BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780864|ref|YP_003065277.1| NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780864|ref|YP_003065277.1| NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 134 bits (336), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISV 60 MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISV Sbjct: 1 MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISV 60 Query: 61 DDFNQMKG 68 DDFNQMKG Sbjct: 61 DDFNQMKG 68 >gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 247 Score = 27.7 bits (60), Expect = 0.041, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 35 LVAAAETSIGLAILVIFYRKCGSISVDDFNQMK 67 LV A SIGLAI I Y++ S+ + +Q K Sbjct: 10 LVTGASGSIGLAIAKILYKQGASVGLHGTSQEK 42 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 20.0 bits (40), Expect = 7.3, Method: Composition-based stats. Identities = 7/22 (31%), Positives = 15/22 (68%) Query: 10 VNLNMISFSAYMQDISGQIFSL 31 ++ N++S + D+SG+ F+L Sbjct: 602 ISKNLLSLEENIYDLSGEKFNL 623 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.330 0.141 0.381 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,367 Number of Sequences: 1233 Number of extensions: 924 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 68 length of database: 328,796 effective HSP length: 39 effective length of query: 29 effective length of database: 280,709 effective search space: 8140561 effective search space used: 8140561 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 31 (16.5 bits)