BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus str. psy62] (121 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780852|ref|YP_003065265.1| NADH dehydrogenase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 239 bits (611), Expect = 8e-66, Method: Compositional matrix adjust. Identities = 121/121 (100%), Positives = 121/121 (100%) Query: 1 MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60 MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD Sbjct: 1 MSDLLTSYAPILVFMAIASAIVIVLMISPFIVAFKSPDPEKLSTYECGFDPFDDARVKFD 60 Query: 61 IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120 IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW Sbjct: 61 IRFCLVSVLFVIFDLEIAFLFPWAVYFKQITWLGFGSMMVFLGILTVGFIYEWKKGALEW 120 Query: 121 D 121 D Sbjct: 121 D 121 >gi|254780573|ref|YP_003064986.1| cysteinyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 23.1 bits (48), Expect = 1.4, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 31 IVAFKSPDPEKLSTYECGFDPFDDARV 57 I F++ DP + Y CG +D A + Sbjct: 15 ITEFQAIDPSNIRMYVCGPTVYDFAHI 41 >gi|254780905|ref|YP_003065318.1| glutamate racemase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 21.6 bits (44), Expect = 4.2, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 2 SDLLTSYAPILVFMAIASAIVIV 24 SD+L Y P+L +A +A ++ Sbjct: 69 SDILDKYQPVLSVIACNTAFTLI 91 >gi|254780539|ref|YP_003064952.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 21.6 bits (44), Expect = 4.8, Method: Compositional matrix adjust. Identities = 10/38 (26%), Positives = 21/38 (55%) Query: 53 DDARVKFDIRFCLVSVLFVIFDLEIAFLFPWAVYFKQI 90 + +++ D+ +V ++F F + + L P AVY + I Sbjct: 85 ETTKLREDVAIAVVYIIFYSFAMFMLSLSPSAVYVENI 122 >gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Score = 21.2 bits (43), Expect = 5.4, Method: Composition-based stats. Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 91 TWLGFGSMMVFLGILTVGFIYE 112 T LGFG FLG+L + I E Sbjct: 341 TALGFGFRCGFLGLLHLEIIQE 362 >gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 21.2 bits (43), Expect = 5.5, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 86 YFKQITWLGFGSMMVFLGILTVGF 109 Y+ + GFG ++V +GI VGF Sbjct: 58 YYCDFSIPGFGLLVVIVGINIVGF 81 >gi|254780404|ref|YP_003064817.1| inositol monophosphatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 286 Score = 20.8 bits (42), Expect = 8.4, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 5/26 (19%) Query: 95 FGSMMVF-----LGILTVGFIYEWKK 115 FG M + L ++ + F+YEWK+ Sbjct: 8 FGGMNLLYWYKKLCLMDIDFMYEWKQ 33 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.147 0.480 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,587 Number of Sequences: 1233 Number of extensions: 2727 Number of successful extensions: 17 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 9 length of query: 121 length of database: 328,796 effective HSP length: 64 effective length of query: 57 effective length of database: 249,884 effective search space: 14243388 effective search space used: 14243388 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 33 (17.3 bits)