RPSBLAST alignment for GI: 254780852 and conserved domain: COG0838

>gnl|CDD|31180 COG0838, NuoA, NADH:ubiquinone oxidoreductase subunit 3 (chain A) [Energy production and conversion]. Length = 123
 Score =  121 bits (306), Expect = 3e-29
 Identities = 58/121 (47%), Positives = 88/121 (72%)

Query: 1   MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60
           M +LL  Y P+L+F+ +A  + ++++    ++  + P+PEKLS YECG  PF  AR++F 
Sbjct: 1   MMELLDEYLPVLIFLVVALLLGVLMLFLSKLLGPRRPNPEKLSPYECGNPPFGGARLRFS 60

Query: 61  IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120
           +++ LV++LFV+FD+E+ FLFPWAV FK++   GF  M+VF+ +L VGF+Y WKKGALEW
Sbjct: 61  VQYYLVAILFVVFDVEVVFLFPWAVSFKELGLFGFLEMLVFIFVLLVGFVYAWKKGALEW 120

Query: 121 D 121
            
Sbjct: 121 Q 121