RPSBLAST alignment for GI: 254780852 and conserved domain: MTH00148

>gnl|CDD|177205 MTH00148, ND3, NADH dehydrogenase subunit 3; Provisional. Length = 117
 Score = 85.7 bits (213), Expect = 3e-18
 Identities = 42/112 (37%), Positives = 67/112 (59%), Gaps = 2/112 (1%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSP-DPEKLSTYECGFDPFDDARVKFDIRFCLVSVL 69
           IL+ +  A  +  VL++   +++ +S  D EK S +ECGFDP   AR  F +RF L+++L
Sbjct: 4   ILLSLLFALILSPVLLLLGLVLSKRSYSDREKSSPFECGFDPISSARSPFSLRFFLLAIL 63

Query: 70  FVIFDLEIAFLFP-WAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           F++FD+EI  LFP         +     S+ +FL IL +G  +EW +G+L+W
Sbjct: 64  FLVFDVEIVLLFPVLQSLGSSFSVWSLTSLFIFLLILILGLFHEWNEGSLDW 115