>TIGR01958 nuoE_fam NADH-quinone oxidoreductase, E subunit; InterPro: IPR002023 Respiratory-chain NADH dehydrogenase (ubiquinone) (1.6.5.3 from EC) , (also known as complex I or NADH-ubiquinone oxidoreductase) is an oligomeric enzymatic complex located in the inner mitochondrial membrane which also seems to exist in the chloroplast and in cyanobacteria (as a NADH-plastoquinone oxidoreductase). Among the 25 to 30 polypeptide subunits of this bioenergetic enzyme complex there is one with a molecular weight of 24 kDa (in mammals), which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 2Fe-2S iron-sulphur cluster. The 24 kDa subunit is nuclear encoded, as a precursor form with a transit peptide in mammals and in Neurospora crassa. There is a highly conserved region located in the central section of this subunit that contains two conserved cysteines, that are probably involved in the binding of the 2Fe-2S centre. The 24 kDa subunit is highly similar to , : Subunit E of Escherichia coli NADH-ubiquinone oxidoreductase (gene nuoE) Subunit NQO2 of Paracoccus denitrificans NADH-ubiquinone oxidoreductase ; GO: 0016491 oxidoreductase activity, 0051287 NAD binding, 0006118 electron transport.

Probab=100.00 E-value=0 Score=401.35 Aligned_cols=148 Identities=47% Similarity=0.827 Sum_probs=145.3 Q ss_pred HHHHHHHHCCC--CCCHHHHHHHHHHHHHH-HCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCC Q ss_conf 99999986784--32133699999999998-2668999999999850887999999997644320222787069996188 Q gi|254780856|r 25 WVNEVISRYPP--SRCQSAVIPLLMRAQEQ-EGWVSRAAIEVVANILDMAYIRVLEIATFYTQFQLSPVGTRAHVQVCGT 101 (218) Q Consensus 25 ~i~~ii~~yP~--~~~~salip~L~~vQ~~-~G~Ip~eai~~iA~~L~i~~~~V~~VaTFY~~f~~~P~G~k~~I~VC~~ 101 (218) T Consensus 1 ~i~~~~~kYP~tP~~~RSA~~~~L~~aQ~~n~Gwv~~~~i~~vA~~L~~~~~~V~eVATFY~~f~~~PvG-r~~~~vC~~ 79 (153) T TIGR01958 1 EIEEAIAKYPDTPDQKRSAILPALRIAQKQNKGWVSPEAIEAVAEMLGIPPVWVYEVATFYSMFDTEPVG-RYHLQVCTN 79 (153) T ss_pred CHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHEEEEEEEHHHHCCCCCC-CEEEEEECC T ss_conf 9233654278997236899999999998740786488999999998688701302131001000167654-278775057 Q ss_pred HHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCEEEE-EECCCCCCCCCCEEEEC-CHHHCCCCHHHHHHHHHHHH Q ss_conf 35877089248999998827564751778818999-53245667788679985-83414588989999999998 Q gi|254780856|r 102 TPCMLRGCEKLIEVCRNKIHQKPLHRNSDGTLSWE-EVECQGACVNAPMVMIG-KDTYEDLTPERLEEIIDAFS 173 (218) Q Consensus 102 ~~C~l~G~~~l~~~l~~~Lgi~~gett~DG~ftLe-~v~CLG~C~~AP~~~Vn-~~~y~~lt~e~~~~il~~Lr 173 (218) T Consensus 80 ~~C~L~G~~~l~~~le~~Lgi~~gEtT~DG~F~l~c~vECLGAC~~APv~~iNd~d~y~~l~~e~l~~lL~~~~ 153 (153) T TIGR01958 80 VPCALRGSEALLKYLENKLGIKPGETTPDGRFTLKCEVECLGACGNAPVMMINDDDYYEFLTEERLDELLESLE 153 (153) T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEECCCCCCCEEEEECCCCCCCCCHHHHHHHHHHCC T ss_conf 43155337999999999828667734799717988500560205888889870784125689888999997419

HHsearch alignment for GI: 254780856 and conserved domain: TIGR01958