydrogenase subunit 3 [Odax cyanomelas]
 gi|125625491|dbj|BAF46851.1| NADH dehydrogenase subunit 3 [Odax cyanomelas]
          Length = 115

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 1/113 (0%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
             I   + IA+ +  VL+I  F +   +PD EKLS YECGFDP   AR+ F ++F L+++
Sbjct: 1   MSITGILTIAAVLATVLVILSFWLPQMNPDHEKLSPYECGFDPLGSARLPFSLQFFLIAI 60

Query: 69  LFVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LF++FDLEIA L P     +     L F      L +LT+G IYEW +G LEW
Sbjct: 61  LFLLFDLEIALLLPLPWGDQLTSPLLTFTCASTVLALLTIGLIYEWTQGGLEW 113


>gi|119360617|ref|YP_913400.1| NADH dehydrogenase subunit 3 [Zacco sieboldii]
 gi|119225087|dbj|BAF41461.1| NADH dehydrogenase subunit 3 [Zacco sieboldii]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 52/111 (46%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I    AI  A+ +VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTIFAITMALSLVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLQNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|117927476|ref|YP_872027.1| NADH dehydrogenase subunit A [Acidothermus cellulolyticus 11B]
 gi|117647939|gb|ABK52041.1| NADH dehydrogenase subunit A [Acidothermus cellulolyticus 11B]
          Length = 119

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 2/119 (1%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDA--RVKFDIR 62
           + SY PI     +A    +  +I+  +   K  +  K   YECG +P        +F ++
Sbjct: 1   MFSYVPIFALFLLAGGFAVFSVIAGSLTGPKRYNRAKYDAYECGIEPTPQPIGGGRFPVK 60

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           + L ++LF++FD+EI FL+PWAV +  +   G   M++F+  + + ++Y W++G LEWD
Sbjct: 61  YYLTAMLFIVFDIEIIFLYPWAVAYGDMGVFGLVEMLLFIVTVLIAYVYVWRRGGLEWD 119


>gi|291515381|emb|CBK64591.1| NADH dehydrogenase subunit A [Alistipes shahii WAL 8301]
 gi|313156906|gb|EFR56344.1| putative NADH dehydrogenase subunit A [Alistipes sp. HGB5]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 68/113 (60%)

Query: 8   YAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           +  ++V +  A A+V V +     V+ +S +P+K   YECG      + ++F + + L +
Sbjct: 3   FTLLVVVILTAIALVAVALGIARAVSPRSYNPQKGEAYECGIPTRGRSWMQFKVGYYLFA 62

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +LF++FD+E  FLF WAV  +++   G  S++ FL +L +G  Y W+KGALEW
Sbjct: 63  ILFLMFDVETVFLFSWAVVVQELGVYGLVSILFFLVVLILGLAYAWRKGALEW 115


>gi|85680151|gb|ABC72278.1| NADH dehydrogenase subunit 3 [Lythrurus bellus]
          Length = 116

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           ++  + IA A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   LITTIIIAVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  +  G F      L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHSPTGTFFWATTVLILLTLGLVYEWTQGGLEW 114


>gi|323149087|ref|YP_004222651.1| NADH-plastoquinone oxidoreductase subunit 3 [Anthriscus cerefolium]
 gi|289645580|gb|ADD13643.1| NADH-plastoquinone oxidoreductase subunit 3 [Anthriscus cerefolium]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y    VF+ I+S I I+      ++A  +  PEKLS+YE G +P  +A ++F IR+
Sbjct: 3   LLYEYDIFWVFLIISSLIPILAFFVSGVLAPINKGPEKLSSYESGIEPMGNAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEW 119


>gi|169142696|ref|YP_001687123.1| NADH dehydrogenase subunit 3 [Oenothera argillicola]
 gi|169143017|ref|YP_001687437.1| NADH dehydrogenase subunit 3 [Oenothera parviflora]
 gi|223635368|sp|B0Z5B4|NU3C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635392|sp|B0Z4L2|NU3C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|159792934|gb|ABW98690.1| NADH dehydrogenase subunit 3 [Oenothera argillicola]
 gi|159895543|gb|ABX10107.1| NADH dehydrogenase subunit 3 [Oenothera parviflora]
          Length = 120

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+      ++A  S  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSVIPILAFRISGLLAPTSKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEW 119


>gi|280978175|ref|YP_003345119.1| NADH dehydrogenase subunit 3 [Rhinomuraena quaesita]
 gi|271280179|dbj|BAI53192.1| NADH dehydrogenase subunit 3 [Rhinomuraena quaesita]
          Length = 116

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIVSILMITTTLSCVLIFVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     + I            + +LT+G  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGNQLIDATQTLFWATSIIILLTIGLAYEWTQGGLEW 114


>gi|270308194|ref|YP_003330252.1| NADH:quinone oxidoreductase subunit 3 (chain A) [Dehalococcoides
           sp. VS]
 gi|270154086|gb|ACZ61924.1| NADH:quinone oxidoreductase subunit 3 (chain A) [Dehalococcoides
           sp. VS]
          Length = 123

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIV-----AFKSPDPEKLSTYECGFDPFDDARVK 58
           +LT Y  I +F+  A     V++  P ++         PD  K + YECG +      V+
Sbjct: 1   MLTDYGYIALFLVAAILFTAVVLGLPVLLQKIGIIPNKPDKVKNAAYECGVETHGRTWVQ 60

Query: 59  FDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           F+ R+   ++L + FD+ + FLFPWA     + +  FG + +FL I+ VG++Y WKKGAL
Sbjct: 61  FNFRYYYYALLLIAFDVLLVFLFPWATQIGSLGFYAFGIVFIFLLIVLVGYLYAWKKGAL 120

Query: 119 EWD 121
           EW+
Sbjct: 121 EWN 123


>gi|33860852|ref|NP_892413.1| NADH dehydrogenase subunit A [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|81711988|sp|Q7TUF8|NU3C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3; AltName:
           Full=NAD(P)H dehydrogenase subunit 3; AltName:
           Full=NADH-plastoquinone oxidoreductase subunit 3;
           AltName: Full=NDH-1 subunit 3; Short=NDH-C
 gi|33633794|emb|CAE18753.1| putative NADH Dehydrogenase (complex I) subunit (chain 3)
           [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
          Length = 120

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 74/116 (63%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           L  Y   L F+ IA+A+ I+ +++  IV+ K    E+  TYE G +P   A ++F+IR+ 
Sbjct: 4   LPGYEYFLGFLIIAAAVPILALVTNLIVSPKGRTGERKLTYESGMEPIGGAWIQFNIRYY 63

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + +++FVIFD+E  FL+PWAV F ++  L F   ++F+ IL +   Y W+KGALEW
Sbjct: 64  MFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFITILVIALAYAWRKGALEW 119


>gi|38018040|ref|NP_937928.1| NADH dehydrogenase subunit 3 [Hiodon alosoides]
 gi|25006514|dbj|BAC24004.1| NADH dehydrogenase subunit 3 [Hiodon alosoides]
          Length = 116

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+V + IA+ + +VL    F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMVILTIATILCLVLATVAFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLSDPTETFFWATAVLILLTLGLVYEWIQGGLEW 114


>gi|51572550|gb|AAU07775.1| NADH dehydrogenase subunit 3 [Hypsipetes olivaceus]
 gi|51572552|gb|AAU07776.1| NADH dehydrogenase subunit 3 [Hypsipetes olivaceus]
          Length = 116

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   +A + A+ I L    F +A  +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTFMLAASLALSIALTTLNFWLAQMTPDSEKLSPYECGFDPLGSARLPFSVRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +              + ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLDTPTTTLAWASALILILTLGLVYEWAQGGLEW 114


>gi|57639715|gb|AAW55704.1| NADH dehydrogenase subunit 3 [Dicranum scoparium]
          Length = 110

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSP--DPEKLSTYECGFDPFDDARVKFDIRFCLVS 67
           PI V++ I     ++L+   F+ A  S    PEKLS YECGFDPFDDAR +FDIRF LVS
Sbjct: 1   PICVYLVINLLFSLILIGVSFLFASSSNLAYPEKLSAYECGFDPFDDARSRFDIRFYLVS 60

Query: 68  VLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGA 117
           +LF+IFD E+ FLFPWAV   +I   GF SM+VFL I T+GF YEWKKGA
Sbjct: 61  ILFIIFDSEVTFLFPWAVSPNKIGLFGFWSMIVFLSISTIGFSYEWKKGA 110


>gi|332886882|dbj|BAK22998.1| NADH dehydrogenase subunit 3 [Aspidoparia morar]
          Length = 116

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I     IA+A+ ++L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITATALIATALSVILAVVAFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P           G    +   L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNHLHNPAGTLFWVTAVLVLLTLGLIYEWAQGGLEW 114


>gi|118430307|ref|YP_874741.1| NADH-plastoquinone oxidoreductase subunit 3 [Agrostis stolonifera]
 gi|223635380|sp|A1EA13|NU3C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|118201216|gb|ABK79585.1| NADH-plastoquinone oxidoreductase subunit 3 [Agrostis stolonifera]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 71/117 (60%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      I+A  S  PEKLS+YE G +P   A ++F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILAFWISGILAPVSEGPEKLSSYESGIEPMGGAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEW 119


>gi|161561746|ref|YP_001586142.1| NADH dehydrogenase subunit 3 [Rhynochetos jubatus]
 gi|143024739|gb|ABO93090.1| NADH dehydrogenase subunit 3 [Rhynochetos jubatus]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
            +    A+++ +  +L+   F +A  +PDPEKLS YECGFDP   AR+ F IRF LV++L
Sbjct: 3   TVTFMFALSTTLAALLITLNFWLAQMNPDPEKLSPYECGFDPLGSARLPFSIRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +              + +LT+G  YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWATQLHSPTYTLTWAYAIIILLTLGLAYEWLQGGLEW 114


>gi|114329973|ref|YP_740655.1| NADH-plastoquinone oxidoreductase subunit 3 [Nandina domestica]
 gi|122165956|sp|Q09FV6|NU3C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|114054475|gb|ABI49868.1| NADH-plastoquinone oxidoreductase subunit 3 [Nandina domestica]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++A  S  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEW 119


>gi|317176783|dbj|BAJ54578.1| NADH dehydrogenase subunit 3 [Pollimyrus adspersus]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA  +  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTTVAIAVLLSCILAMVSFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + IT    F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLITPTHTFLWATAILALLTLGLIYEWIQGGLEW 114


>gi|262400766|gb|ACY66255.1| NADH dehydrogenase subunit 3 [Brassica napus]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 74/117 (63%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+SAI ++  +   +++  +  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFLIISSAIPVLAFLISGVLSPITKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEW 119


>gi|85680139|gb|ABC72272.1| NADH dehydrogenase subunit 3 [Lythrurus atrapiculus]
 gi|85680141|gb|ABC72273.1| NADH dehydrogenase subunit 3 [Lythrurus atrapiculus]
 gi|85680143|gb|ABC72274.1| NADH dehydrogenase subunit 3 [Lythrurus atrapiculus]
 gi|85680145|gb|ABC72275.1| NADH dehydrogenase subunit 3 [Lythrurus atrapiculus]
          Length = 117

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I     IA A+  VL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 5   ITTIFIIAVALSSVLAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 64

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  +  G F      L +LT+G +YEW +G LEW
Sbjct: 65  LLFDLEIALLLPLPWGDQLHSPTGTFFWATTVLILLTLGLVYEWTQGGLEW 115


>gi|29367117|gb|AAO72305.1| NdhC [Hordeum vulgare]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I+      ++A  S  PEKLS+YE G +P   A V+F IR+
Sbjct: 3   LLYEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEPMGGAWVQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILVVGLVYAWRKGALEW 119


>gi|156598676|gb|ABU85593.1| NADH-plastoquinone oxidoreductase subunit 3 [Scaevola aemula]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y P   F+ I+S I I+      ++A  S  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDPFWAFLIISSLIPILAFFISGVLAPISKGPEKLSSYESGIEPIGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL +G +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEAFIFMLILILGLVYAWRKGALEW 119


>gi|34501410|ref|NP_904197.1| NADH dehydrogenase subunit 3 [Physcomitrella patens subsp. patens]
 gi|75294074|sp|Q6YXR0|NU3C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|34494780|dbj|BAC85047.1| NADH dehydrogenase ND3 subunit [Physcomitrella patens subsp.
           patens]
          Length = 121

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIR 62
           LL  Y    +F+ +AS I I+       +A  +   PEKL++YE G +P  DA ++F IR
Sbjct: 3   LLPKYNSFFIFLLLASVIPILAFSISKFLAPNNTQGPEKLTSYESGIEPMGDAWIQFQIR 62

Query: 63  FCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           + + +++FVIFD+E  FL+PWA+ F  +    F   +VF+ IL +G +Y W+KGALEW
Sbjct: 63  YYMFALVFVIFDVETVFLYPWAMSFNDLGLSAFIEALVFVFILIIGLVYAWRKGALEW 120


>gi|332886896|dbj|BAK23011.1| NADH dehydrogenase subunit 3 [Nicholsicypris normalis]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILIITVALSSILAMVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|11467197|ref|NP_043030.1| NADH dehydrogenase subunit 3 [Zea mays]
 gi|48478776|ref|YP_024384.1| NADH dehydrogenase subunit 3 [Saccharum hybrid cultivar SP-80-3280]
 gi|50812533|ref|YP_054636.1| NADH dehydrogenase subunit 3 [Saccharum officinarum]
 gi|118614497|ref|YP_899412.1| NADH-plastoquinone oxidoreductase subunit 3 [Sorghum bicolor]
 gi|242057529|ref|XP_002457910.1| hypothetical protein SORBIDRAFT_03g020210 [Sorghum bicolor]
 gi|260677424|ref|YP_003208192.1| NADH-plastoquinone oxidoreductase subunit 3 [Coix lacryma-jobi]
 gi|128688|sp|P19044|NU3C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|75290175|sp|Q6ENV8|NU3C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|75291225|sp|Q6L394|NU3C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|223635386|sp|A1E9S9|NU3C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 3,
           chloroplastic; AltName: Full=NAD(P)H dehydrogenase
           subunit 3; AltName: Full=NADH-plastoquinone
           oxidoreductase subunit 3
 gi|902227|emb|CAA60291.1| NADH dehydrogenase D3 [Zea mays]
 gi|48478678|gb|AAT44698.1| NADH dehydrogenase subunit 3 [Saccharum hybrid cultivar SP80-3280]
 gi|49659517|dbj|BAD27298.1| NADH dehydrogenase ND3 subunit [Saccharum hybrid cultivar NCo 310]
 gi|118201131|gb|ABK79501.1| NADH-plastoquinone oxidoreductase subunit 3 [Sorghum bicolor]
 gi|209361362|gb|ACI43277.1| NADH-plastoquinone oxidoreductase subunit 3 [Coix lacryma-jobi]
 gi|241929885|gb|EES03030.1| hypothetical protein SORBIDRAFT_03g020210 [Sorghum bicolor]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/117 (41%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IAS I I++     ++A  S  PEKLS+YE G +P   A ++F IR+
Sbjct: 3   LLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEW 119


>gi|313183998|ref|YP_004021155.1| NADH-plastoquinone oxidoreductase subunit 3 [Castanea mollissima]
 gi|309321525|gb|ADO65065.1| NADH-plastoquinone oxidoreductase subunit 3 [Castanea mollissima]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ IASAI I+  +   ++A     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDIFWAFIIIASAIPILAFLISGVLAPIRKGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F    +F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGISVFIEAFIFVLILIVGSVYAWRKGALEW 119


>gi|290489968|gb|ADD31391.1| NADH-plastoquinone oxidoreductase subunit 3 protein [Nelumbo
           nucifera]
          Length = 120

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 73/117 (62%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+  +   ++A     PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLHEYDIFWAFLIISSVIPILAFLISGVLAPIREGPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F  +    F   ++F+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEW 119


>gi|257453967|ref|ZP_05619243.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Enhydrobacter aerosaccus SK60]
 gi|257448632|gb|EEV23599.1| NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
           [Enhydrobacter aerosaccus SK60]
          Length = 177

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 63/112 (56%)

Query: 9   APILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSV 68
              +VF+  A  + I +++ P ++   S   +K   +E G      AR++   +F +V++
Sbjct: 7   WSAIVFILAAIGLCIFMLVVPRLLGGTSKGFQKQENFESGVVSAGSARIRLSAKFYIVAI 66

Query: 69  LFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            FVIFDLE  +L+ +AV  K+  WLGF ++++F+  L +G  Y  K GAL W
Sbjct: 67  FFVIFDLEALYLYTYAVSVKEAGWLGFWTVVLFVVELLIGLYYLLKLGALNW 118


>gi|256425968|ref|YP_003126621.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chitinophaga
           pinensis DSM 2588]
 gi|256040876|gb|ACU64420.1| NADH-ubiquinone/plastoquinone oxidoreductase chain 3 [Chitinophaga
           pinensis DSM 2588]
          Length = 130

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 72/115 (62%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           SY PI++ +  A   V V M++   +  K    +KL+T+E G +   +AR    I++ L 
Sbjct: 15  SYFPIVMQLLAALGFVGVTMLATHFLGPKRKTSDKLATFESGIEQKGNARQPVAIKYFLT 74

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
           ++LFV+FD+E+ F +P+AV F+ + W GF +M++F+     GFIY  KKGAL+W+
Sbjct: 75  AILFVLFDVEVIFFYPYAVNFRGLGWDGFMAMLLFVAFFLCGFIYILKKGALKWE 129


>gi|192293783|ref|YP_001994422.1| NADH dehydrogenase subunit 3 [Acanella eburnea]
 gi|148964838|gb|ABR19860.1| NADH dehydrogenase subunit 3 [Acanella eburnea]
          Length = 115

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 81/115 (70%), Gaps = 2/115 (1%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
            +  IL+ + ++  + I+++ + +++  K PD EK+S YECGFDPFD+    F +RF L+
Sbjct: 2   EFKGILILLIVSGTLSIIILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLI 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEWD 121
            +LF+IFDLEI+FLFPWAV +  +   G+  +M+FL ILT+G +YEW +G LEW+
Sbjct: 62  GILFLIFDLEISFLFPWAVTY--MALFGYWVVMLFLFILTLGLVYEWIEGGLEWE 114


>gi|320449690|ref|YP_004201786.1| NADH-quinone oxidoreductase subunit A [Thermus scotoductus SA-01]
 gi|320149859|gb|ADW21237.1| NADH-quinone oxidoreductase, subunit A [Thermus scotoductus SA-01]
          Length = 119

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/115 (35%), Positives = 68/115 (59%), Gaps = 1/115 (0%)

Query: 6   TSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCL 65
             Y  IL+++ +A  I +  ++   ++  K P   KL  YE G DP  + + +F + F +
Sbjct: 5   AEYVSILIYLGVALFIGVAALVVGALLGPKKPGKAKLMPYESGNDPAGEVK-RFPVHFYV 63

Query: 66  VSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           V++LF++FD+E+AFL+P+AV    +   GF  +  F  +L VGF+YEW KG + W
Sbjct: 64  VAMLFILFDVEVAFLWPYAVSAGTLGLYGFLGVAGFTLLLFVGFLYEWWKGVMRW 118


>gi|288801143|ref|ZP_06406599.1| proton-translocating NADH-quinone oxidoreductase, A subunit
           [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332077|gb|EFC70559.1| proton-translocating NADH-quinone oxidoreductase, A subunit
           [Prevotella sp. oral taxon 299 str. F0039]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 59/114 (51%)

Query: 7   SYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLV 66
           ++   +  +  A  +V+       ++  +S +  K   +ECG      + +   + + L 
Sbjct: 2   NFILFITVLITAVFLVVAAYAIAKLIGPRSYNAVKGEPFECGIPTRGSSWIPVHVGYYLF 61

Query: 67  SVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++LF++FD+E  FL+PWAV  K+I      S+  FL +L  G  Y W+KGALEW
Sbjct: 62  AILFLMFDVETVFLYPWAVVVKEIGTTALASIGFFLLVLVFGLAYAWRKGALEW 115


>gi|126216064|gb|ABN81088.1| NADH dehydrogenase subunit 3 [Turdus lawrencii]
          Length = 111

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 1/109 (0%)

Query: 13  VFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVI 72
             +A++ A+ I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++
Sbjct: 1   FMIALSLALSIALTTLNFWLAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLL 60

Query: 73  FDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           FDLEIA L P     + Q            + +LT+G  YEW +G LEW
Sbjct: 61  FDLEIALLLPLPWATQLQYPTTTLIWASALVILLTLGLAYEWTQGGLEW 109


>gi|23428742|gb|AAM00183.1| NADH dehydrogenase subunit 3 [Xiphorhynchus triangularis bangsi]
          Length = 109

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 15  MAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLFVIFD 74
           +A++ ++ IVL +  F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF++FD
Sbjct: 1   LALSMSLSIVLTMLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILFLLFD 60

Query: 75  LEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           LEIA L P     + Q            + +LT+G +YEW +G LEW
Sbjct: 61  LEIALLLPLPWATQLQSPLSTLTWTSTIIILLTLGLVYEWAQGGLEW 107


>gi|110456682|gb|ABG74791.1| NADH dehydrogenase subunit 3 [Jasminum abyssinicum]
          Length = 120

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/117 (42%), Positives = 69/117 (58%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I I+      I+A     PEKLS+YE G +P  DA  +F IR+
Sbjct: 3   LLYEYDIFWAFLIISSLIPILTFFISGILAPIRKGPEKLSSYESGIEPMGDAWFQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FV+FD+E  FL+PWA+ F       F    VF+ IL VG +Y W+KGALEW
Sbjct: 63  YMFALVFVVFDVETVFLYPWAMSFDVSGLSVFIEAFVFVLILIVGLVYAWRKGALEW 119


>gi|290489980|gb|ADD31397.1| NADH-plastoquinone oxidoreductase subunit 3 protein [Euonymus
           americanus]
          Length = 120

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 72/117 (61%)

Query: 4   LLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRF 63
           LL  Y     F+ I+S I ++  +   ++A  +  PEKLS+YE G +P  DA ++F IR+
Sbjct: 3   LLYEYDLFWAFLIISSVIPVLAFLISGVLAPLNKRPEKLSSYESGIEPMGDAWLQFRIRY 62

Query: 64  CLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
            + +++FVIFD+E  FL+PWA+ F  +    F    +F+ IL  G +Y W+KGALEW
Sbjct: 63  YMFALVFVIFDVETVFLYPWAMSFDVVGVSVFIEAFIFVLILIAGLVYAWRKGALEW 119


>gi|237648859|dbj|BAH58955.1| NADH dehydrogenase subunit 3 [Notopterus notopterus]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 54/111 (48%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + IA+A+  VL I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTALIIATALSCVLAIIAFWIPQMSPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +  T  L F    V L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLTTPTLTFIWATVILTLLTLGLVYEWLQGGLEW 114


>gi|38638383|ref|NP_943624.1| NADH dehydrogenase subunit 3 [Huso huso]
 gi|38304807|gb|AAR16149.1| NADH dehydrogenase subunit 3 [Huso huso]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  +AIA  +  +L +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMAVLAIAITLSCILAVVAFWLPQMNPDSEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQ-ITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +              L +LT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLASPTAALLWATAILILLTLGLVYEWTQGGLEW 114


>gi|63081787|gb|AAY30652.1| NADH dehydrogenase subunit 3 [Gyrinocheilus aymonieri]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTILLITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +   G F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGNQLLNPTGTFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|256427175|ref|YP_003126947.1| NADH dehydrogenase subunit 3 [Kyphosus cinerascens]
 gi|256353327|dbj|BAH97838.1| NADH dehydrogenase subunit 3 [Kyphosus cinerascens]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   + IA+A+  +L I  F +   SPD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTTVITIAAALCTILAIVSFWLPQMSPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLSSPLTTFLWASAVLILLTLGLIYEWLQGGLEW 114


>gi|312233329|ref|YP_004021543.1| NADH dehydrogenase subunit 3 [Micropterus floridanus]
 gi|310619491|gb|ADP01858.1| NADH dehydrogenase subunit 3 [Micropterus floridanus]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   + IA+A+ IVL I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTTIICIAAALCIVLAIISFWLPQMNPDHEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQIT-WLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +     F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLMNPLTTFLWASAVLILLTLGLIYEWSQGGLEW 114


>gi|255506446|ref|YP_003097197.1| NADH dehydrogenase subunit 3 [Xenocypris davidi]
 gi|254547194|gb|ACT66668.1| NADH dehydrogenase subunit 3 [Xenocypris davidi]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I+  + I  A+  +L I  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   IMTILTITVALSSILAIVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLG-FGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +     G F    + L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTGTFFWATMVLILLTLGLIYEWTQGGLEW 114


>gi|119360269|ref|YP_913413.1| NADH dehydrogenase subunit 3 [Barbus barbus]
 gi|119225101|dbj|BAF41474.1| NADH dehydrogenase subunit 3 [Barbus barbus]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           +   + I   + +VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   VTTILIITMTLSLVLAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     +       F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLHNPTETFFWATTVLILLTLGLIYEWTQGGLEW 114


>gi|6714880|gb|AAF26193.1| NADH dehydrogenase subunit III [Pteroptochos castaneus]
 gi|6714881|gb|AAF26194.1| NADH dehydrogenase subunit III [Pteroptochos castaneus]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           IL  + I++++ I+L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ILFMLTISASLSIILTTLNFWLAQMNPDSEKLSPYECGFDPLGTARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q            + ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWATQLQSPLTTLTWSTSIIVILTLGLVYEWLQGGLEW 114


>gi|55378229|ref|YP_136079.1| NAD(P)H-quinone oxidoreductase subunit 3 [Haloarcula marismortui
           ATCC 43049]
 gi|55230954|gb|AAV46373.1| NAD(P)H-quinone oxidoreductase chain 3 [Haloarcula marismortui ATCC
           43049]
          Length = 177

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 2   SDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARV-KFD 60
           + +   +  I     +A AI + +M    ++    P+  K +TYE G  P   +R  KF+
Sbjct: 39  TGMSNPWIAIGALAVVALAIPLTMMAVSSLLRPSVPEQGKRTTYESGEVPTGSSRQIKFN 98

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQI-----TWLGFGSMMVFLGILTVGFIYEWKK 115
           I++ +V++LFV+FD+E  F+FPW V +               M+VF+ IL +G  + W+ 
Sbjct: 99  IQYYMVALLFVVFDIETVFIFPWTVIYSDAAAELGMTTALLPMVVFITILAIGLGWAWRN 158

Query: 116 GALEW 120
           GA++W
Sbjct: 159 GAVQW 163


>gi|322422737|ref|YP_004222529.1| NADH dehydrogenase subunit 3 [Hippopotamyrus wilverthi]
 gi|317176517|dbj|BAJ54331.1| NADH dehydrogenase subunit 3 [Hippopotamyrus wilverthi]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +AIA  +  VL +  F +   +PD EKLS YECGFDP   AR+ F +RF LV++LF
Sbjct: 4   ITTTVAIAVLLSCVLAMISFWLPQMNPDTEKLSPYECGFDPLGSARLPFSLRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFKQI-TWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + +     F      L +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWGDQLLAPTHTFLWATAILALLTLGLIYEWTQGGLEW 114


>gi|113171314|gb|ABI30703.1| NADH dehydrogenase subunit 3 [Yuhina castaniceps]
 gi|220900372|gb|ACL82386.1| NADH dehydrogenase subunit 3 [Yuhina castaniceps]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (58%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I   +A++  + I L    F +A  +PD EKLS YECGFDP   AR+ F IRF LV++LF
Sbjct: 4   ITFMIALSLTLSIALTALNFWIAQMNPDSEKLSPYECGFDPLGSARLPFSIRFFLVAILF 63

Query: 71  VIFDLEIAFLFPWAVYFK-QITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P     + Q            + ILT+G +YEW +G LEW
Sbjct: 64  LLFDLEIALLLPLPWAIQLQNPTTTLIWTSTLIIILTLGLVYEWAQGGLEW 114


>gi|86158992|ref|YP_465777.1| NADH-ubiquinone/plastoquinone oxidoreductase subunit 3
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123764105|sp|Q2IL11|NUOA_ANADE RecName: Full=NADH-quinone oxidoreductase subunit A; AltName:
           Full=NADH dehydrogenase I subunit A; AltName: Full=NDH-1
           subunit A; AltName: Full=NUO1
 gi|85775503|gb|ABC82340.1| NADH dehydrogenase subunit A [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 129

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M   L  Y PI V + +A  +   ++    ++  + P   K + +ECG +P   AR +F 
Sbjct: 1   MLTPLQIYFPIGVVLLVAVVLAFTMLGLANVLGPRRPSLVKQTPFECGSEPIGSARERFG 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYF-------KQITWLGFGSMMVFLGILTVGFIYEW 113
           ++F +V++LF++FD+E  FL+PWAV           + W GF SM +F+  L  G +Y W
Sbjct: 61  VKFYVVALLFIVFDIEAIFLYPWAVLLLPDGQGYPGLGWPGFISMGIFVFTLVAGLVYVW 120

Query: 114 KKGALEW 120
           KKG L+W
Sbjct: 121 KKGVLDW 127


>gi|313126886|ref|YP_004037156.1| NADH:ubiquinone oxidoreductase subunit 3 (chain a) [Halogeometricum
           borinquense DSM 11551]
 gi|312293251|gb|ADQ67711.1| NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Halogeometricum
           borinquense DSM 11551]
          Length = 138

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 6/122 (4%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ +  I     +A  I + +M    I+    P+  K +TYE G  P   ARV+F+I++ 
Sbjct: 1   MSEWIAIGALALVAVGIPLGMMAVSAILRPSVPEQGKSATYESGEIPTGTARVQFNIQYY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQITWLG------FGSMMVFLGILTVGFIYEWKKGAL 118
           +V++LFV+FD+E   +FPW V ++     G         M++F+G+L VG  + W+ GA+
Sbjct: 61  MVALLFVVFDIETVLIFPWTVIYRSALSQGADLATVLLPMLIFIGVLVVGLAWAWRNGAV 120

Query: 119 EW 120
           EW
Sbjct: 121 EW 122


>gi|292655138|ref|YP_003535035.1| NADH dehydrogenase-like complex subunit A [Haloferax volcanii DS2]
 gi|291372577|gb|ADE04804.1| NADH dehydrogenase-like complex subunit A [Haloferax volcanii DS2]
          Length = 138

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 6/122 (4%)

Query: 5   LTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFC 64
           ++ +  I     +   I + +M    ++    P+  K +TYE G  P   ARV+F+I++ 
Sbjct: 1   MSDWIAIGAMGLVGVGIPLAMMAVSALLRPSVPEQGKSATYESGEVPTGTARVQFNIQYY 60

Query: 65  LVSVLFVIFDLEIAFLFPWAVYFKQ------ITWLGFGSMMVFLGILTVGFIYEWKKGAL 118
           +V++LF++FD+E   +FPW V ++               M+VF+G+L VG ++ W+ GA+
Sbjct: 61  MVALLFLVFDIETVLIFPWTVIYRSALEQGASLATILTPMLVFIGVLVVGLVWAWRNGAV 120

Query: 119 EW 120
           +W
Sbjct: 121 KW 122


>gi|54024636|ref|YP_118878.1| NADH dehydrogenase subunit A [Nocardia farcinica IFM 10152]
 gi|54016144|dbj|BAD57514.1| putative NADH dehydrogenase I chain A [Nocardia farcinica IFM
           10152]
          Length = 126

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 68/121 (56%), Gaps = 9/121 (7%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDD---------ARVKFD 60
           P LV  A+A A  +  ++   +V  K  +  KL  YECG +P               +F 
Sbjct: 6   PTLVLGALAGAFAVFSIVLSALVGPKRYNRAKLEAYECGIEPTPHAVAGGPGNATGQRFP 65

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ L ++LF+IFD+EI FL+PWAV+F  +   G  +M +F+  +++ + YEW++G L W
Sbjct: 66  VKYYLTAMLFIIFDIEIVFLYPWAVHFDALGLFGLVAMALFIVNVSIAYAYEWRRGGLSW 125

Query: 121 D 121
           D
Sbjct: 126 D 126


>gi|280978427|ref|YP_003345353.1| NADH dehydrogenase subunit 3 [Stemonidium hypomelas]
 gi|271280572|dbj|BAI53374.1| NADH dehydrogenase subunit 3 [Stemonidium hypomelas]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 67/112 (59%), Gaps = 1/112 (0%)

Query: 10  PILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           PI+  + I + +  VL+   F +   +PD EKLS YECGFDP   AR+ F +RF LV++L
Sbjct: 3   PIISILTIVTILSCVLITVSFWLPQMNPDSEKLSPYECGFDPLGSARLPFSMRFFLVAIL 62

Query: 70  FVIFDLEIAFLFPWAVYFKQITWL-GFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FDLEIA L P     +    +      +  + +LT+G +YEW +G LEW
Sbjct: 63  FLLFDLEIALLLPLPWGDQLPDIMDTLFLALAIIILLTLGLVYEWTQGGLEW 114


>gi|299825740|ref|YP_003734670.1| NADH dehydrogenase subunit 3 [Anchoviella sp. LBP 2297]
 gi|299758147|dbj|BAJ09841.1| NADH dehydrogenase subunit 3 [Anchoviella sp. LBP 2297]
          Length = 116

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 52/111 (46%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYEC