RPSBLAST alignment for GI: 254780852 and conserved domain: MTH00203

>gnl|CDD|177248 MTH00203, ND3, NADH dehydrogenase subunit 3; Provisional. Length = 112
 Score = 84.6 bits (210), Expect = 7e-18
 Identities = 49/110 (44%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 11  ILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFDIRFCLVSVLF 70
           I++F  IA  + ++L+   F +   +PD EKLS YECGFDP   AR+ F ++F LV++ F
Sbjct: 4   IMLFFLIALLLSLILLFIAFWLPKVNPDGEKLSPYECGFDPLGSARLPFSLQFFLVALSF 63

Query: 71  VIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           ++FDLEIA L P   +  Q++ L      +FL +LT+G IYEW +G LEW
Sbjct: 64  LLFDLEIALLLPL-PWSNQLSSLSLLLAFLFLILLTLGLIYEWLQGGLEW 112