RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780860|ref|YP_003065273.1| NADH dehydrogenase subunit H [Candidatus Liberibacter asiaticus str. psy62] (348 letters) >gnl|CDD|180386 PRK06076, PRK06076, NADH:ubiquinone oxidoreductase subunit H; Provisional. Length = 322 Score = 423 bits (1090), Expect = e-119 Identities = 178/330 (53%), Positives = 230/330 (69%), Gaps = 15/330 (4%) Query: 11 PLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVF 70 L + +K++V LV +L+ +A+++ +RKV A +QLR GPN VGP+GLLQ AD +K +F Sbjct: 8 LLLLILLKAVVILVVVLLCVAFLIWFERKVLARMQLRYGPNRVGPFGLLQLVADGIKLLF 67 Query: 71 KEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYG 130 KE IIP+ ++K+LFLLAP+++ I + AWAV+P +IAD+NVGILYILAISSL +YG Sbjct: 68 KEDIIPAGADKVLFLLAPVIAFIPAFLAWAVIPFGPELVIADLNVGILYILAISSLGVYG 127 Query: 131 IIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGT 190 +I+ GWASN+KYA LGALR+AAQMISYEV +GL ++ VVL AGSLNL+DIV +Q Sbjct: 128 VILAGWASNNKYALLGALRAAAQMISYEVPLGLSLLAVVLLAGSLNLSDIVEAQ------ 181 Query: 191 FLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLL 250 L W + P FVVFFI+ +AETNR PFDL EAESELVAGY EYS + L Sbjct: 182 -------FLSWNIIPQPPAFVVFFIAAVAETNRHPFDLPEAESELVAGYHTEYSGMKFGL 234 Query: 251 FMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFV 310 F L EY ++L+ L + LFLGGWLPPF + IPG W V K F+ ++A + Sbjct: 235 FFLGEYINMILVSALITTLFLGGWLPPFPLGGG--IPGAIWFVLKVAFFVFLFIWLRATL 292 Query: 311 PRYRYDQLMRLGWKVFLPLSFAMVLIVSFF 340 PRYRYDQLMRLGWKV LPLS +L+ + Sbjct: 293 PRYRYDQLMRLGWKVLLPLSLVNLLLTAAV 322 >gnl|CDD|169692 PRK09174, PRK09174, F0F1 ATP synthase subunit B'; Validated. Length = 204 Score = 36.3 bits (84), Expect = 0.012 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 273 GWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPR 312 G PPFD + + S WL T GLF++ M + +PR Sbjct: 42 GVFPPFDSTHYAS--QLLWLAI-TFGLFYL-FMSRVILPR 77 >gnl|CDD|177537 PHA03134, PHA03134, thymidine kinase; Provisional. Length = 340 Score = 30.9 bits (70), Expect = 0.46 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Query: 186 SGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSS 245 SG G L FP M YW LF VV I A+ + L+ ++ + + + Sbjct: 38 SGGGPTLYFPEPMA--YWRTLFETDVVSGI-YDAQNRKQQGSLAAEDAAGITAHYQARFA 94 Query: 246 TPYLL 250 TPYL+ Sbjct: 95 TPYLI 99 >gnl|CDD|178310 PLN02708, PLN02708, Probable pectinesterase/pectinesterase inhibitor. Length = 553 Score = 30.6 bits (69), Expect = 0.57 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Query: 239 YMVEYSSTP-----YLLFMLAEYS-TIVLMCTLASILFLGGWLP 276 YM Y S P +L EYS T+ + C L +++ GW+P Sbjct: 452 YMKLYRSNPKVHKNFLGRPWKEYSRTVFIGCNLEALITPQGWMP 495 >gnl|CDD|163055 TIGR02876, spore_yqfD, sporulation protein YqfD. YqfD is part of the sigma-E regulon in the sporulation program of endospore-forming Gram-positive bacteria. Mutation results in a sporulation defect in Bacillus subtilis. Members are found in all currently known endospore-forming bacteria, including the genera Bacillus, Symbiobacterium, Carboxydothermus, Clostridium, and Thermoanaerobacter. Length = 382 Score = 30.4 bits (69), Expect = 0.65 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 12 LFFMAIKSIVFLVGLLIFIAYVLLMDRKVW 41 LF K L+G+L+F+A V + +W Sbjct: 77 LFKRLRKRPGILIGILLFLAIVYFLSNFIW 106 >gnl|CDD|148491 pfam06898, YqfD, Putative stage IV sporulation protein YqfD. This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins. YqfD of Bacillus subtilis is known to be essential for efficient sporulation although its exact function is unknown. Length = 383 Score = 30.0 bits (68), Expect = 0.88 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 3 SFIEDFFVP-LFFMAIKSIVFLVGLLIFIAYVLLMDRKVW 41 FIE +P LFF K ++G+L+F+ + + +W Sbjct: 70 KFIERKGLPFLFFRLRKRRGIVLGILLFVILLYFLSNFIW 109 >gnl|CDD|163111 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Certain closely related transferase enzymes such as Sinorhizobium ExoY and Lactococcus EpsD lack the N-terminal domain and are not found by this model. Length = 445 Score = 29.1 bits (66), Expect = 1.7 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 6/96 (6%) Query: 253 LAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPR 312 LA+ +VL LA +L+ G LPP + + LF + +++ R Sbjct: 1 LADLLALVLALLLAYLLYGGLLLPPPSFYSLLILLLLLLFLI----LFAASGLYRSWRGR 56 Query: 313 YRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR 348 ++L R+ L F ++L ++F LK + R Sbjct: 57 SFLEELARVLLAWLL--VFLLLLALAFLLKGFDFSR 90 >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase. Length = 463 Score = 27.4 bits (61), Expect = 5.3 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 7/43 (16%) Query: 159 VSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDW 201 V +G++++ V LC+ L ++ YS+K G PP + W Sbjct: 4 VVLGVLVIIVCLCSALLRWNEVRYSKK-------GLPPGTMGW 39 >gnl|CDD|163172 TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696, ) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases. Length = 406 Score = 27.1 bits (61), Expect = 6.5 Identities = 31/143 (21%), Positives = 63/143 (44%), Gaps = 19/143 (13%) Query: 81 KILFLLAPLVS-VILSLSAWAVVPVADGWII---ADINVGILYILAISSLEIYGIIIGGW 136 K++ P+V+ +++L +++PVA W + G L ++ L + I++ Sbjct: 105 KLVRFFPPVVTGTVITLIGLSLMPVAINWAAGGAGAPDFGSPQNLGLALLTLVIILLL-- 162 Query: 137 ASNSKYAFLGALRSAAQMISYEVSIGLVIVTVV-LCAGSLNLTDIVYSQKSGLGTFLGFP 195 G LRS A V +GLV+ T+V G ++ + + + L T F Sbjct: 163 ----NRFGKGFLRSIA------VLLGLVVGTIVAAALGMVDFSGVAEAPWFALPTPFHF- 211 Query: 196 PSMLDWYWLALFPMFVVFFISLL 218 + +A+ M +V+ +S++ Sbjct: 212 -GAPTFDLVAILTMIIVYLVSMV 233 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.332 0.146 0.455 Gapped Lambda K H 0.267 0.0753 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,908,575 Number of extensions: 399407 Number of successful extensions: 1443 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1429 Number of HSP's successfully gapped: 95 Length of query: 348 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 254 Effective length of database: 3,963,321 Effective search space: 1006683534 Effective search space used: 1006683534 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 58 (26.1 bits)