BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M
[Candidatus Liberibacter asiaticus str. psy62]
         (499 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040543|gb|ACT57339.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 499

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/499 (100%), Positives = 499/499 (100%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS
Sbjct: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV
Sbjct: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF
Sbjct: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP
Sbjct: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK
Sbjct: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF
Sbjct: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS
Sbjct: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL
Sbjct: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480

Query: 481 SSIIENYTLKTGYSDSVKG 499
           SSIIENYTLKTGYSDSVKG
Sbjct: 481 SSIIENYTLKTGYSDSVKG 499


>gi|315122713|ref|YP_004063202.1| NADH dehydrogenase subunit M [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496115|gb|ADR52714.1| NADH dehydrogenase subunit M [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 491

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/486 (79%), Positives = 448/486 (92%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+LPFLSI+TF PF+GV ++  +SYLGC RRSF G+ALG S INF+FSLFVW++F++  S
Sbjct: 1   MDLPFLSIITFTPFIGVLLLFLASYLGCERRSFLGIALGTSIINFVFSLFVWAIFNQNNS 60

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQMIEYYHWIDYFC YHLGVDGISILLVVLT FLTPFCILSSW+S+QE F+EYMIAFL+
Sbjct: 61  GFQMIEYYHWIDYFCDYHLGVDGISILLVVLTAFLTPFCILSSWESVQERFKEYMIAFLI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LESM IGAFLSLD++LFYIFFEASLIPMF+IIGVWGG+ER+YAAYKFFLYTFFGS+FML 
Sbjct: 121 LESMTIGAFLSLDIVLFYIFFEASLIPMFIIIGVWGGNERVYAAYKFFLYTFFGSVFMLL 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VMCW+KKT+SIIDLYA S FP SIQ W+W+AFF SFAIKIPMFPFHTWLP+AHVQAP
Sbjct: 181 AIMVMCWDKKTTSIIDLYASSSFPMSIQCWLWLAFFISFAIKIPMFPFHTWLPSAHVQAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSVFLAGIMLKMGGYGC+RFLLPLFPLAS+YF+P+I  LS+I+IIYASLV+MVQ DIK
Sbjct: 241 TAGSVFLAGIMLKMGGYGCLRFLLPLFPLASKYFSPLILILSVISIIYASLVAMVQRDIK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVTIGIFSG++SGVEGAMFQMLSHGLVSSALFF +G++YDRLHTRD++
Sbjct: 301 KLIAYSSIAHMGYVTIGIFSGIRSGVEGAMFQMLSHGLVSSALFFSIGILYDRLHTRDLY 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV NMPRYAVVMMVFTMAN+GLPGTSGFIGEFL+I+S F N N +AV ASFGVVLS
Sbjct: 361 AYGGLVRNMPRYAVVMMVFTMANIGLPGTSGFIGEFLIIVSAFFNHNMIAVFASFGVVLS 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           ALYSLW YRK+VFGVS+ E+V+++KDLSLRERC+VYPIAVL VFFGIY +P+ DTF++ +
Sbjct: 421 ALYSLWFYRKIVFGVSEREEVKKIKDLSLRERCIVYPIAVLIVFFGIYTIPVFDTFALTI 480

Query: 481 SSIIEN 486
           SSI++ 
Sbjct: 481 SSIVKT 486


>gi|222085589|ref|YP_002544119.1| NADH-ubiquinone oxidoreductase chain M protein [Agrobacterium
           radiobacter K84]
 gi|221723037|gb|ACM26193.1| NADH-ubiquinone oxidoreductase chain M protein [Agrobacterium
           radiobacter K84]
          Length = 512

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/497 (60%), Positives = 388/497 (78%), Gaps = 2/497 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLG-CGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GV ++LF    G  GRR+   V+L  +   FI SLF+W  FD    
Sbjct: 12  DWPILSTVTFLPLVGVLILLFMRDDGPNGRRNILNVSLLTTVFTFIVSLFIWIGFDNANP 71

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQMIE + W+    SYHLGVDGIS+L V+L+TFL PFC+L+SW S+++  ++YMIAFLV
Sbjct: 72  GFQMIEKHGWLGTGISYHLGVDGISMLFVILSTFLMPFCVLASWLSVEKRLKDYMIAFLV 131

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+M+IG F+SLD++LFY+FFEA LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+ ML 
Sbjct: 132 LETMMIGVFVSLDIVLFYVFFEAGLIPMFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLL 191

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ I  L A  KFP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 192 AIMAMYWQAGTTDIPALLAY-KFPPHMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 250

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF L +FP AS+YFAP++F +S+IAIIY SLV+++Q DIK
Sbjct: 251 TAGSVILAGILLKLGGYGLIRFSLGMFPNASEYFAPLVFAMSVIAIIYTSLVALMQEDIK 310

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIF+  + GV+GA+FQMLSHG+VS ALF CVGVIYDR HTR+I 
Sbjct: 311 KLIAYSSVAHMGYVTMGIFAANQQGVQGAIFQMLSHGIVSGALFLCVGVIYDRTHTREIA 370

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV MMVFTMAN+GLPGTSGFIGEFL ++ VF+ +  VA+ A+ GV+LS
Sbjct: 371 AYGGLVNNMPKYAVAMMVFTMANVGLPGTSGFIGEFLTLIGVFRVNTWVALFAATGVILS 430

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + E +++L DLS RE+ ++YP+  LT+ FG+YP PI D  +  +
Sbjct: 431 AAYALWLYRRVIFGALEKENLKKLLDLSPREQLILYPLIALTILFGVYPAPIFDATAASV 490

Query: 481 SSIIENYTLKTGYSDSV 497
             ++ NYT     + +V
Sbjct: 491 DLLVNNYTAALHAAQNV 507


>gi|327188500|gb|EGE55714.1| NADH-ubiquinone oxidoreductase protein, chain M [Rhizobium etli
           CNPAF512]
          Length = 503

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 292/497 (58%), Positives = 385/497 (77%), Gaps = 2/497 (0%)

Query: 2   NLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP  GV  ++L +     GR++  G++L  +   FI SL +W  FD    
Sbjct: 3   DWPILSTVTFLPLAGVVLLLLMNGESESGRKNVLGISLITTVFTFIVSLVIWIGFDNANP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM + + W+     YH+GVDGIS+L V+LTTFL PFC+L+SW SI++  +EYM+AFL+
Sbjct: 63  GFQMEQKFDWLGTGIGYHVGVDGISMLFVILTTFLMPFCVLASWLSIEKRLKEYMVAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+M+IG F+SLD++LFY+FFEA LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+ ML 
Sbjct: 123 LETMMIGVFVSLDIVLFYVFFEAGLIPMFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ I  L A  KFP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 183 AIMAMYWQAGTTDITALLAY-KFPPALQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF L +FP+AS YFAP++F LS+IAIIY SLV+M+Q DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGLIRFSLGMFPVASDYFAPLVFALSVIAIIYTSLVAMMQDDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIF+    GV+G++FQMLSHG+VS ALF CVGV+YDR HTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFAANMQGVQGSIFQMLSHGIVSGALFLCVGVVYDRTHTREIN 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV MMVFTMAN+GLPGTSGFIGEFL ++ VF+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAMMVFTMANVGLPGTSGFIGEFLTLIGVFRVNTWVALFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + EK++ L DLS RE+ ++YP+  LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKEKLKALLDLSPREQLILYPLVALTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENYTLKTGYSDSV 497
             ++ NYT     + +V
Sbjct: 482 DLLVNNYTAAVHAAQNV 498


>gi|190891299|ref|YP_001977841.1| NADH-ubiquinone oxidoreductase, chain M [Rhizobium etli CIAT 652]
 gi|190696578|gb|ACE90663.1| NADH-ubiquinone oxidoreductase protein, chain M [Rhizobium etli
           CIAT 652]
          Length = 503

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 381/488 (78%), Gaps = 2/488 (0%)

Query: 2   NLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP  GV  ++L +     GR++   ++L  +   FI SL +W  FD    
Sbjct: 3   DWPILSTVTFLPLAGVVLLLLMNGESESGRKNVLWISLITTVFTFIVSLVIWIGFDNANP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM + ++W+     YH+GVDGIS+L V+L+TFL PFC+L+SW SI++  +EYMIAFL+
Sbjct: 63  GFQMEQKFNWLGTGIGYHVGVDGISMLFVILSTFLMPFCVLASWLSIEKRLKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+M+IG F+SLD++LFY+FFEA LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+ ML 
Sbjct: 123 LETMMIGVFVSLDIVLFYVFFEAGLIPMFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ I  L A  KFP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 183 AIMAMYWQAGTTDITALLAY-KFPPALQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF L +FP+AS YFAP +F LS+IAIIY SLV+M+Q DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGLIRFSLGMFPVASDYFAPFVFALSVIAIIYTSLVAMMQDDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIF+    GV+G++FQMLSHG+VS ALF CVGV+YDR HTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFAANMQGVQGSIFQMLSHGIVSGALFLCVGVVYDRTHTREIN 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV MMVFTMAN+GLPGTSGFIGEFL ++ VF+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAMMVFTMANVGLPGTSGFIGEFLTLIGVFRVNTWVALFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + EK++ L DLS RE+ ++YP+  LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKEKLKALLDLSRREQLILYPLVALTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENYT 488
             ++ NYT
Sbjct: 482 DLLVNNYT 489


>gi|222148287|ref|YP_002549244.1| NADH dehydrogenase subunit M [Agrobacterium vitis S4]
 gi|221735275|gb|ACM36238.1| NADH dehydrogenase I chain M [Agrobacterium vitis S4]
          Length = 512

 Score =  612 bits (1577), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 291/497 (58%), Positives = 378/497 (76%), Gaps = 2/497 (0%)

Query: 2   NLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GV  ++L +     GRR+   ++L  +   FI SLF+W  FD    
Sbjct: 12  DWPILSTVTFLPLVGVALLLLMNGDTPSGRRNVLNISLLTTVATFIVSLFIWIGFDNANP 71

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E + W+    +YHLGVDGIS+L VVLT FL PFC+L+SW S+Q+  +EYMIAFL+
Sbjct: 72  GFQMVENHPWLGTGIAYHLGVDGISMLFVVLTAFLMPFCVLASWTSVQKRIKEYMIAFLI 131

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE M+IG F+SLD++LFY+FFEA LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+ M+ 
Sbjct: 132 LEVMMIGVFVSLDIVLFYVFFEAGLIPMFIIIGVWGGKDRVYASYKFFLYTLLGSVLMML 191

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ I  L A  KFP  +Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 192 AIMAMYWDAGTTDIAALLA-HKFPPHLQTVLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 250

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGIMLK+GGYG IRF L +FPLAS YFAP +F LS+IAIIY SLV+++Q D+K
Sbjct: 251 TAGSVILAGIMLKLGGYGFIRFSLAMFPLASDYFAPAVFALSVIAIIYTSLVALMQEDMK 310

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVT+GIF+    G++GA+FQM+SHG VS ALF CVGVIYDR+HTR+I 
Sbjct: 311 KLIAYSSIAHMGYVTMGIFAANTQGLQGAVFQMISHGFVSGALFLCVGVIYDRMHTREIV 370

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGL +NMP+YA+  M+FTMAN+GLPGTSGFIGEFL ++  F+ ++ VA+ A+ GV+LS
Sbjct: 371 AYGGLANNMPKYALAFMIFTMANVGLPGTSGFIGEFLTLIGAFRANSWVALFAATGVILS 430

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+VVFG    E ++ L DLS RE+  +YP+  LT+ FG+YP PI D  +  +
Sbjct: 431 AAYALWLYRRVVFGALDKESLKALLDLSFREKVTLYPLIALTILFGVYPAPIFDVTTASV 490

Query: 481 SSIIENYTLKTGYSDSV 497
            +++ NYT     + +V
Sbjct: 491 DALLNNYTAALQAAQNV 507


>gi|90417831|ref|ZP_01225743.1| NADH dehydrogenase I, M subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337503|gb|EAS51154.1| NADH dehydrogenase I, M subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 502

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 382/496 (77%), Gaps = 2/496 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS VTFLP +G  +ILF        RR+   VAL  +   F+ SL++W  FD   + F
Sbjct: 5   PILSTVTFLPLVGALLILFIRDDSELARRNIRNVALLTTLFTFVVSLWIWIDFDNSNAGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   W+    +YH+GVDGIS+L V+LTTFL PFCIL+S++S+Q   +EYMIAFLVLE
Sbjct: 65  QMVERLDWLGGGITYHMGVDGISMLFVILTTFLMPFCILASFESVQTRVKEYMIAFLVLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++V+G F +LD++LFYIFFE  LIPMF+IIGVWGG  RIYA+YKFFLYTF GS+ ML AI
Sbjct: 125 TLVVGVFCALDIVLFYIFFEGGLIPMFLIIGVWGGKRRIYASYKFFLYTFLGSVLMLVAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M W   TSSI +L A   FP S+Q W+W AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MTMFWTAGTSSIPELLAY-DFPASMQTWLWFAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI+LK+GGYG +RF LP+FPLAS  FAP++F LS++AIIY SLV+++Q DIKKL
Sbjct: 244 GSVILAGILLKLGGYGFLRFSLPMFPLASAEFAPLVFTLSVVAIIYTSLVALMQQDIKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+  + GVEGA+FQMLSHGLVS ALF CVGV+YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAANQQGVEGAIFQMLSHGLVSGALFLCVGVVYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP YA  M++FTMAN+GLPGTSGF+GEFL ++ VFQ ++ VA+ A+ GV+LSA 
Sbjct: 364 GGLVNRMPHYAAAMLIFTMANVGLPGTSGFVGEFLTLIGVFQVNSWVAIFAATGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYR+VVFG  + E ++ + DLS RE+ ++YP+ VL +FFG+YP+P+ D  +  + S
Sbjct: 424 YALWLYRRVVFGALEKESLRSILDLSGREKILLYPLIVLVIFFGVYPMPVFDVTAASVES 483

Query: 483 IIENYTLKTGYSDSVK 498
           ++  YT     + SV 
Sbjct: 484 MVNRYTAAIEAASSVA 499


>gi|110633388|ref|YP_673596.1| NADH dehydrogenase subunit M [Mesorhizobium sp. BNC1]
 gi|110284372|gb|ABG62431.1| NADH dehydrogenase subunit M [Chelativorans sp. BNC1]
          Length = 501

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 377/486 (77%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCG-RRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G F+IL     G G RR+   VAL  +   FI SLF+W  FD    
Sbjct: 3   DWPILSTVTFLPLVGAFLILLIRDDGQGARRNIRNVALLTTVFTFILSLFIWIGFDYTTP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+D   SYH+GVDGIS+L V+LTTFL PFCIL+SW++I    +EYMIAFL+
Sbjct: 63  GFQMVEKREWLDSGISYHMGVDGISMLFVILTTFLMPFCILASWEAIDSRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDIVLFYVFFEAGLIPMFIIIGVWGGKRRVYASFKFFLYTLAGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M W+  T+ I  L   + FP  +QYW+WIAFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AMMAMFWQSGTTDIPTLLTHA-FPVQMQYWLWIAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LKMGGYG +RF LP+FP AS  FAP +F LS++AIIY SLV+M+Q DIK
Sbjct: 242 TAGSVILAGILLKMGGYGFLRFSLPMFPEASAEFAPFVFTLSVVAIIYTSLVAMMQDDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHGLVS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMGFVTMGIFAMNEQGVQGAIFQMLSHGLVSGALFLCVGVIYDRMHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV  MVFTMAN+GLPGTSGF+GEFL + + FQ +  VA  A+ GVVLS
Sbjct: 362 AYGGLVNNMPKYAVAFMVFTMANVGLPGTSGFVGEFLTLFAAFQVNTWVAFFATTGVVLS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG    E ++ L DLSLRE+ ++YP+  L +FFG+YP  + DT +  +
Sbjct: 422 AAYALWLYRRVIFGALTKESLKGLTDLSLREKTILYPLVALVIFFGVYPSALIDTTTASV 481

Query: 481 SSIIEN 486
           S+++++
Sbjct: 482 SALLDH 487


>gi|319782994|ref|YP_004142470.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168882|gb|ADV12420.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 501

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/494 (58%), Positives = 384/494 (77%), Gaps = 2/494 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+VTFLP +GV +ILF +      RR+   +AL  +T  FI SLF+W+ FD  +S F
Sbjct: 5   PILSLVTFLPLVGVLLILFINDDSENARRNIRAIALLTTTFTFIISLFIWTGFDNSQSGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+D   SYH+GVDGIS+L V+LTTFL P CIL+SW+SI++  + YMIAFL+LE
Sbjct: 65  QFVEKVAWLDSGISYHMGVDGISMLFVILTTFLMPLCILASWESIEKRVKAYMIAFLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMIGVFCALDIVLFYVFFEAGLIPMFIIIGVWGGKRRVYASFKFFLYTLAGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M ++  T+ I  L     FP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MAMFFQSGTTDIPTLLT-HNFPANMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI+LKMGGYG +RF LP+FPLAS+ FAP++F LS++AIIY SLV+++Q D+KKL
Sbjct: 244 GSVILAGILLKMGGYGLLRFSLPMFPLASEMFAPLVFALSVVAIIYTSLVALMQEDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHGLVS ALF CVGVIYDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAMNQEGVQGAIFQMLSHGLVSGALFLCVGVIYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+NMP+YA V ++FTMAN+GLPGTSGF+GEFL ++ VF+ +  VA  A+ GV+LSA 
Sbjct: 364 GGLVNNMPKYATVFLIFTMANVGLPGTSGFVGEFLTMLGVFRVNTWVAFFAATGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYR+V+FG    E ++ L DLS RE+ ++YP+ VL +FFG+YP P+ D  +  + S
Sbjct: 424 YALWLYRRVIFGALTKESLKGLLDLSPREKVIIYPLVVLVIFFGVYPAPVFDATAQSVKS 483

Query: 483 IIENYTLKTGYSDS 496
           ++ N     G + +
Sbjct: 484 LVTNVAASIGAAQT 497


>gi|260462244|ref|ZP_05810488.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Mesorhizobium opportunistum WSM2075]
 gi|259032104|gb|EEW33371.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Mesorhizobium opportunistum WSM2075]
          Length = 501

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/497 (57%), Positives = 385/497 (77%), Gaps = 2/497 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+VTFLP +GV +ILF +      RR+   +AL  +T  FI SLF+W+ FD  ++ F
Sbjct: 5   PILSLVTFLPLVGVLLILFINDDSENARRNIRAIALLTTTFTFIISLFIWTGFDNSQAGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+D   SYH+GVDGIS+L V+LTTFL P CIL+SW+SI++  + YM+AFL+LE
Sbjct: 65  QFVEKAAWLDSGISYHMGVDGISMLFVILTTFLMPLCILASWESIEKRVKAYMVAFLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMIGVFCALDIVLFYVFFEAGLIPMFIIIGVWGGKRRVYASFKFFLYTLAGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M ++  T+ I  L   S FP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MAMFYQSGTTDIPTLLTHS-FPANMQIWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG +RF LP+FPLAS+ FAP++F LS++AIIY SLV+++Q D+KKL
Sbjct: 244 GSVILAAILLKMGGYGFLRFSLPMFPLASEMFAPLVFTLSVVAIIYTSLVALMQEDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHGLVS ALF CVGVIYDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAMNQEGVQGAIFQMLSHGLVSGALFLCVGVIYDRMHTREIDAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+NMP+YA V MVFTMAN+GLPGTSGF+GEFL ++ VF+ +  VA  A+ GV+LSA 
Sbjct: 364 GGLVNNMPKYATVFMVFTMANVGLPGTSGFVGEFLTMLGVFRVNTWVAFFAATGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYR+V+FG    + ++ L DLS RE+ ++YP+ VL +FFG+YP P+ D  +  + S
Sbjct: 424 YALWLYRRVIFGALTKDSLKGLLDLSPREKAIIYPLVVLVIFFGVYPAPVFDATAQSVKS 483

Query: 483 IIENYTLKTGYSDSVKG 499
           ++ N T   G + +   
Sbjct: 484 LVTNVTASIGAAQTAAA 500


>gi|13471394|ref|NP_102960.1| NADH dehydrogenase subunit M [Mesorhizobium loti MAFF303099]
 gi|14022136|dbj|BAB48746.1| NADH-ubiquinone dehydrogenase chain 13 [Mesorhizobium loti
           MAFF303099]
          Length = 501

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/494 (58%), Positives = 384/494 (77%), Gaps = 2/494 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+VTFLP +GV +ILF        RR+   +AL  +T  FI S+F+W+ FD  +S F
Sbjct: 5   PILSLVTFLPLVGVLLILFIRDDSENARRNIRAIALLTTTFTFIISVFIWTGFDNSQSGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+D   SYH+GVDGIS+L V+LTTFL P CIL+SW++I++  + YMIAFL+LE
Sbjct: 65  QFVEKAAWLDSGISYHMGVDGISMLFVILTTFLMPLCILASWEAIEKRVKAYMIAFLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMIGVFCALDIVLFYVFFEAGLIPMFIIIGVWGGKRRVYASFKFFLYTLAGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M ++  T+ I  L   S FP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MAMFYQSGTTDIPTLLTHS-FPANMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG +RF LP+FPLAS+ FAP++F LS++AIIY SLV+++Q D+KKL
Sbjct: 244 GSVILAAILLKMGGYGFLRFSLPMFPLASEMFAPLVFTLSVVAIIYTSLVALMQDDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHGLVS ALF CVGVIYDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAMNQEGVQGAIFQMLSHGLVSGALFLCVGVIYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+NMP+YA V MVFTMAN+GLPGTSGF+GEFL ++ VF+ +  VA  A+ GV+LSA 
Sbjct: 364 GGLVNNMPKYATVFMVFTMANVGLPGTSGFVGEFLTMLGVFRVNTWVAFFAATGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYR+V+FG    + ++ L DLSLRE+ ++YP+  L +FFG+YP P+ D  +  + S
Sbjct: 424 YALWLYRRVIFGALTKDSLKGLLDLSLREKVIIYPLVALVIFFGVYPAPVFDATAQSVKS 483

Query: 483 IIENYTLKTGYSDS 496
           ++ N T   G + +
Sbjct: 484 LVTNVTASIGAAQT 497


>gi|15965031|ref|NP_385384.1| NADH dehydrogenase subunit M [Sinorhizobium meliloti 1021]
 gi|307301103|ref|ZP_07580872.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sinorhizobium meliloti BL225C]
 gi|307317837|ref|ZP_07597275.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sinorhizobium meliloti AK83]
 gi|15074210|emb|CAC45857.1| Probable NADH dehydrogenase I chain M transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306896599|gb|EFN27347.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sinorhizobium meliloti AK83]
 gi|306904058|gb|EFN34644.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sinorhizobium meliloti BL225C]
          Length = 503

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 378/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGC-GRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTF+P +GV ++L +      GRR+   V+L  +   F+ SL++W  FD    
Sbjct: 3   DWPVLSAVTFMPLVGVLLLLLTREDSAYGRRNILNVSLLTTVFTFLVSLYIWYQFDPSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYHLGVDGISIL V LT FL PFC+L+SW +I++  +EYMIAFL+
Sbjct: 63  GFQMVEKREWLGTGISYHLGVDGISILFVPLTAFLMPFCVLASWVTIEKRLKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++++G F+SLD++LFY+FFEA LIPMF+IIGVWGG ER+YA+YKFFLYT  GS+ ML 
Sbjct: 123 LETLMLGVFVSLDIILFYVFFEAGLIPMFIIIGVWGGKERVYASYKFFLYTLLGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M W+  T+ I  L A  +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 183 AMMAMYWQAGTTDITQLLAY-QFPREMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG +RF LP+FPLAS +FAP +F LS+IAIIY SLV+M+QTDIK
Sbjct: 242 TAGSVILAGILLKLGGYGFLRFSLPMFPLASDFFAPFVFTLSIIAIIYTSLVAMMQTDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+G F+    GV+GA+FQMLSHG+VS ALF CVGV+YDRLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGTFAANVQGVQGAIFQMLSHGIVSGALFLCVGVVYDRLHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV  MVFTMAN+GLPGTSGF+GE L ++  F+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAFMVFTMANVGLPGTSGFVGEVLTLVGAFRANTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + E ++ L DLS RE+ ++YP+ +LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKESLKALLDLSAREKLILYPLVILTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENY 487
             ++ NY
Sbjct: 482 DLLVNNY 488


>gi|209548876|ref|YP_002280793.1| NADH dehydrogenase subunit M [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534632|gb|ACI54567.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 503

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 281/461 (60%), Positives = 367/461 (79%), Gaps = 1/461 (0%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
            GR++   ++L  +   FI SLF+W  FD     FQM+E + W+     YHLGVDGIS+L
Sbjct: 30  TGRKNVLWISLITTVFTFIVSLFIWIGFDNANPGFQMLEKHDWLGTGIGYHLGVDGISML 89

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+L+TFL PFC+L+SW SI++  +EYMIAFL+LE+M++G F+SLD++LFY+FFEA LIP
Sbjct: 90  FVILSTFLMPFCVLASWLSIEKRLKEYMIAFLILETMMVGVFVSLDIVLFYVFFEAGLIP 149

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI 207
           MF+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I  L A  KFP ++
Sbjct: 150 MFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITALLAY-KFPPAL 208

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAG++LK+GGYG IRF L +F
Sbjct: 209 QTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGVLLKLGGYGLIRFSLGMF 268

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P+AS YFAP +F LS+IAIIY SLV+M+Q DIKKLIAYSS+AHMGYVT+GIF+    GV+
Sbjct: 269 PVASDYFAPFVFALSVIAIIYTSLVAMMQDDIKKLIAYSSVAHMGYVTMGIFAANMQGVQ 328

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G++FQMLSHG+VS ALF CVGV+YDR HTR+I AYGGLV+NMP+YAV MMVFTMAN+GLP
Sbjct: 329 GSIFQMLSHGIVSGALFLCVGVVYDRTHTREINAYGGLVNNMPKYAVAMMVFTMANVGLP 388

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GTSGFIGEFL ++ VF+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + EK++ L DL
Sbjct: 389 GTSGFIGEFLTLLGVFRVNTWVALFAATGVILSAAYALWLYRRVIFGALEKEKLKALLDL 448

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYT 488
           S RE+ ++YP+  LT+FFG+YP P+ D  +  +  ++ NYT
Sbjct: 449 SRREQLILYPLVALTIFFGVYPAPVFDATAASVDLLVNNYT 489


>gi|150396125|ref|YP_001326592.1| NADH dehydrogenase subunit M [Sinorhizobium medicae WSM419]
 gi|150027640|gb|ABR59757.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sinorhizobium medicae WSM419]
          Length = 503

 Score =  604 bits (1558), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/488 (59%), Positives = 378/488 (77%), Gaps = 2/488 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGC-GRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTF+P +GV ++L +      GRR+   V+L  +   F+ SL+VW  FD    
Sbjct: 3   DWPVLSAVTFMPLVGVLLLLLTREDSAYGRRNILNVSLLTTIFTFLVSLYVWYQFDPSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQMIE   W+    SYHLGVDGISIL V LT FL PFC+L+SW +I++  +EYMIAFL+
Sbjct: 63  GFQMIEKREWLGAGISYHLGVDGISILFVPLTAFLMPFCVLASWVTIEKRLKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++++G F+SLD++LFY+FFEA LIPMF+IIGVWGG ER+YA+YKFFLYT  GS+ ML 
Sbjct: 123 LETLMLGVFVSLDIILFYVFFEAGLIPMFIIIGVWGGKERVYASYKFFLYTLLGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M W+  T+ I  L A  +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 183 AMMAMYWQAGTTDITQLLAY-QFPRQMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG +RF LP+FPLAS +FAP +F LS+IAIIY SLV+M+QTDIK
Sbjct: 242 TAGSVILAGILLKLGGYGFLRFSLPMFPLASDFFAPFVFTLSVIAIIYTSLVAMMQTDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+G F+    GV+GA+FQMLSHG+VS ALF CVGV+YDRLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGTFAANVQGVQGAIFQMLSHGIVSGALFLCVGVVYDRLHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV  MVFTMAN+GLPGTSGF+GE L ++  F+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAFMVFTMANVGLPGTSGFVGEVLTLVGAFRANTWVALFATSGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + E ++ L DLS RE+ ++YP+ +LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKESLKALLDLSPREKLILYPLVILTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENYT 488
             ++ NY 
Sbjct: 482 DLLVNNYA 489


>gi|86357251|ref|YP_469143.1| NADH dehydrogenase subunit M [Rhizobium etli CFN 42]
 gi|86281353|gb|ABC90416.1| NADH-ubiquinone oxidoreductase chain M protein [Rhizobium etli CFN
           42]
          Length = 503

 Score =  604 bits (1558), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/470 (59%), Positives = 371/470 (78%), Gaps = 1/470 (0%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
            GRR+   ++L  +   F+ SLF+W  FD     FQM+E + W+     YH+GVDGIS+L
Sbjct: 30  SGRRNVLWISLITTVFTFVVSLFIWIGFDNANPGFQMLEKHDWLGTGIGYHVGVDGISML 89

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+L+TFL PFC+L+SW SI++  +EYMIAFL+LE+M++G F+SLD++LFY+FFEA LIP
Sbjct: 90  FVILSTFLMPFCVLASWLSIEKRLKEYMIAFLILETMMVGVFVSLDIVLFYVFFEAGLIP 149

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI 207
           MF+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I  L A  KFP ++
Sbjct: 150 MFLIIGVWGGRDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITALLAY-KFPPAL 208

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAG++LK+GGYG IRF L +F
Sbjct: 209 QTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGVLLKLGGYGLIRFSLGMF 268

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P+AS YFAP++F +S+IAIIY SLV+M+Q DIKKLIAYSS+AHMGYVT+GIF+    GV+
Sbjct: 269 PVASDYFAPLVFAMSVIAIIYTSLVAMMQDDIKKLIAYSSVAHMGYVTMGIFAANMQGVQ 328

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G++FQMLSHG+VS ALF CVGV+YDR HTR+I AYGGLV+NMP+YAV MMVFTMAN+GLP
Sbjct: 329 GSIFQMLSHGIVSGALFLCVGVVYDRTHTREINAYGGLVNNMPKYAVAMMVFTMANVGLP 388

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GTSGFIGEFL ++ VF+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + EK++ L DL
Sbjct: 389 GTSGFIGEFLTLIGVFRVNTWVALFAATGVILSAAYALWLYRRVIFGALEKEKLKALLDL 448

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSV 497
           S RE+ ++YP+  LT+FFG+YP P+ D  +  +  ++ NYT     + +V
Sbjct: 449 SRREQLILYPLVALTIFFGVYPAPVFDATAASVDLLVNNYTAAVHAAQNV 498


>gi|241204100|ref|YP_002975196.1| NADH dehydrogenase subunit M [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857990|gb|ACS55657.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 503

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/470 (59%), Positives = 371/470 (78%), Gaps = 1/470 (0%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
            GR++   ++L  +   F+ SLF+W  FD     FQM+E + W+     YHLGVDGIS+L
Sbjct: 30  TGRKNVLWISLITTVFTFVVSLFIWIGFDNANPGFQMLEKHDWLGTGIGYHLGVDGISML 89

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+L+TFL PFC+L+SW SI++  +EYMIAFL+LE+M+IG F+SLD++LFY+FFEA LIP
Sbjct: 90  FVILSTFLMPFCVLASWLSIEKRLKEYMIAFLILETMMIGVFVSLDIVLFYVFFEAGLIP 149

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI 207
           MF+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I  L A  KFP ++
Sbjct: 150 MFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITALLAY-KFPPAL 208

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAG++LK+GGYG IRF L +F
Sbjct: 209 QTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGVLLKLGGYGLIRFSLGMF 268

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P+AS YFAP++F LS++AIIY SLV+M+Q DIKKLIAYSS+AHMGYVT+GIF+    GV+
Sbjct: 269 PVASDYFAPLVFALSVMAIIYTSLVAMMQDDIKKLIAYSSVAHMGYVTMGIFAANMQGVQ 328

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G++FQMLSHG+VS ALF CVGV+YDR HTR+I AYGGLV+NMP+YAV MMVFTMAN+GLP
Sbjct: 329 GSIFQMLSHGIVSGALFLCVGVVYDRTHTREINAYGGLVNNMPKYAVAMMVFTMANVGLP 388

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GTSGF+GEFL ++ VF+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + EK++ L DL
Sbjct: 389 GTSGFVGEFLTLIGVFRVNTWVALFAATGVILSAAYALWLYRRVIFGALEKEKLKALLDL 448

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSV 497
           S RE+ ++YP+  LT+FFG+YP P+ D  +  +  ++ NYT     + +V
Sbjct: 449 SPREQLILYPLVALTIFFGVYPAPVFDATAASVDLLVNNYTAAVHAAQNV 498


>gi|116251479|ref|YP_767317.1| NADH dehydrogenase subunit M [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256127|emb|CAK07208.1| putative NADH-ubiquinone oxidoreductase subunit M [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 503

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 371/470 (78%), Gaps = 1/470 (0%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
            GR++   ++L  +   F+ SL +W  FD     FQM+E ++W+     YH+GVDGIS+L
Sbjct: 30  TGRKNVLWISLITTVFTFVVSLVIWIGFDNANPGFQMVEKHNWLGTGIGYHVGVDGISML 89

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+L+TFL PFC+L+SW SI++  +EYMIAFL+LE+M+IG F+SLD++LFY+FFEA LIP
Sbjct: 90  FVILSTFLMPFCVLASWLSIEKRLKEYMIAFLILETMMIGVFVSLDIVLFYVFFEAGLIP 149

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI 207
           MF+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I  L A  KFP ++
Sbjct: 150 MFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITALLAY-KFPPAL 208

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAG++LK+GGYG IRF L +F
Sbjct: 209 QTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGVLLKLGGYGLIRFSLGMF 268

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P+AS YFAP++F +S+IAIIY SLV+M+Q DIKKLIAYSS+AHMGYVT+GIF+    GV+
Sbjct: 269 PVASDYFAPLVFAMSVIAIIYTSLVAMMQDDIKKLIAYSSVAHMGYVTMGIFAANMQGVQ 328

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G++FQMLSHG+VS ALF CVGV+YDR HTR+I AYGGLV+NMP+YAV MMVFTMAN+GLP
Sbjct: 329 GSIFQMLSHGIVSGALFLCVGVVYDRTHTREINAYGGLVNNMPKYAVAMMVFTMANVGLP 388

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GTSGF+GEFL ++ VF+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + EK++ L DL
Sbjct: 389 GTSGFVGEFLTLIGVFRVNTWVALFAATGVILSAAYALWLYRRVIFGALEKEKLKALLDL 448

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSV 497
           S RE+ ++YP+  LT+FFG+YP P+ D  +  +  ++ NYT     + +V
Sbjct: 449 SPREQLILYPLVALTIFFGVYPAPVFDATAASVDLLVNNYTAAVHAAQNV 498


>gi|114707381|ref|ZP_01440278.1| NADH dehydrogenase subunit M [Fulvimarina pelagi HTCC2506]
 gi|114537262|gb|EAU40389.1| NADH dehydrogenase subunit M [Fulvimarina pelagi HTCC2506]
          Length = 502

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/495 (57%), Positives = 381/495 (76%), Gaps = 2/495 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS VTFLP +G F+IL         RR+   VAL  +   F+ SL++W  FD   + F
Sbjct: 5   PILSTVTFLPLVGAFLILLIQDDNELARRNIRNVALLTTVFTFVVSLWIWGEFDYQTTGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+    +YH+GVDGIS+L V+LTTFL P CIL+S++S++   +EYMIAFLVLE
Sbjct: 65  QFVEQAEWLGTGITYHMGVDGISMLFVILTTFLMPLCILASFESVKTRVKEYMIAFLVLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++VIG F +LD++LFYIFFE  LIPMF+IIGVWGG  RIYA+YKFFLYTF GS+ ML A+
Sbjct: 125 TLVIGVFCALDLILFYIFFEGGLIPMFLIIGVWGGKRRIYASYKFFLYTFLGSVLMLVAM 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M W   T+SI +L A   FP S+Q W+W AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MAMYWNAGTTSIPELLA-HDFPASMQAWLWFAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI+LK+GGYG +RF LP+FP+AS  FAP ++ LS+IAIIY SLV+++Q DIKKL
Sbjct: 244 GSVILAGILLKLGGYGFLRFSLPMFPIASADFAPFVYSLSVIAIIYTSLVALMQEDIKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+    G++GA+FQMLSHGL+S ALF CVGV+YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAANAQGLQGAIFQMLSHGLISGALFLCVGVVYDRMHTREITAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP+YAV M++FTMAN+GLPGTSGF+GEFL ++ VFQ ++ VA+ A+ GV+LSA 
Sbjct: 364 GGLVNRMPKYAVAMLIFTMANVGLPGTSGFVGEFLTLLGVFQVNSWVAIFAATGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYR+V+FG  + E ++Q+ DLS RE+ ++YP+ VL +FFG+YP+P+ D  +  + +
Sbjct: 424 YALWLYRRVIFGALEKESLRQILDLSRREKALLYPLVVLVIFFGVYPMPVFDVTAASVEN 483

Query: 483 IIENYTLKTGYSDSV 497
           +I  Y+     + SV
Sbjct: 484 LINTYSAGLEAAQSV 498


>gi|163759528|ref|ZP_02166613.1| NADH dehydrogenase subunit M [Hoeflea phototrophica DFL-43]
 gi|162283125|gb|EDQ33411.1| NADH dehydrogenase subunit M [Hoeflea phototrophica DFL-43]
          Length = 503

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/488 (59%), Positives = 374/488 (76%), Gaps = 2/488 (0%)

Query: 2   NLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+VTF+P + V F++        GRR+   VAL  +T  FI SL +W+ FD    
Sbjct: 3   DWPLLSVVTFIPLICVLFLLPIKDDTEIGRRNIRQVALLGTTATFIMSLLIWANFDYADP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E         SY +GVDGIS+L V+LTTFL P CIL+SW S++   REYMIAFLV
Sbjct: 63  GFQMVENIELAGSGFSYAMGVDGISMLFVILTTFLMPLCILASWNSVETRVREYMIAFLV 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+M+IG F +LD++LFYIFFEA LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML 
Sbjct: 123 LETMMIGVFCALDIVLFYIFFEAGLIPMFIIIGVWGGKRRVYASFKFFLYTLAGSVLMLL 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ I  L A   FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMFWDAGTTDIRALLA-HNFPAEMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG +RF LP+FPLAS  FAP IF LS++AIIY SLV+++Q DIK
Sbjct: 242 TAGSVILAGILLKLGGYGFLRFSLPMFPLASADFAPFIFVLSVVAIIYTSLVALMQEDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHGL+S ALF CVGV+YDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMGFVTMGIFAANQLGVQGAIFQMLSHGLISGALFLCVGVVYDRMHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAVV M+FTMAN+GLPGTSGF+GEF+ ++ VFQ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVVFMIFTMANVGLPGTSGFVGEFMTLIGVFQANTWVALFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+VVFG  + E ++ + DLS RE+ ++YP+  L +FFG YP PI D  +  +
Sbjct: 422 AAYALWLYRRVVFGALEKESLKAMLDLSGREKAIIYPLVALVIFFGFYPAPILDVTAASV 481

Query: 481 SSIIENYT 488
            ++I NYT
Sbjct: 482 DALINNYT 489


>gi|306841948|ref|ZP_07474626.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. BO2]
 gi|306287981|gb|EFM59389.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. BO2]
          Length = 502

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 376/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNVTAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|17987429|ref|NP_540063.1| NADH dehydrogenase subunit M [Brucella melitensis bv. 1 str. 16M]
 gi|23501701|ref|NP_697828.1| NADH dehydrogenase subunit M [Brucella suis 1330]
 gi|163843087|ref|YP_001627491.1| NADH dehydrogenase subunit M [Brucella suis ATCC 23445]
 gi|225852330|ref|YP_002732563.1| NADH dehydrogenase subunit M [Brucella melitensis ATCC 23457]
 gi|254701582|ref|ZP_05163410.1| NADH dehydrogenase subunit M [Brucella suis bv. 5 str. 513]
 gi|254706970|ref|ZP_05168798.1| NADH dehydrogenase subunit M [Brucella pinnipedialis M163/99/10]
 gi|254709922|ref|ZP_05171733.1| NADH dehydrogenase subunit M [Brucella pinnipedialis B2/94]
 gi|254713923|ref|ZP_05175734.1| NADH dehydrogenase subunit M [Brucella ceti M644/93/1]
 gi|254717019|ref|ZP_05178830.1| NADH dehydrogenase subunit M [Brucella ceti M13/05/1]
 gi|256031415|ref|ZP_05445029.1| NADH dehydrogenase subunit M [Brucella pinnipedialis M292/94/1]
 gi|256044493|ref|ZP_05447397.1| NADH dehydrogenase subunit M [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060926|ref|ZP_05451084.1| NADH dehydrogenase subunit M [Brucella neotomae 5K33]
 gi|256264171|ref|ZP_05466703.1| NADH-ubiquinone oxidoreductase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369246|ref|YP_003106754.1| NADH dehydrogenase subunit M [Brucella microti CCM 4915]
 gi|260563847|ref|ZP_05834333.1| NADH-ubiquinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|261218826|ref|ZP_05933107.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M13/05/1]
 gi|261314433|ref|ZP_05953630.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis M163/99/10]
 gi|261317468|ref|ZP_05956665.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis B2/94]
 gi|261321675|ref|ZP_05960872.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M644/93/1]
 gi|261324926|ref|ZP_05964123.1| proton-translocating NADH-quinone oxidoreductase [Brucella neotomae
           5K33]
 gi|261752135|ref|ZP_05995844.1| proton-translocating NADH-quinone oxidoreductase [Brucella suis bv.
           5 str. 513]
 gi|265988504|ref|ZP_06101061.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis M292/94/1]
 gi|265990917|ref|ZP_06103474.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|294852171|ref|ZP_06792844.1| NADH dehydrogenase I subunit M [Brucella sp. NVSL 07-0026]
 gi|306843751|ref|ZP_07476350.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. BO1]
 gi|17983121|gb|AAL52327.1| NADH-quinone oxidoreductase chain m [Brucella melitensis bv. 1 str.
           16M]
 gi|23347624|gb|AAN29743.1| NADH dehydrogenase I, M subunit [Brucella suis 1330]
 gi|163673810|gb|ABY37921.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           suis ATCC 23445]
 gi|225640695|gb|ACO00609.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           melitensis ATCC 23457]
 gi|255999406|gb|ACU47805.1| NADH dehydrogenase subunit M [Brucella microti CCM 4915]
 gi|260153863|gb|EEW88955.1| NADH-ubiquinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|260923915|gb|EEX90483.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M13/05/1]
 gi|261294365|gb|EEX97861.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M644/93/1]
 gi|261296691|gb|EEY00188.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis B2/94]
 gi|261300906|gb|EEY04403.1| proton-translocating NADH-quinone oxidoreductase [Brucella neotomae
           5K33]
 gi|261303459|gb|EEY06956.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis M163/99/10]
 gi|261741888|gb|EEY29814.1| proton-translocating NADH-quinone oxidoreductase [Brucella suis bv.
           5 str. 513]
 gi|263001701|gb|EEZ14276.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094389|gb|EEZ18234.1| NADH-ubiquinone oxidoreductase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660701|gb|EEZ30962.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           pinnipedialis M292/94/1]
 gi|294820760|gb|EFG37759.1| NADH dehydrogenase I subunit M [Brucella sp. NVSL 07-0026]
 gi|306275942|gb|EFM57655.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. BO1]
 gi|326408837|gb|ADZ65902.1| NADH dehydrogenase subunit M [Brucella melitensis M28]
 gi|326538553|gb|ADZ86768.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           melitensis M5-90]
          Length = 502

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 376/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|153009739|ref|YP_001370954.1| NADH dehydrogenase subunit M [Ochrobactrum anthropi ATCC 49188]
 gi|151561627|gb|ABS15125.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Ochrobactrum anthropi ATCC 49188]
          Length = 502

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 285/487 (58%), Positives = 376/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL +W+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTIFVFILSLVIWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEQIDWMGGGISYHMGVDGISVLFVVLSAFLMPFCILASWISVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   S FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELQKYS-FPAGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG +RF LP+FPLAS  FAP+IF LS+IAIIY SLV++VQ DIK
Sbjct: 242 TAGSVILAGILLKLGGYGFLRFSLPMFPLASADFAPLIFTLSVIAIIYTSLVALVQEDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGIQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGF+GEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFLGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+VVFG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRQVVFGALTKESLKALLDLSPREKIILYPLVALTIFFGVYPTPVFDVTAGAV 481

Query: 481 SSIIENY 487
           ++++++Y
Sbjct: 482 NALVQHY 488


>gi|254718923|ref|ZP_05180734.1| NADH dehydrogenase subunit M [Brucella sp. 83/13]
 gi|265983910|ref|ZP_06096645.1| proton-translocating NADH-quinone oxidoreductase [Brucella sp.
           83/13]
 gi|306838229|ref|ZP_07471081.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. NF 2653]
 gi|264662502|gb|EEZ32763.1| proton-translocating NADH-quinone oxidoreductase [Brucella sp.
           83/13]
 gi|306406673|gb|EFM62900.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           sp. NF 2653]
          Length = 502

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I +Y
Sbjct: 482 NALIRHY 488


>gi|15888611|ref|NP_354292.1| NADH dehydrogenase subunit M [Agrobacterium tumefaciens str. C58]
 gi|15156333|gb|AAK87077.1| NADH dehydrogenase I chain M [Agrobacterium tumefaciens str. C58]
          Length = 503

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/497 (57%), Positives = 382/497 (76%), Gaps = 2/497 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGC-GRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GV ++L ++  G  GRR+   V+L  +   FI SLFVW  FD    
Sbjct: 3   DWPILSTVTFLPLVGVVLLLLTNENGPYGRRNILNVSLLTTVFTFIVSLFVWIGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E + W     +YHLGVDGIS+L V+LTTFL PFC+L+SW SI++  +EYMIAFL+
Sbjct: 63  GFQMVEKHAWFGKIAAYHLGVDGISMLFVILTTFLMPFCVLASWNSIEKRVKEYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE +++G F++LD +LFY+FFEA+LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+  + 
Sbjct: 123 LEVVMVGVFVALDTVLFYVFFEATLIPMFIIIGVWGGKDRVYASYKFFLYTLLGSVLTML 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ + +L     FP  +Q W+W+A F +F++K+PM+P HTWLP+AHVQAP
Sbjct: 183 AIMAMYWQSGTTDMTELLKYG-FPAGMQTWLWLACFAAFSVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG+MLK+GGYG IRF L +FPLAS YFAP +F LS++AIIY SLV+M+Q DIK
Sbjct: 242 TAGSVILAGVMLKLGGYGFIRFSLSMFPLASDYFAPFVFTLSVLAIIYTSLVAMMQDDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIF+    GV+GA+FQMLSHG+VS ALF CVGV+YDRLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFAANVQGVQGAIFQMLSHGIVSGALFLCVGVVYDRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV  M+FTMAN+GLPGTSGF+GEFL ++ VF+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAFMIFTMANVGLPGTSGFVGEFLTLIGVFRANTLVALFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + E ++ + DLS RE+ ++YP+  LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKESLKSMLDLSTREKVILYPLVALTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENYTLKTGYSDSV 497
             ++ NYT     + +V
Sbjct: 482 DLLVNNYTAALQAAQNV 498


>gi|325292646|ref|YP_004278510.1| NADH dehydrogenase I chain M [Agrobacterium sp. H13-3]
 gi|325060499|gb|ADY64190.1| NADH dehydrogenase I chain M [Agrobacterium sp. H13-3]
          Length = 503

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 383/497 (77%), Gaps = 2/497 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGC-GRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GV ++L ++  G  GRR+   V+L  +   F+ SLFVW  FD    
Sbjct: 3   DWPILSTVTFLPLVGVVLLLLTNENGPYGRRNILNVSLLTTVFTFLVSLFVWIGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E + W     +YHLGVDGIS+L V+LTTFL PFC+L+SW+S+++  +EYMIAFL+
Sbjct: 63  GFQMVEKHAWFGNIAAYHLGVDGISMLFVILTTFLMPFCVLASWQSVEKRIKEYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE ++IG F++LD +LFY+FFEA+LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+  + 
Sbjct: 123 LEVVMIGVFVALDTVLFYVFFEATLIPMFIIIGVWGGKDRVYASYKFFLYTLLGSVLTML 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ + +L     FP  +Q W+W+A F +F++K+PM+P HTWLP+AHVQAP
Sbjct: 183 AIMAMYWQSGTTDMTELLKYG-FPAGMQTWLWLACFAAFSVKMPMWPVHTWLPDAHVQAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG+MLK+GGYG IRF L +FPLAS YFAP +F LS++AIIY SLV+M+Q DIK
Sbjct: 242 TAGSVILAGVMLKLGGYGFIRFSLSMFPLASDYFAPFVFTLSVLAIIYTSLVAMMQDDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIF+    GV+GA+FQMLSHG+VS ALF CVGV+YDRLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFAANVQGVQGAIFQMLSHGIVSGALFLCVGVVYDRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV+NMP+YAV  M+FTMAN+GLPGTSGF+GEFL ++ VF+ +  VA+ A+ GV+LS
Sbjct: 362 AYGGLVNNMPKYAVAFMIFTMANVGLPGTSGFVGEFLTLIGVFRANTLVALFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG  + E ++ + DLS RE+ ++YP+  LT+FFG+YP P+ D  +  +
Sbjct: 422 AAYALWLYRRVIFGALEKESLKSMLDLSTREKVILYPLVALTIFFGVYPAPVFDATAASV 481

Query: 481 SSIIENYTLKTGYSDSV 497
             ++ NYT     + +V
Sbjct: 482 DLLVNNYTAALQAAQNV 498


>gi|256159536|ref|ZP_05457304.1| NADH dehydrogenase subunit M [Brucella ceti M490/95/1]
 gi|256254823|ref|ZP_05460359.1| NADH dehydrogenase subunit M [Brucella ceti B1/94]
 gi|261222004|ref|ZP_05936285.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           B1/94]
 gi|265997968|ref|ZP_06110525.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M490/95/1]
 gi|260920588|gb|EEX87241.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           B1/94]
 gi|262552436|gb|EEZ08426.1| proton-translocating NADH-quinone oxidoreductase [Brucella ceti
           M490/95/1]
          Length = 502

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            +GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 VFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|256113349|ref|ZP_05454207.1| NADH dehydrogenase subunit M [Brucella melitensis bv. 3 str. Ether]
 gi|265994755|ref|ZP_06107312.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           melitensis bv. 3 str. Ether]
 gi|262765868|gb|EEZ11657.1| proton-translocating NADH-quinone oxidoreductase [Brucella
           melitensis bv. 3 str. Ether]
          Length = 502

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYAFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|225627311|ref|ZP_03785348.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           ceti str. Cudo]
 gi|260168549|ref|ZP_05755360.1| NADH dehydrogenase subunit M [Brucella sp. F5/99]
 gi|261758022|ref|ZP_06001731.1| NADH-ubiquinone oxidoreductase [Brucella sp. F5/99]
 gi|225617316|gb|EEH14361.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           ceti str. Cudo]
 gi|261738006|gb|EEY26002.1| NADH-ubiquinone oxidoreductase [Brucella sp. F5/99]
          Length = 502

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS  TFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTATFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|62289763|ref|YP_221556.1| NADH dehydrogenase subunit M [Brucella abortus bv. 1 str. 9-941]
 gi|82699691|ref|YP_414265.1| NADH dehydrogenase subunit M [Brucella melitensis biovar Abortus
           2308]
 gi|189024008|ref|YP_001934776.1| NADH dehydrogenase subunit M [Brucella abortus S19]
 gi|237815250|ref|ZP_04594248.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           abortus str. 2308 A]
 gi|254689070|ref|ZP_05152324.1| NADH dehydrogenase subunit M [Brucella abortus bv. 6 str. 870]
 gi|254697204|ref|ZP_05159032.1| NADH dehydrogenase subunit M [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730100|ref|ZP_05188678.1| NADH dehydrogenase subunit M [Brucella abortus bv. 4 str. 292]
 gi|256257319|ref|ZP_05462855.1| NADH dehydrogenase subunit M [Brucella abortus bv. 9 str. C68]
 gi|260545487|ref|ZP_05821228.1| NADH-ubiquinone oxidoreductase [Brucella abortus NCTC 8038]
 gi|260754568|ref|ZP_05866916.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 6 str. 870]
 gi|260757789|ref|ZP_05870137.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 4 str. 292]
 gi|260761614|ref|ZP_05873957.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883595|ref|ZP_05895209.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 9 str. C68]
 gi|297248168|ref|ZP_06931886.1| NADH dehydrogenase I subunit M [Brucella abortus bv. 5 str. B3196]
 gi|62195895|gb|AAX74195.1| NuoM, NADH dehydrogenase I, M subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615792|emb|CAJ10790.1| NADH/Ubiquinone/plastoquinone (complex I):NADH-ubiquinone
           oxidoreductase, chain 4 [Brucella melitensis biovar
           Abortus 2308]
 gi|189019580|gb|ACD72302.1| NADH-ubiquinone oxidoreductase, chain 4 [Brucella abortus S19]
 gi|237790087|gb|EEP64297.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           abortus str. 2308 A]
 gi|260096894|gb|EEW80769.1| NADH-ubiquinone oxidoreductase [Brucella abortus NCTC 8038]
 gi|260668107|gb|EEX55047.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 4 str. 292]
 gi|260672046|gb|EEX58867.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674676|gb|EEX61497.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 6 str. 870]
 gi|260873123|gb|EEX80192.1| proton-translocating NADH-quinone oxidoreductase [Brucella abortus
           bv. 9 str. C68]
 gi|297175337|gb|EFH34684.1| NADH dehydrogenase I subunit M [Brucella abortus bv. 5 str. B3196]
          Length = 502

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 376/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AH+ YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHIAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|161618778|ref|YP_001592665.1| NADH dehydrogenase subunit M [Brucella canis ATCC 23365]
 gi|161335589|gb|ABX61894.1| proton-translocating NADH-quinone oxidoreductase, chain M [Brucella
           canis ATCC 23365]
          Length = 502

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+ VDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMSVDGISVLFVVLSAFLIPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTCVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|254469370|ref|ZP_05082775.1| NADH-quinone oxidoreductase chain m [Pseudovibrio sp. JE062]
 gi|211961205|gb|EEA96400.1| NADH-quinone oxidoreductase chain m [Pseudovibrio sp. JE062]
          Length = 508

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 370/484 (76%), Gaps = 1/484 (0%)

Query: 6   LSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LSI TFLP +GV F++L        + +   VAL  +T  FI SLF+W  F      FQM
Sbjct: 7   LSITTFLPLVGVLFILLVRGDDPDAKTNIRRVALITTTFTFIVSLFIWGGFTNENPGFQM 66

Query: 65  IEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           +E Y W     +YH+GVDGIS+L V+LTTFL P CIL+SW+S+Q+  +EYMIAFLVLE++
Sbjct: 67  VEKYDWFGDTFTYHMGVDGISMLFVILTTFLMPLCILASWESVQDRVKEYMIAFLVLETL 126

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           +IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YA+YKFFLYT  GS+ ML AI+ 
Sbjct: 127 MIGVFCALDLVLFYVFFEAGLIPMFLIIGVWGGPRRVYASYKFFLYTLLGSVLMLAAIMA 186

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           M W+  T  I++L   S FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGS
Sbjct: 187 MYWQAGTLDIVELLDKSDFPAQMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGS 246

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LA I+LKMGGYG +RF LP+FP+AS  FAP+IF LS++AIIY SLV++ Q DIKKLIA
Sbjct: 247 VVLAAILLKMGGYGFLRFSLPMFPIASDMFAPLIFTLSIVAIIYTSLVALAQEDIKKLIA 306

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSS+AHMG+VT+GIFS    G+EGA+F ML+HGL+S ALF CVGVIYDR+HTR I AYGG
Sbjct: 307 YSSVAHMGFVTMGIFSANAQGIEGAIFMMLAHGLISGALFLCVGVIYDRMHTRQITAYGG 366

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           LV+NMPRYAV  M+FTMAN+GLPGT+GF+GEFL ++ VFQ +  VA  A+ GV+LSA Y+
Sbjct: 367 LVNNMPRYAVAFMIFTMANVGLPGTAGFVGEFLTMIGVFQVNTWVAFFAATGVILSAAYA 426

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           L+LYR+VVFG  + E ++ + DL+ RE+ ++ P+ +LT+FFG YP  + D  S  + ++I
Sbjct: 427 LFLYRRVVFGALEKESLKSMLDLTGREKLILAPLIILTIFFGFYPAALLDVTSASVGALI 486

Query: 485 ENYT 488
           ENY 
Sbjct: 487 ENYN 490


>gi|254704129|ref|ZP_05165957.1| NADH dehydrogenase subunit M [Brucella suis bv. 3 str. 686]
 gi|260566622|ref|ZP_05837092.1| NADH-ubiquinone oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|261754795|ref|ZP_05998504.1| proton-translocating NADH-quinone oxidoreductase [Brucella suis bv.
           3 str. 686]
 gi|260156140|gb|EEW91220.1| NADH-ubiquinone oxidoreductase [Brucella suis bv. 4 str. 40]
 gi|261744548|gb|EEY32474.1| proton-translocating NADH-quinone oxidoreductase [Brucella suis bv.
           3 str. 686]
          Length = 502

 Score =  596 bits (1537), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 375/487 (77%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+ VDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMSVDGISVLFVVLSAFLIPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|239831698|ref|ZP_04680027.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Ochrobactrum intermedium LMG 3301]
 gi|239823965|gb|EEQ95533.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Ochrobactrum intermedium LMG 3301]
          Length = 511

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 287/496 (57%), Positives = 376/496 (75%), Gaps = 2/496 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   F  SL VW+ FD    
Sbjct: 12  DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTIFVFALSLVVWAGFDNSNP 71

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 72  GFQMVEQVDWMGGGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 131

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 132 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 191

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L     FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 192 AIMAMYWQAGTMNIVELLKYD-FPAGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 250

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS+IAIIY SLV+MVQ D+K
Sbjct: 251 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFALSVIAIIYTSLVAMVQEDMK 310

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 311 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 370

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 371 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 430

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYR+V+FG    E ++ L DLS RE+ ++YP+ VLT+FFG+YP P+ +  +  +
Sbjct: 431 AAYALWLYRQVIFGALTKESLKALLDLSPREKLILYPLVVLTIFFGVYPTPVFNVTAGAV 490

Query: 481 SSIIENYTLKTGYSDS 496
           ++++++Y      S S
Sbjct: 491 NALVQHYDAALAGSAS 506


>gi|118590025|ref|ZP_01547429.1| NADH dehydrogenase subunit M [Stappia aggregata IAM 12614]
 gi|118437522|gb|EAV44159.1| NADH dehydrogenase subunit M [Stappia aggregata IAM 12614]
          Length = 508

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 281/489 (57%), Positives = 378/489 (77%), Gaps = 2/489 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           ++ P LS+ TFLP LGV F++L        +++   VAL  +++ F+ SLF+W  FD   
Sbjct: 2   IDWPILSLTTFLPLLGVLFILLVPGNDEGSKKNIRMVALVTTSVTFLLSLFIWGNFDYAN 61

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           S FQ +E+  W+    SY +GVDGIS+L V+LTTFL PFCIL+SW S+Q+  +EYMIAFL
Sbjct: 62  SGFQFVEHREWLGSNISYRMGVDGISVLFVILTTFLMPFCILASWDSVQKRVKEYMIAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+++IG F +LD+++FY+FFEA LIPMF+IIGVWGG+ R+YA+YKFFLYT  GS+ ML
Sbjct: 122 VLETLMIGVFCALDLVVFYVFFEAGLIPMFLIIGVWGGARRVYASYKFFLYTLLGSVLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ M W   T++I +L  + +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 182 IAIMAMYWNAGTTNIEELL-VHQFPAGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEA 240

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAG++LK+GGYG +RF LP+FPLAS  FAP +F LS++AIIY SLV++ Q DI
Sbjct: 241 PTAGSVILAGVLLKLGGYGFLRFSLPMFPLASDMFAPFVFTLSVVAIIYTSLVALAQEDI 300

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVT+GIF+  + GV+G +FQMLSHG+VS ALF CVGVIYDR+HTRDI
Sbjct: 301 KKLIAYSSVAHMGYVTMGIFTMTEQGVQGGIFQMLSHGIVSGALFLCVGVIYDRMHTRDI 360

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP+YAV  ++FTMAN+GLPGTSGF+GE L +M  FQ ++ VA  A+ GV+L
Sbjct: 361 TAYGGLVNRMPKYAVAFLIFTMANVGLPGTSGFVGEILTLMGAFQVNSWVAFFATTGVIL 420

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+L+LYR+VVFG  + E ++ + DL+LRE+ ++ P+ +LT+FFG YP+ I D     
Sbjct: 421 SAAYALYLYRRVVFGALEKESLKSILDLNLREKVILVPMIILTIFFGFYPMAILDVTQGA 480

Query: 480 LSSIIENYT 488
           + ++I  YT
Sbjct: 481 VDNLINQYT 489


>gi|148560286|ref|YP_001258792.1| NADH dehydrogenase subunit M [Brucella ovis ATCC 25840]
 gi|148371543|gb|ABQ61522.1| NADH dehydrogenase I, M subunit [Brucella ovis ATCC 25840]
          Length = 502

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 285/487 (58%), Positives = 374/487 (76%), Gaps = 2/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+ M +YAV  ++FTMAN+GLPGTSGFIGEFL +  VF+ +  VA+ A+ GV+LS
Sbjct: 362 AFGGLVNKMSKYAVAFLIFTMANVGLPGTSGFIGEFLTLFGVFRVNTWVALFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLYRKV+FG    E ++ L DLS RE+ ++YP+  LT+FFG+YP P+ +  +  +
Sbjct: 422 AAYALWLYRKVIFGALDKESLKALLDLSPREKLILYPLVALTIFFGVYPTPVFNATAGAV 481

Query: 481 SSIIENY 487
           +++I++Y
Sbjct: 482 NALIQHY 488


>gi|227821631|ref|YP_002825601.1| NADH dehydrogenase subunit M [Sinorhizobium fredii NGR234]
 gi|227340630|gb|ACP24848.1| NADH dehydrogenase I chain M [Sinorhizobium fredii NGR234]
          Length = 503

 Score =  591 bits (1524), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 271/460 (58%), Positives = 362/460 (78%), Gaps = 1/460 (0%)

Query: 29  GRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILL 88
           GRR+   ++L  + + F  SL+VW  FD     FQMIE + W+    SYHLG+DGIS+L 
Sbjct: 31  GRRNILNISLLTTIVVFGLSLYVWYQFDSSNPGFQMIEKHEWLGTGISYHLGIDGISVLF 90

Query: 89  VVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPM 148
           + LT FL PFC+L+SW +I+   +EYMIAFL+LE++++G F+SLD++LFY+FFEA LIPM
Sbjct: 91  LPLTAFLMPFCVLASWVTIENRLKEYMIAFLLLETLMLGVFVSLDIVLFYVFFEAGLIPM 150

Query: 149 FVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           F+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I +L   + FP  +Q
Sbjct: 151 FIIIGVWGGKDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITELLKYN-FPRQMQ 209

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
            W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAGI+LK+GGYG +RF LP+FP
Sbjct: 210 TWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGILLKLGGYGFLRFSLPMFP 269

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
           LAS YFAP ++ LS+IAIIY SLV+M+Q+DIKKLIAYSS+AHMGYVT+G F+    GV+G
Sbjct: 270 LASDYFAPFVYTLSIIAIIYTSLVAMMQSDIKKLIAYSSVAHMGYVTMGTFAANIQGVQG 329

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           A+FQMLSHG+VS ALF CVGV+YDRLHTR+I AYGGLV+NMP+YAV  MVFTMAN+GLPG
Sbjct: 330 AIFQMLSHGIVSGALFLCVGVVYDRLHTREISAYGGLVNNMPKYAVAFMVFTMANVGLPG 389

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TSGF+GE L ++  F+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + + ++ + DLS
Sbjct: 390 TSGFVGEVLTLVGAFRANTWVALFATSGVILSAAYALWLYRRVIFGALEKDSLKAMLDLS 449

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYT 488
            RE+ ++YP+ +LT+FFG+YP P+ D  +  +  ++ NY 
Sbjct: 450 TREKLILYPLVILTIFFGVYPAPVFDATAASVDLLVNNYA 489


>gi|304391414|ref|ZP_07373356.1| NADH-quinone oxidoreductase subunit m [Ahrensia sp. R2A130]
 gi|303295643|gb|EFL90001.1| NADH-quinone oxidoreductase subunit m [Ahrensia sp. R2A130]
          Length = 506

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 370/487 (75%), Gaps = 3/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           +LP L+I TFLP +G  ++ L        RR+   VAL  + + F+ SL +W+ FD  R+
Sbjct: 3   DLPILTITTFLPLVGALIVFLIWEDSEVARRNVRMVALLTTCLTFLVSLGIWAGFDNSRA 62

Query: 61  SFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ +E   WI +   +YH+GVDGIS+L V+LTTFL PFCIL+SW +IQ   REYMIAFL
Sbjct: 63  DFQFVEKVEWISEGGIAYHMGVDGISMLFVILTTFLMPFCILASWDAIQHRVREYMIAFL 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F SLD++LFY+FFEA LIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML
Sbjct: 123 LLETLMIGVFCSLDIVLFYVFFEAGLIPMFIIIGVWGGQRRVYASMKFFLYTLLGSVLML 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ M W+  T+ I  L A   FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 183 LAIMAMYWQAGTTDIPTLLAY-DFPADMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEA 241

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAGI+LKMGGYG +RF LP+FPLAS      +F LS+IAIIY SLV+++Q DI
Sbjct: 242 PTAGSVILAGILLKMGGYGFLRFSLPMFPLASDTMQNFVFALSVIAIIYTSLVALMQEDI 301

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVT+GIF+    G++GA+FQML+HGLVS ALF CVGV+YDR+HTR+I
Sbjct: 302 KKLIAYSSVAHMGYVTMGIFTANVQGIQGAIFQMLAHGLVSGALFLCVGVVYDRMHTREI 361

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+NMP+YAV  ++FTMAN+GLPGT+GF+GEFL ++  FQ +  VA+ A+ GV+L
Sbjct: 362 AAYGGLVNNMPKYAVAFLIFTMANVGLPGTAGFVGEFLTLLGAFQANTWVAIFATLGVIL 421

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYR+VVFG    E ++ + DL+ RE+ ++YP+ VL +FFG+YP P+ D  +  
Sbjct: 422 SAAYALWLYRRVVFGTLDKEALKAMLDLNTREKVILYPLVVLVIFFGVYPSPVFDVTTAS 481

Query: 480 LSSIIEN 486
           + +++  
Sbjct: 482 VDNLVAT 488


>gi|319404247|emb|CBI77840.1| NADH dehydrogenase I chain M [Bartonella rochalimae ATCC BAA-1498]
          Length = 489

 Score =  588 bits (1517), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 287/486 (59%), Positives = 374/486 (76%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GVF+IL         +R+   VA   +   FI SL +W+ FD   S
Sbjct: 3   DWPILSTVTFLPLVGVFLILLIKDDSEAAKRNIRNVAFFTTVFVFIISLVIWAGFDTTNS 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E +HW+    SYH+G+DGIS+L VVL+ FL PFCIL+SW +IQ+  ++YMIAFL+
Sbjct: 63  DFQMVEKFHWLGSDISYHVGIDGISVLFVVLSAFLLPFCILASWNTIQDRLKDYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  +IG F +LD +LFYIFFE SLIPMF+IIGVWGG+ RIYA+ KFFLYT  GS+ ML 
Sbjct: 123 LEVAIIGVFCALDAILFYIFFEGSLIPMFIIIGVWGGARRIYASMKFFLYTLLGSVLMLV 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VM WE  T  I  L    +F   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMVMYWEAGTLDIPTLLTY-QFNTHMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF LP+FP+AS  F+ ++F LSLIAIIY SLV++VQ+DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGFIRFSLPMFPIASADFSSLVFTLSLIAIIYTSLVALVQSDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIFS  + G++GA++QMLSHG+VS+ALF CVGVIY+RLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFSANEQGIQGAIYQMLSHGIVSAALFLCVGVIYNRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGFIGEFL ++ VFQ +  VAV A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVVFLIFTMANIGLPGSSGFIGEFLTLIGVFQVNKLVAVFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+L+LYR++VFG  + E ++ L DLS  E+  +YP+ +LT+FFG+YP PI  T    +
Sbjct: 422 AAYALYLYRRIVFGSLEKENLKVLLDLSPIEKFTLYPMVILTIFFGVYPTPIFKTTMSAV 481

Query: 481 SSIIEN 486
            S+I  
Sbjct: 482 ESLINQ 487


>gi|319405686|emb|CBI79309.1| NADH dehydrogenase I chain M [Bartonella sp. AR 15-3]
          Length = 489

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/486 (58%), Positives = 374/486 (76%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GVF+IL         + +   VA   +   FI SL +W+ FD   S
Sbjct: 3   DWPILSTVTFLPLIGVFLILLIKDDSEAAKSNIRNVAFFTTVFVFIISLVIWAGFDTTNS 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E +HW+    SYH+G+DGIS+L VVL+ FL PFCIL+SW +IQ+  ++YM+AFL+
Sbjct: 63  DFQMVEKFHWLGSGISYHMGIDGISVLFVVLSAFLLPFCILASWNTIQDRLKDYMVAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  +IG F +LD +LFYIFFE SLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LEVAIIGVFCALDAILFYIFFEGSLIPMFIIIGVWGGVRRVYASMKFFLYTLLGSVLMLV 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VM WE  T  I  L    +F   +Q W+W+AFF SFA+K+PM+PFHTWLP+AHV+AP
Sbjct: 183 AIMVMYWEAGTLDIPTLLTY-QFTTHMQIWLWLAFFASFAVKMPMWPFHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF LP+FP+AS  F+ ++F LSLIAIIY SLV++VQ DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGFIRFSLPMFPIASADFSSLVFTLSLIAIIYTSLVALVQNDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIFS  + G++GA++QMLSHG+VS+ALF CVG+IY+RLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFSANEQGIQGAIYQMLSHGIVSAALFLCVGIIYNRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGFIGEFL ++ VFQ +  VAV A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVVFLIFTMANVGLPGSSGFIGEFLTLIGVFQANKFVAVFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+L+LYR+VVFG S+ E ++ L DLS  E+  +YP+ +LT+FFG+YP PI  T    +
Sbjct: 422 AAYALYLYRRVVFGSSEKENLKVLLDLSPIEKFTLYPMVILTIFFGVYPRPIFKTTISAV 481

Query: 481 SSIIEN 486
            S+I+ 
Sbjct: 482 ESLIKQ 487


>gi|319408591|emb|CBI82246.1| NADH dehydrogenase I chain M [Bartonella schoenbuchensis R1]
          Length = 489

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 374/486 (76%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GVF+IL         + +   VA   S   F+ SL +W  FD   S
Sbjct: 3   DWPILSTVTFLPLVGVFLILLIKDNTEAEKHNIRNVAFFTSVFVFVISLIIWVKFDNTNS 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E + W+    SYH+GVDGISIL VVL+ FL PFCIL+SW++I++  + YMIAFL+
Sbjct: 63  DFQMVEKFDWLGGGISYHMGVDGISILFVVLSAFLLPFCILASWENIKDRLKAYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  +IG F +LD +LFY+FFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LEVAIIGVFCALDAMLFYVFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVLMLV 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M WE  T  I  L    +F   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWEAGTLDIPTLLTY-QFSTHMQMWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG +RF LP+FP+AS  FAP++F LSL+AIIY SLV++VQ DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGFLRFSLPMFPIASADFAPLVFVLSLVAIIYTSLVALVQNDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVT+GIF+  + G++GA++QMLSHG+VS+ALF CVGVIYDRLHTR+I 
Sbjct: 302 KLIAYSSIAHMGYVTMGIFAINEQGIQGAIYQMLSHGIVSAALFLCVGVIYDRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGF+GEFL ++ VFQ +  VAV A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVVFLIFTMANVGLPGSSGFLGEFLTLIGVFQINKLVAVFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+L+LYR+++FG    E ++ L DLSLRE+ ++YP+ VLT+FFG+YP+PI  T +  +
Sbjct: 422 AAYALYLYRRMIFGPLDKEGLKVLHDLSLREKIILYPMVVLTIFFGVYPMPILKTTAFTV 481

Query: 481 SSIIEN 486
            ++I  
Sbjct: 482 ETLINQ 487


>gi|328543699|ref|YP_004303808.1| Proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [polymorphum gilvum SL003B-26A1]
 gi|326413443|gb|ADZ70506.1| Proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Polymorphum gilvum SL003B-26A1]
          Length = 506

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 373/501 (74%), Gaps = 6/501 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCG-RRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           ++ P L+  TFLP  GV  IL       G +R+   VAL  +   F+ SLF+W  FD   
Sbjct: 2   IDWPILTTTTFLPLAGVLAILLVPGDDEGAKRNIRMVALVTTLFTFVLSLFIWGAFDYDN 61

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQM+E   W+    +Y +GVDGIS+L V+LTTFL PFCIL+SW+S+Q+  +EYMIAFL
Sbjct: 62  PGFQMVESRDWLSGTITYKMGVDGISMLFVILTTFLMPFCILASWESVQKRVKEYMIAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD+++FY+FFEA L+PMF+IIGVWGG  R+YA+YKFFLYT  GS+ ML
Sbjct: 122 ILETLMIGVFCALDLVVFYVFFEAGLLPMFLIIGVWGGKRRVYASYKFFLYTLLGSVLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPF--SIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            A++ M WE  T+   D+  + + PF  S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 182 IAVMAMYWEAGTT---DITVLLRHPFGESMQTWLWLAFFASFAVKMPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAGI+LKMGGYG +RF LP+FPLAS  FAP++F LS++AI+Y SLV++ Q 
Sbjct: 239 EAPTAGSVILAGILLKMGGYGFLRFSLPMFPLASDMFAPLVFTLSVVAIVYTSLVALAQE 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMGYVT+GIF+    GV+G +FQMLSHG+VS ALF CVGVIYDR+HTR
Sbjct: 299 DIKKLIAYSSVAHMGYVTMGIFTMTPQGVQGGLFQMLSHGIVSGALFLCVGVIYDRMHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I AYGGLV+ MP YAV  ++FTMAN+GLPGTSGF+GEFL +M  F+ +  VA++A+ GV
Sbjct: 359 EISAYGGLVNRMPFYAVAFLIFTMANVGLPGTSGFVGEFLTLMGAFEVNTWVALIATTGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA Y+L+LYR+VVFG    E ++ + DLS RE+ ++ P+ VLTV FG YP PI D   
Sbjct: 419 ILSAAYALFLYRRVVFGALDKESLKSITDLSFREQAILVPMIVLTVLFGFYPAPILDVTQ 478

Query: 478 VPLSSIIENYTLKTGYSDSVK 498
             + ++I NY      +  V+
Sbjct: 479 ASVDALITNYQAALDAAGQVQ 499


>gi|319898894|ref|YP_004158987.1| NADH dehydrogenase I chain M [Bartonella clarridgeiae 73]
 gi|319402858|emb|CBI76409.1| NADH dehydrogenase I chain M [Bartonella clarridgeiae 73]
          Length = 489

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 374/489 (76%), Gaps = 8/489 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF----SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           + P LS VTFLP +GVF+IL     S    C  R+   VA   +   F+ SL +W+ FD 
Sbjct: 3   DWPILSTVTFLPLVGVFLILLIKDDSEEAKCNIRN---VAFFTAMFVFVISLVIWAGFDN 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             S FQM+E +HW+    SYH+G+DGIS+L VVL+ FL PFCIL+SW +IQ+  ++YMIA
Sbjct: 60  TNSDFQMVEKFHWLGGDISYHMGIDGISVLFVVLSAFLLPFCILASWNTIQDRLKDYMIA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE  +IG F +LD +LFYIFFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ 
Sbjct: 120 FLLLEVAIIGVFCALDAILFYIFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVL 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML AI+ M WE  T  I  L    +F   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 180 MLVAIMAMYWEAGTLDIPTLLT-HQFTTHMQIWLWLAFFASFAVKMPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAGI+LK+GGYG IRF LP+FP+AS  FAP++F LSLI+IIY SLV++VQ 
Sbjct: 239 EAPTAGSVILAGILLKLGGYGFIRFSLPMFPIASADFAPLVFTLSLISIIYTSLVALVQN 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMGYV +GIFS  + G++GA++QMLSHG++S+ALF CVGVIY+RLHTR
Sbjct: 299 DIKKLIAYSSVAHMGYVMMGIFSANEQGIQGAIYQMLSHGIISAALFLCVGVIYNRLHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGFIGEFL ++ VFQ +  +AV A+ GV
Sbjct: 359 EISAFGGLVNNMPKYAVVFLIFTMANIGLPGSSGFIGEFLTLIGVFQINKFIAVFATTGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           VLSA Y+L+LYR+++FG    E ++ L DLS RE+  +YP+ +LT+FFG+YP PI  T +
Sbjct: 419 VLSAAYALYLYRRIIFGSLDKENLKVLLDLSPREKFTLYPMVILTIFFGVYPTPIFKTTT 478

Query: 478 VPLSSIIEN 486
             + ++I  
Sbjct: 479 SAVKALINQ 487


>gi|240850595|ref|YP_002971995.1| NADH dehydrogenase I subunit M [Bartonella grahamii as4aup]
 gi|240267718|gb|ACS51306.1| NADH dehydrogenase I subunit M [Bartonella grahamii as4aup]
          Length = 489

 Score =  584 bits (1506), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 370/484 (76%), Gaps = 2/484 (0%)

Query: 4   PFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS VTFLP +GV +ILF        R +   VA   +   FI SL +W  FD    +F
Sbjct: 5   PILSTVTFLPLVGVLLILFIKDDSEVARHNIRNVAFFTTLFVFIISLIIWIGFDSSNPNF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   W+    SYH+GVDGISIL VVL+ FL PFCIL+S ++++E  + YMIAFL+LE
Sbjct: 65  QMVEKSSWLGGGISYHMGVDGISILFVVLSAFLLPFCILASLENVKERLKAYMIAFLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
             +IG F +LD +LFY+FFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ ML A+
Sbjct: 125 VAIIGVFCALDAMLFYVFFEGSLIPMFIIIGVWGGARRVYASIKFFLYTLLGSVLMLVAL 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + M WE  T  I  L    +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MAMYWEAGTLDIPTLLNY-QFPAHMQIWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAG++LK+GGYG +RF LP+FP+AS  FAP+IF LSLIAIIY SLV++VQ DIKKL
Sbjct: 244 GSVILAGVLLKLGGYGFLRFSLPMFPIASADFAPLIFTLSLIAIIYTSLVALVQNDIKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSSIAHMGYVT+GIFS  + G++GA++QMLSHG+VS+ALF CVGVIYDRLHTR+I A+
Sbjct: 304 IAYSSIAHMGYVTMGIFSANEQGIQGAIYQMLSHGIVSAALFLCVGVIYDRLHTREISAF 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+NMP+YAVV ++FTMAN+GLPG+SGF+GEFL ++ VFQ +  V VLA+ GV+LSA 
Sbjct: 364 GGLVNNMPKYAVVFLIFTMANVGLPGSSGFLGEFLTLIGVFQVNKLVVVLATTGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+L+LYR+VVFG    E ++ L DLSLRE+ ++YP+ +LT+FFGIYP PI    +  + +
Sbjct: 424 YALYLYRRVVFGSLDKENLKVLIDLSLREKFILYPMVILTIFFGIYPTPILKATAFSVET 483

Query: 483 IIEN 486
           +I  
Sbjct: 484 LINK 487


>gi|319407255|emb|CBI80894.1| NADH dehydrogenase I chain M [Bartonella sp. 1-1C]
          Length = 489

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 372/486 (76%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS V FLP +GVF+IL         +R+   VA   +   FI SL +W+ FD   S
Sbjct: 3   DWPILSTVIFLPLVGVFLILLIKDDSEVAKRNIRNVAFFTTVFVFIISLVIWAGFDTTNS 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E +HW+    SYH+G+DGIS+L VVL+ FL PFCIL+SW +IQ+  ++YMIAFL+
Sbjct: 63  DFQMVEKFHWLGSGISYHVGIDGISVLFVVLSAFLLPFCILASWDAIQDRLKDYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  +IG F +LD +LFYIFFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LEIAIIGVFCALDAILFYIFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVLMLV 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VM WE  T  I  L    +F   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMVMYWEAGTLDIPTLLTY-QFNTHMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF LP+FP+AS  FA ++F LSLIAIIY SLV++VQ+DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGFIRFSLPMFPIASADFASLVFTLSLIAIIYTSLVALVQSDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMGYVT+GIFS  + G++GA++QMLSHG+VS+ALF CVGVIY+RLHTR+I 
Sbjct: 302 KLIAYSSVAHMGYVTMGIFSANEQGIQGAIYQMLSHGIVSAALFLCVGVIYNRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGFIGEFL ++ VFQ +  VAV A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVVFLIFTMANIGLPGSSGFIGEFLTLIGVFQVNKLVAVFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+L+LYR++VFG  + E ++ L DLS  E+  +YP+ ++ +FFG+YP PI  T    +
Sbjct: 422 AAYALYLYRRIVFGSLEKENLKVLLDLSPIEKFTLYPMVIIIIFFGVYPTPILKTTMSAV 481

Query: 481 SSIIEN 486
            S+I  
Sbjct: 482 ESLINQ 487


>gi|254500852|ref|ZP_05113003.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Labrenzia alexandrii DFL-11]
 gi|222436923|gb|EEE43602.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Labrenzia alexandrii DFL-11]
          Length = 505

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 370/489 (75%), Gaps = 2/489 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           ++ P LS+ TFLP LGV FV++ S      +     VAL  + + F  SL +W+ FD   
Sbjct: 2   IDWPILSLTTFLPLLGVVFVLMVSGNDDQAKGQMRMVALVTTGMTFGLSLVIWAFFDYSN 61

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    SY +GVDGIS+L VVLT FL PFCIL+SWKS+Q   REYM+AFL
Sbjct: 62  PGFQFVEERDWLGSNISYKMGVDGISLLFVVLTAFLMPFCILASWKSVQNRVREYMVAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD+++FY+FFEA LIPMF+IIGVWGG+ R+YA+YKFFLYT  GS+ ML
Sbjct: 122 ILETLMIGVFCALDIVVFYVFFEAGLIPMFLIIGVWGGARRVYASYKFFLYTLLGSVLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ M W   T+ I +L  + +FP  +Q W+WIAFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 182 VAIMAMYWTAGTTDIQELL-VYQFPPEMQTWLWIAFFASFAVKMPMWPVHTWLPDAHVEA 240

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAG++LK+GGYG +RF LP+FPLAS  FAP+++ LS++AIIY SLV++ Q DI
Sbjct: 241 PTAGSVILAGVLLKLGGYGFLRFSLPMFPLASDMFAPLVYTLSVVAIIYTSLVALAQEDI 300

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVT+GIF+    GV+G +FQMLSHG+VS ALF CVGVIYDR+HTR+I
Sbjct: 301 KKLIAYSSVAHMGYVTLGIFTMTPQGVQGGIFQMLSHGIVSGALFLCVGVIYDRMHTREI 360

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP+YAV  ++FTMAN+GLPGTSGF+GE LV++  FQ +  VAV A+ GV+L
Sbjct: 361 SAYGGLVNRMPKYAVAFLIFTMANVGLPGTSGFVGEILVLIGAFQVNTWVAVFATLGVIL 420

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+L+LYR+VVFG    E ++ + DL LRE+ ++ P+ +LT+FFG YP+ I D     
Sbjct: 421 SACYALYLYRRVVFGSLDKESLKSILDLDLREKVILVPMIILTIFFGFYPMAILDVTQGS 480

Query: 480 LSSIIENYT 488
           + ++I  YT
Sbjct: 481 VDNLINQYT 489


>gi|163868361|ref|YP_001609570.1| NADH dehydrogenase subunit M [Bartonella tribocorum CIP 105476]
 gi|161018017|emb|CAK01575.1| NADH dehydrogenase I chain M [Bartonella tribocorum CIP 105476]
          Length = 489

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/487 (57%), Positives = 373/487 (76%), Gaps = 2/487 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           ++ P LS VTFLP +GV +ILF        R +   VA   +   FI SL +W  FD   
Sbjct: 2   IDWPILSTVTFLPLVGVLLILFIKDDSEVARHNIRNVAFFTTIFVFIISLIIWIGFDSTN 61

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            +FQM+E ++W+    SYH+GVDGISIL +VL+ FL PFCIL+SW++++E  + YMIAFL
Sbjct: 62  PNFQMVEKFNWLGNGISYHMGVDGISILFIVLSAFLLPFCILASWENVKERLKAYMIAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE  +IG F +LD +LFY+FFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ ML
Sbjct: 122 LLEVAIIGVFCALDAILFYVFFEGSLIPMFIIIGVWGGARRVYASIKFFLYTLLGSVLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ M W+  T  I  L    +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 182 VALMAMYWQAGTLDIPTLLNY-QFPAHMQMWLWLAFFASFAVKMPMWPVHTWLPDAHVEA 240

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAG++LK+GGYG +RF LP+FP+AS  FAP +F LSLIAIIY SLV++VQ+DI
Sbjct: 241 PTAGSVILAGVLLKLGGYGFLRFSLPMFPIASADFAPFVFTLSLIAIIYTSLVALVQSDI 300

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSIAHMGYVT+GIF+  + G++GA++QMLSHG+VS+ALF CVGVIYDRLHTR+I
Sbjct: 301 KKLIAYSSIAHMGYVTMGIFAANEQGIQGAIYQMLSHGIVSAALFLCVGVIYDRLHTREI 360

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            A+GGLV+NMP+YAVV ++FTMAN+GLPGTSGF+GEFL ++ VFQ +  + VLA+ GV+L
Sbjct: 361 SAFGGLVNNMPKYAVVFLIFTMANVGLPGTSGFLGEFLTLIGVFQVNKLIVVLATTGVIL 420

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+L+LYR+VVFG    E ++ L DLS RE+ ++YP+ +L +FFGIYP P+    +  
Sbjct: 421 SAAYALYLYRRVVFGSLDKENLKVLIDLSSREKFILYPMVILIIFFGIYPTPLLKVTAFS 480

Query: 480 LSSIIEN 486
           + ++I  
Sbjct: 481 VEALINK 487


>gi|49474189|ref|YP_032231.1| NADH dehydrogenase subunit M [Bartonella quintana str. Toulouse]
 gi|49239693|emb|CAF26068.1| NADH dehydrogenase I, M subunit [Bartonella quintana str. Toulouse]
          Length = 489

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/489 (57%), Positives = 375/489 (76%), Gaps = 8/489 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF----SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           + P LS VTFLP +GV +ILF    S    C  R+   VA   +   FI SL +W+ FD 
Sbjct: 3   DWPILSTVTFLPLVGVILILFIKDDSESARCNIRN---VAFFTTVFVFIISLIIWAGFDH 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
               FQM+E ++W+    SYH+G+DGISIL VVL+ FL PFCIL+SW++I+++ + YMIA
Sbjct: 60  TNPHFQMVEKFNWLGEGTSYHMGIDGISILFVVLSAFLLPFCILASWENIKDSLKAYMIA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE  +IG F +LD +LFY+FFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ 
Sbjct: 120 FLLLEVAIIGVFCALDAILFYVFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVL 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML AI+VM  E  T  I  L    +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 180 MLVAIMVMYLEAGTLDIPTLLTY-QFPAHMQMWLWLAFFASFAVKMPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LK+GGYG +RF LP+FP+AS  FAP++F LSLIAI+Y SLV++VQ 
Sbjct: 239 EAPTAGSVILAGVLLKLGGYGFLRFSLPMFPIASTAFAPLVFVLSLIAILYTSLVALVQN 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSSIAHMGYVT+GIF+  + G++GA++QMLSHG+VS+ALF CVGVIYDRLHTR
Sbjct: 299 DIKKLIAYSSIAHMGYVTMGIFAANEQGIQGAIYQMLSHGIVSAALFLCVGVIYDRLHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I A+GGLV+NMP+YAVV ++FTMAN+GLPG+SGF+GEFL ++ VFQ +  V + A+ GV
Sbjct: 359 EISAFGGLVNNMPKYAVVFLIFTMANIGLPGSSGFLGEFLTLIGVFQVNKLVVIFATTGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA Y+L+LYR+VVFG    E ++ L DLS RE+ ++YP+ ++T+FFGIYP P+    +
Sbjct: 419 ILSAAYALYLYRRVVFGSLDKENLKILIDLSSREKIILYPMVIITIFFGIYPTPVLKATA 478

Query: 478 VPLSSIIEN 486
             + ++I  
Sbjct: 479 FSVEALINK 487


>gi|300023441|ref|YP_003756052.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525262|gb|ADJ23731.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 495

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/482 (56%), Positives = 372/482 (77%), Gaps = 4/482 (0%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS++TFLP +G  +I   +     +++   +AL  + + F  SL +W  FD  +S FQ +
Sbjct: 5   LSVITFLPLVGALLIAVQN--AEAKQNARWIALWTTLVTFAVSLLIWWNFDTTQSGFQFV 62

Query: 66  EYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMV 125
           E + W+     Y LGVDGIS+L ++LTTFL P CIL+SW S++   +EYMIAFLVLE+++
Sbjct: 63  EEHAWLGSL-KYKLGVDGISMLFIILTTFLMPLCILASWVSVENRVKEYMIAFLVLETLM 121

Query: 126 IGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVM 185
           +G F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML A++ M
Sbjct: 122 LGVFSALDLVLFYLFFEGGLIPMFIIIGVWGGKRRVYASFKFFLYTLLGSVLMLLAMMAM 181

Query: 186 CWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSV 245
            W   T+ I  L   +KFP  +Q+W+WIAFF SFA+K+PM+P HTWLP+AHV+APTAGSV
Sbjct: 182 YWHAGTTDIPTLL-QTKFPPDMQWWLWIAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSV 240

Query: 246 FLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAY 305
            LAGI+LKMGGYG +RF LP+FP AS   AP++F LS+IAIIY SLV++VQ D+KKLIAY
Sbjct: 241 ILAGILLKMGGYGFLRFSLPMFPNASADLAPLVFSLSIIAIIYTSLVALVQEDMKKLIAY 300

Query: 306 SSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGL 365
           SS+AHMGYVT+GIF+G + G++GA+FQMLSHGLVSSALF CVGVIYDR+HTR+I AYGGL
Sbjct: 301 SSVAHMGYVTMGIFTGSQQGIDGAIFQMLSHGLVSSALFLCVGVIYDRMHTREISAYGGL 360

Query: 366 VHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSL 425
           V  MP+YAV  M+FTMAN+GLPGTSGFIGEFL +M+ F+++  VA+LA+ G++LSA Y+L
Sbjct: 361 VERMPKYAVAFMIFTMANVGLPGTSGFIGEFLTLMAAFKSNTWVAILATTGIILSAAYAL 420

Query: 426 WLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIE 485
           +LYR+VVFGV +   ++ + DLS RE  ++ P+ +LT+++G YP P+ D  +  + ++++
Sbjct: 421 YLYRRVVFGVLEKANLRSILDLSPREIAILAPLILLTIYYGFYPAPVLDVTAASVKNLVQ 480

Query: 486 NY 487
           NY
Sbjct: 481 NY 482


>gi|49475646|ref|YP_033687.1| NADH dehydrogenase subunit M [Bartonella henselae str. Houston-1]
 gi|49238453|emb|CAF27681.1| NADH dehydrogenase I, M subunit [Bartonella henselae str.
           Houston-1]
          Length = 489

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/486 (58%), Positives = 372/486 (76%), Gaps = 2/486 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +GV +ILF        R +   VA   +   FI SL +W+ FD   +
Sbjct: 3   DWPILSTVTFLPLVGVILILFIKDDSEAARYNIRNVAFFTTVFVFIISLIIWAGFDYTNA 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E ++W+    SYH+GVDGISIL VVL+ FL PFCIL+SW++I++  + YMIAFL+
Sbjct: 63  HFQMVEKFNWLGGGISYHMGVDGISILFVVLSAFLLPFCILASWENIKDRLKAYMIAFLL 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  +IG F +LD +LFY+FFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LEVAIIGVFCALDAILFYVFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVLMLV 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VM WE  T  I  L    +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMVMYWETGTLDIPTLLNY-QFPAHMQIWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG +RF LP+FPLAS  FAP++F LS+ AIIY SLV++VQ DIK
Sbjct: 242 TAGSVILAGVLLKLGGYGFLRFSLPMFPLASADFAPLVFTLSVSAIIYTSLVALVQNDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVT+GIF+  +  ++GA++QMLSHG+VS+ALF CVGVIYDRLHTR+I 
Sbjct: 302 KLIAYSSIAHMGYVTMGIFAANEQAIQGAIYQMLSHGIVSAALFLCVGVIYDRLHTREIS 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           A+GGLV+NMP+YAV+ ++FTMAN+GLPG+SGF+GEFL ++ VFQ +  V + A+ GV+LS
Sbjct: 362 AFGGLVNNMPKYAVIFLIFTMANVGLPGSSGFLGEFLTLIGVFQVNKLVVIFATTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+L+LYR+VVFG    E ++ L DLS RE+ ++YP+ +LT+FFGIYP PI    +  +
Sbjct: 422 AAYALYLYRRVVFGSLDKENLKVLIDLSSREKFILYPMVILTIFFGIYPTPILKATAFSV 481

Query: 481 SSIIEN 486
            ++I  
Sbjct: 482 KALINK 487


>gi|121602023|ref|YP_989082.1| NADH dehydrogenase subunit M [Bartonella bacilliformis KC583]
 gi|120614200|gb|ABM44801.1| NADH dehydrogenase (quinone), M subunit [Bartonella bacilliformis
           KC583]
          Length = 489

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 281/478 (58%), Positives = 367/478 (76%), Gaps = 8/478 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF----SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           + P LS VTFLP +GV +ILF    S    C  R+   VA   +   F  SL +W  FD 
Sbjct: 3   DWPILSTVTFLPLVGVILILFIKDNSEAEKCNIRN---VAFFTTVFVFFISLIIWVSFDN 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             S+FQM+E + W+    SYH+G+DGISIL VVL+ FL PFC+L+SW+++++  + YMIA
Sbjct: 60  TNSNFQMVEKFDWLGSGISYHMGIDGISILFVVLSAFLLPFCVLASWETVKDRLKAYMIA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE  +IG F SLD +LFYIFFE SLIPMF+IIGVWGG+ R+YA+ KFFLYT  GS+ 
Sbjct: 120 FLLLEVAIIGVFCSLDAVLFYIFFEGSLIPMFIIIGVWGGARRVYASMKFFLYTLLGSVL 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML AI+ M WE  T  I  L    +FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 180 MLVAIMAMYWEAGTLDIPTLLNY-QFPISMQMWLWLAFFASFAVKMPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LK+GGYG +RF LP+FP+AS  F+P +  LSLIAIIY SLV++VQ 
Sbjct: 239 EAPTAGSVILAGVLLKLGGYGFLRFSLPMFPVASVDFSPFVLVLSLIAIIYTSLVALVQN 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA++QMLSHG+VS+ALF CVGVIYDRLHTR
Sbjct: 299 DMKKLIAYSSVAHMGYVTMGIFAANEQGVQGAIYQMLSHGIVSAALFLCVGVIYDRLHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I A+GGLV+NMP+YAVV ++ TMAN+GLPGTSGF+GEFL ++ VFQ +  VA+  + GV
Sbjct: 359 EISAFGGLVNNMPKYAVVFLILTMANVGLPGTSGFLGEFLTLIGVFQINKLVAIFTTTGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           +LSA Y+L+LYR+V++G    E ++ L DLS RE+ ++YP+ +LT+FFGIYP PI  T
Sbjct: 419 ILSAAYALYLYRRVIWGTLDKESLKILCDLSQREKFLLYPMIILTIFFGIYPTPIFQT 476


>gi|307942131|ref|ZP_07657482.1| NADH-quinone oxidoreductase subunit m [Roseibium sp. TrichSKD4]
 gi|307774417|gb|EFO33627.1| NADH-quinone oxidoreductase subunit m [Roseibium sp. TrichSKD4]
          Length = 506

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 284/499 (56%), Positives = 375/499 (75%), Gaps = 2/499 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           ++ P LSIVTFLP LGV F+++        + +   VAL  +   F  SL +W  FD   
Sbjct: 2   LDFPILSIVTFLPLLGVVFLMIVPGNDDGAKGAMRMVALVTTLFTFATSLAIWYFFDYTN 61

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    +Y +GVDGIS+L V+LTTFL PFCIL+SW+S+Q+  REYMIAFL
Sbjct: 62  PGFQFVESREWLGGNINYKMGVDGISVLFVILTTFLMPFCILASWESVQKRVREYMIAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD++LFYIFFEA LIPMF+IIGVWGG+ R+YA+YKFFLYT  GS+ ML
Sbjct: 122 ILETLMIGVFCALDLVLFYIFFEAGLIPMFLIIGVWGGARRVYASYKFFLYTLLGSVLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ M WE  T+ I  L   S FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 182 IAIMAMYWEVGTTDIPALMDHS-FPGGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEA 240

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAGI+LK+GGYG +RF LP+FPLAS  FAP++F LS+IAI+Y SLV++ Q DI
Sbjct: 241 PTAGSVILAGILLKLGGYGFLRFSLPMFPLASDMFAPLVFTLSVIAIVYTSLVALAQEDI 300

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVT+GIF+    G++G +FQMLSHG+VS ALF CVGVIYDR+HTR+I
Sbjct: 301 KKLIAYSSVAHMGYVTMGIFTMTPQGIQGGVFQMLSHGIVSGALFLCVGVIYDRMHTREI 360

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP+YAV  ++FTMAN+GLPGTSGF+GE L +M  FQ +  VAV+A+ GV+L
Sbjct: 361 SAYGGLVNRMPKYAVAFLIFTMANVGLPGTSGFVGEILTLMGAFQVNTWVAVIATSGVIL 420

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+L+LYR+VVFG    E ++ + DL  RE+ ++ P+ +LT+FFG+YP+ I D     
Sbjct: 421 SAAYALYLYRRVVFGELNKESLKSILDLDFREKAILLPLIILTIFFGVYPMAILDVTQGS 480

Query: 480 LSSIIENYTLKTGYSDSVK 498
           + ++I +YT     + SV+
Sbjct: 481 VDNLINHYTAALEAAGSVQ 499


>gi|154248540|ref|YP_001419498.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Xanthobacter autotrophicus Py2]
 gi|154162625|gb|ABS69841.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Xanthobacter autotrophicus Py2]
          Length = 503

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/499 (55%), Positives = 372/499 (74%), Gaps = 9/499 (1%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+VTFLP +G +F+++         R+   VAL  + + F+ SL +   FD   S
Sbjct: 3   DWPILSVVTFLPLVGALFILVVRGDDEVTARNARWVALWTTLVTFVVSLLLLPGFDSAAS 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W+    +YH+GVDGIS+  V+LTTFL PFCIL+SW+S+ +  +EYMIAFLV
Sbjct: 63  GFQFVEKKAWLGELAAYHMGVDGISLPFVILTTFLMPFCILASWESVHKRVKEYMIAFLV 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD++LFY FFE  LIPMF+IIG+WGG  RIYAA+KFFLYT  GS+ M+ 
Sbjct: 123 LETLMIGTFCALDLVLFYFFFEGGLIPMFLIIGIWGGQRRIYAAFKFFLYTLAGSVLMML 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ +  L     FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQSGTTDVPTLLT-HGFPSGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LKMGGYG +R+ LP+FP AS YFAP++F LS++AIIY SLV++VQ DIK
Sbjct: 242 TAGSVILAGVLLKMGGYGFLRYSLPMFPEASHYFAPLVFTLSVVAIIYTSLVALVQEDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMG+VT+GIF+  + G++GAMF M+SHG VS ALF CVGVIYDRLHTR+I 
Sbjct: 302 KLIAYSSIAHMGFVTMGIFAMNEQGLQGAMFLMISHGFVSGALFLCVGVIYDRLHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLVH MP YA V+M+FTMAN+GLPGTSGFIGEFL +++ F+ +  +A  A+ GV+LS
Sbjct: 362 AYGGLVHRMPLYATVLMIFTMANVGLPGTSGFIGEFLTMLAAFERNTWIAFFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LWLY +V+FG  + EK++ + DLS RE  ++ P+ +LT+ FG++P PI +  S  +
Sbjct: 422 AGYALWLYLRVIFGPLEKEKLKTMMDLSPREIVIMVPLVILTILFGVWPAPILNMTSHAV 481

Query: 481 SSIIENYTLKTGYSDSVKG 499
           ++++         +DSV G
Sbjct: 482 NAVVAR-------TDSVAG 493


>gi|154253653|ref|YP_001414477.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Parvibaculum lavamentivorans DS-1]
 gi|154157603|gb|ABS64820.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Parvibaculum lavamentivorans DS-1]
          Length = 514

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 371/496 (74%), Gaps = 4/496 (0%)

Query: 6   LSIVTFLPFLGVFVILFS--SYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LS++TFLP +G  VIL +        R + + VAL  +   F+ SL++W  FD   + FQ
Sbjct: 7   LSLITFLPLIGALVILATRGDEATVARNARY-VALWTTGATFLVSLYIWWKFDPTTADFQ 65

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            ++   W+    +YH+GVDGIS+L V+LTTFL P CIL+SW SI    +EYMIAFLVLE+
Sbjct: 66  FVQQTEWLGGAINYHMGVDGISMLFVILTTFLMPACILASWTSINTRVKEYMIAFLVLET 125

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD++LFY+FFE  LIPMF+IIGVWGG+ RIYA++KFFLYTF GS+ ML AI+
Sbjct: 126 LMIGVFCALDLVLFYLFFEGGLIPMFLIIGVWGGARRIYASFKFFLYTFVGSVLMLLAIM 185

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M W   T+SI  L     FP  +Q+W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAG
Sbjct: 186 AMYWSAGTTSIPVLLE-HDFPAGMQFWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAG 244

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LKMGGYG +RF LP+FP+AS   A ++F LS+IAI+Y SLV++VQ D+KKLI
Sbjct: 245 SVILAGILLKMGGYGFLRFSLPMFPVASADLAWLVFGLSVIAIVYTSLVALVQEDMKKLI 304

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHMG+VT+GIF+  + GV+G +FQMLSHG VS ALF CVGVIYDR+HTR+I AYG
Sbjct: 305 AYSSVAHMGFVTMGIFAANQQGVQGGIFQMLSHGWVSGALFLCVGVIYDRIHTREIAAYG 364

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV+ MP YAV  MVFTMAN+GLPGTSGFIGEFL I+ VF+ +  VA +A+ GV+L+A Y
Sbjct: 365 GLVNRMPLYAVAFMVFTMANVGLPGTSGFIGEFLTILGVFKVNTWVAAIAATGVILAAGY 424

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           +L+LYR+++FGV + + ++ + DL+ RE   + P+   T+FFG+YP PI D  +V + ++
Sbjct: 425 ALYLYRRIIFGVLEKDSLKSIADLNRREVITIAPLLAATIFFGVYPSPIMDVTAVSVENL 484

Query: 484 IENYTLKTGYSDSVKG 499
           + NYT       S +G
Sbjct: 485 VTNYTAAVEAYRSAEG 500


>gi|148255901|ref|YP_001240486.1| NADH dehydrogenase subunit M [Bradyrhizobium sp. BTAi1]
 gi|146408074|gb|ABQ36580.1| NADH dehydrogenase subunit M [Bradyrhizobium sp. BTAi1]
          Length = 502

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/486 (55%), Positives = 360/486 (74%), Gaps = 2/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+VTFLP +G  +I L        RR+   +AL  + I F  S+ +   FD  ++ F
Sbjct: 5   PILSVVTFLPIVGALLIYLVRGDDEAARRNARWIALWTTLITFAVSVLLVLRFDPNQTDF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E  +W+    SYH+GVDGIS+  V+LTT L PFCI++SWKS+    REYM+AFL+LE
Sbjct: 65  QFVEKSNWLAAGISYHMGVDGISLPFVILTTALMPFCIVASWKSVTNRLREYMMAFLILE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMVGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + + W   T+ I  L   +  P S+Q W W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MALYWNAGTTDIPTLMH-TAVPRSLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG +RF LP+FPLAS  FAP+++ LS IAIIY SLV+++Q DIKKL
Sbjct: 244 GSVILAAILLKMGGYGFLRFSLPMFPLASHDFAPLVWTLSAIAIIYTSLVALMQEDIKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVGV+YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAGTMQGVAGGVFQMISHGIVSGALFLCVGVVYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP YA+V MVFTMAN+GLPGTSGF+GEF+ ++  F+ S   A  A+FGV+LSA 
Sbjct: 364 GGLVNRMPIYALVFMVFTMANVGLPGTSGFVGEFMTLLGTFKVSIPTAFFATFGVILSAG 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYRKVVFG      +  +KDL+LRE  +++P+  LT+ FG+YP PI D  +  +  
Sbjct: 424 YALWLYRKVVFGALTKPSLASIKDLTLREGVILFPLVALTILFGVYPKPILDMSAASVQQ 483

Query: 483 IIENYT 488
           ++ NY 
Sbjct: 484 LVNNYN 489


>gi|158423304|ref|YP_001524596.1| proton-translocating NADH-quinone oxidoreductase chain M protein
           [Azorhizobium caulinodans ORS 571]
 gi|158330193|dbj|BAF87678.1| proton-translocating NADH-quinone oxidoreductase chain M protein
           [Azorhizobium caulinodans ORS 571]
          Length = 504

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/477 (57%), Positives = 361/477 (75%), Gaps = 2/477 (0%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           N P LS+VTFLP +G +F+ +         R+   VAL  + + F+ SLF+   FD    
Sbjct: 3   NWPILSVVTFLPLVGALFIFVVRGEDEVAARNARWVALWTTLVTFVVSLFLLPGFDPAAP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W+    +YH+GVDGIS+ LV+L+TFL PFCIL+SW S+++  +EYMI FLV
Sbjct: 63  GFQFVEKKPWLGGIAAYHMGVDGISLSLVILSTFLMPFCILASWDSVKKRVKEYMICFLV 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++++G F +LD++LFY FFEA+LIPMF+IIGVWGG+ RIYA++KFFLYT  GS+ M+ 
Sbjct: 123 LETLMVGTFCALDLVLFYFFFEAALIPMFLIIGVWGGARRIYASFKFFLYTLLGSVLMML 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T+ +  L     FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWKAGTTDVPTLMQYG-FPAGMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LKMGGYG IRF LP+FP AS  FAP+++ LS++AIIY SLV+MVQ DIK
Sbjct: 242 TAGSVILAGVLLKMGGYGFIRFSLPMFPDASHLFAPLVYTLSVVAIIYTSLVAMVQEDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMG+VT+G+FS  ++G++GAMF M+SHG VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSIAHMGFVTMGLFSMNEAGLQGAMFLMISHGFVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV  MP YAV MMVFTMAN+GLPGTSGF+GEFL ++S FQ +  VA  A+ GV+LS
Sbjct: 362 AYGGLVKRMPLYAVAMMVFTMANVGLPGTSGFVGEFLTMLSAFQRNTWVAFFAATGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           A Y+LWLY +V+FG  + E + +LKDL+ RE  ++ P+  LT+ FG +P P+ D  S
Sbjct: 422 AAYALWLYWRVIFGPLEKENLMKLKDLNAREIGIMIPLIALTIIFGFWPAPVLDMTS 478


>gi|163793199|ref|ZP_02187175.1| NADH dehydrogenase subunit M [alpha proteobacterium BAL199]
 gi|159181845|gb|EDP66357.1| NADH dehydrogenase subunit M [alpha proteobacterium BAL199]
          Length = 504

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/501 (55%), Positives = 371/501 (74%), Gaps = 11/501 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGV-----ALGISTINFIFSLFVWSVFD 56
           N P LS+V FLP +GVF IL +     G  +   +     AL IST  F+ SL +W  FD
Sbjct: 4   NAPLLSLVIFLPLVGVFFILLTR----GEEAQVAINCRWQALLISTAVFLVSLLIWYNFD 59

Query: 57  KGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYM 115
              + FQM+E Y WI     +YH+GVDGIS+  V+L+T LTP CIL+SW+++Q   +EYM
Sbjct: 60  PTTADFQMVERYDWIPGSSIAYHVGVDGISMWFVLLSTLLTPICILASWEAVQSRVKEYM 119

Query: 116 IAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGS 175
           IAFLVLE++++G F +LD+L+FY+FFE  LIPMF+IIGVWGG  R+YAA+KFFLYT  GS
Sbjct: 120 IAFLVLETLMVGMFCALDILVFYVFFEGVLIPMFLIIGVWGGQRRVYAAFKFFLYTLGGS 179

Query: 176 IFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           + M+ AI+ M WE  T+ I  L    KF  ++Q W+W+AFF SFA+K+PM+P HTWLP+A
Sbjct: 180 VLMMIAILAMYWEAGTTDIPTLLVF-KFAPALQTWLWLAFFASFAVKVPMWPVHTWLPDA 238

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APTAGSV LAG++LKMGGYG +RF +P+FP AS YFAP++F LS++A+IY SLV++V
Sbjct: 239 HVEAPTAGSVILAGVLLKMGGYGFLRFSIPMFPEASDYFAPLVFALSVVAVIYTSLVALV 298

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KKLIAYSS+AHMG+VTIG+F+    GVEG++FQMLSHG+VS ALF CVGV+YDRLH
Sbjct: 299 QQDMKKLIAYSSVAHMGFVTIGMFTLTTQGVEGSIFQMLSHGVVSGALFLCVGVVYDRLH 358

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           TR+I AYGGL +NMPRYA+V MVFT+A++GLPGTSGF+GE L++   F+ +  +A LA+ 
Sbjct: 359 TREISAYGGLANNMPRYALVFMVFTLASVGLPGTSGFVGELLILTGAFKVNTWLAALAAT 418

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L A Y L+LYR+VVFGV   + V+ + DLS RE  +  P+ VL  + GIYP    D 
Sbjct: 419 GLILGAAYMLYLYRRVVFGVLDKDSVKAMLDLSPREIALFAPLIVLVFWMGIYPSTFIDM 478

Query: 476 FSVPLSSIIENYTLKTGYSDS 496
            SV + ++I NY +  G + +
Sbjct: 479 MSVSVDNLITNYKVALGEAGT 499


>gi|316933905|ref|YP_004108887.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Rhodopseudomonas palustris DX-1]
 gi|315601619|gb|ADU44154.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris DX-1]
          Length = 505

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 357/488 (73%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP LG   V L        RR+   +AL  + I F  SL +   FD   
Sbjct: 6   MTWPVLSVVTFLPVLGAALVYLARGEDEAARRNARWIALWTTLITFAVSLLLVWHFDPAN 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    +YH+G+DGIS+ LV+LTT + PFCI++SW+S+    REYMIAFL
Sbjct: 66  PGFQFVEKAPWLGATITYHMGLDGISLPLVILTTAIMPFCIIASWRSVTVRVREYMIAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 ILETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGIWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ + W   T+ I  L   +  P  +Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYWNAGTTDIPTLM-RTPVPGGLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA I+LKMGGYG +RF LP+FP AS YFAP+I+ LS+IAIIY SLV+++Q DI
Sbjct: 245 PTAGSVVLAAILLKMGGYGFLRFSLPMFPDASAYFAPLIYTLSVIAIIYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV GA+FQM+SHG+VS ALF CVGV+YDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGTTQGVAGAVFQMISHGIVSGALFLCVGVVYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YA+V MVFTMAN+GLPGTSGF+GEFL ++  F+ +   A LA+ GV+L
Sbjct: 365 AAYGGLVNRMPLYALVFMVFTMANVGLPGTSGFVGEFLTLLGTFRVNVPTATLATTGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE  M+ P+ VLT+ FG YP P+ D  +  
Sbjct: 425 SAGYALWLYRKVVFGAMTKPALASIKDLTWREGLMLAPLVVLTILFGFYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++ NY
Sbjct: 485 VQQLVNNY 492


>gi|115524542|ref|YP_781453.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris BisA53]
 gi|115518489|gb|ABJ06473.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris BisA53]
          Length = 505

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 275/490 (56%), Positives = 361/490 (73%), Gaps = 6/490 (1%)

Query: 1   MNLPFLSIVTFLPFLG---VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           M  P LS+VTFLP LG   +FV+  S      +R+   +AL  + + F  SL +   FD 
Sbjct: 6   MTWPILSVVTFLPLLGALAIFVVRGSDE--AAKRNARWIALWATLVTFAVSLILVWRFDP 63

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             + FQ +E   W+     YH+GVDGIS+  V+LTT L PFCI++SW SIQ   REYM+A
Sbjct: 64  TLTDFQFVEKAPWLAAGIGYHMGVDGISLPFVILTTALMPFCIIASWNSIQTRVREYMMA 123

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE+++IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA +KFFLYT  GS+ 
Sbjct: 124 FLILETLMIGTFAALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYATFKFFLYTLLGSVL 183

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML AI+ +     T+ I  L   +  P ++Q W W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 184 MLLAIMALYLNAGTTDIPTLMN-TAVPRNLQTWAWLAFFASFAVKMPMWPVHTWLPDAHV 242

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LA IMLKMGGYG +RF LP+FPLASQ FAP+IF LS+IAI+Y SLV+++Q 
Sbjct: 243 EAPTAGSVVLAAIMLKMGGYGFLRFSLPMFPLASQDFAPLIFTLSVIAIVYTSLVALMQE 302

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMG+VT+GIF+G   GV G++FQM+SHG+VS ALF CVGVIYDR+HTR
Sbjct: 303 DIKKLIAYSSVAHMGFVTMGIFAGTTQGVAGSVFQMISHGIVSGALFLCVGVIYDRMHTR 362

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I AYGGLV+ MP YA+V MVFTMAN+GLPGTSGF+GEFL ++  F+ +   A +AS GV
Sbjct: 363 EIAAYGGLVNRMPLYALVFMVFTMANVGLPGTSGFVGEFLTLIGTFKVNIPTATVASLGV 422

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA Y+LWLYRKVVFG      +  ++DL+ RE   + P+ VLT+ FG+YP P+ D  +
Sbjct: 423 ILSAAYALWLYRKVVFGALVKPSLATIQDLTWREGLTLAPLVVLTILFGVYPKPVLDMSA 482

Query: 478 VPLSSIIENY 487
             ++ +++NY
Sbjct: 483 ASVNLVVQNY 492


>gi|146341101|ref|YP_001206149.1| NADH dehydrogenase subunit M [Bradyrhizobium sp. ORS278]
 gi|146193907|emb|CAL77924.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           (NDH-1, chain M) [Bradyrhizobium sp. ORS278]
          Length = 502

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 270/486 (55%), Positives = 359/486 (73%), Gaps = 2/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+VTFLP +G  +I L        +R+   +AL  + I F  S+ +   FD   + F
Sbjct: 5   PILSVVTFLPLVGALLIYLVRGDDEAAQRNARWIALWTTLITFAVSVILVLRFDPNLTDF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E  +W+    SYH+GVDGIS+  V+LTT L PFCI++SWKS++   REYM+AFL+LE
Sbjct: 65  QFVEKKNWLAAGISYHMGVDGISLPFVILTTALMPFCIIASWKSVKNRLREYMMAFLILE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMVGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + + W   T+ I  L   +  P S+Q W W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MALYWNAGTTDIPTLMH-TAVPRSLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG +RF LP+FPLAS  FAP+++ LS IAIIY SLV+++Q DIKKL
Sbjct: 244 GSVILAAILLKMGGYGFLRFSLPMFPLASHDFAPLVWTLSAIAIIYTSLVALMQEDIKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVGV+YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAGTMQGVAGGVFQMISHGIVSGALFLCVGVVYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP YA+V MVFTMAN+GLPGTSGF+GEF+ ++  F+ S   A  A+FGV+LSA 
Sbjct: 364 GGLVNRMPVYALVFMVFTMANVGLPGTSGFVGEFMTLLGTFKVSIPTAFFATFGVILSAA 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYRKVVFG      +  +KDL+ RE  +++P+  LT+ FG+YP PI D  +  +  
Sbjct: 424 YALWLYRKVVFGALTKPSLASIKDLTWREGMILFPLVALTILFGVYPKPILDMSAASVQQ 483

Query: 483 IIENYT 488
           ++ NY 
Sbjct: 484 LVTNYN 489


>gi|39936003|ref|NP_948279.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris CGA009]
 gi|39649857|emb|CAE28379.1| NADH-ubiquinone dehydrogenase chain M [Rhodopseudomonas palustris
           CGA009]
          Length = 505

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 357/488 (73%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP LG   V L        RR+   ++L  + I F  SL +   FD   
Sbjct: 6   MTWPVLSVVTFLPVLGAALVYLARGEDEAARRNARWISLWTTLITFAVSLLLVWHFDPAN 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    +YH+G+DGIS+ LV+LTT + PFCI++SW+S+    REYMIAFL
Sbjct: 66  PGFQFVEKAPWLGNTITYHMGLDGISLPLVILTTAIMPFCIIASWRSVTVRVREYMIAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 ILETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGIWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ + W   T+ I  L   S  P  +Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYWNAGTTDIPTLMRTS-VPSGLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA I+LKMGGYG +RF LP+FP AS YFAP+I+ LS+IAIIY SLV+++Q DI
Sbjct: 245 PTAGSVVLAAILLKMGGYGFLRFSLPMFPDASAYFAPLIYTLSVIAIIYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV GA+FQM+SHG+VS ALF CVGV+YDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGTTQGVAGAVFQMVSHGIVSGALFLCVGVVYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YA+V MVFTMAN+GLPGTSGF+GEFL ++  F+ +   A LA+ GV+L
Sbjct: 365 AAYGGLVNRMPLYALVFMVFTMANVGLPGTSGFVGEFLTLLGTFRVNIPTATLATTGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE  M+ P+ VLT+ FG YP P+ D  +  
Sbjct: 425 SAGYALWLYRKVVFGAMTKPALASIKDLTWREGLMMAPLLVLTILFGFYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++ NY
Sbjct: 485 VQQLVNNY 492


>gi|192291658|ref|YP_001992263.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris TIE-1]
 gi|192285407|gb|ACF01788.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris TIE-1]
          Length = 505

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/488 (55%), Positives = 357/488 (73%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP LG   V L        RR+   ++L  + I F  SL +   FD   
Sbjct: 6   MTWPVLSVVTFLPVLGAALVYLARGEDEAARRNARWISLWTTLITFAVSLLLVWHFDPAN 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    +YH+G+DGIS+ LV+LTT + PFCI++SW+S+    REYMIAFL
Sbjct: 66  PGFQFVEKAPWLGNTITYHMGLDGISLPLVILTTAIMPFCIIASWRSVTVRVREYMIAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+++IG F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 ILETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGIWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ + W   T+ I  L   S  P  +Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYWNAGTTDIPTLMRTS-VPSGLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA I+LKMGGYG +RF LP+FP AS YFAP+I+ LS+IAIIY SLV+++Q DI
Sbjct: 245 PTAGSVVLAAILLKMGGYGFLRFSLPMFPDASAYFAPLIYTLSVIAIIYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV GA+FQM+SHG+VS ALF CVGV+YDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGTTQGVAGAVFQMVSHGIVSGALFLCVGVVYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YA+V +VFTMAN+GLPGTSGF+GEFL ++  F+ +   A LA+ GV+L
Sbjct: 365 AAYGGLVNRMPLYALVFLVFTMANVGLPGTSGFVGEFLTLLGTFRVNIPTATLATTGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE  M+ P+ VLT+ FG YP P+ D  +  
Sbjct: 425 SAGYALWLYRKVVFGAMTKPALASIKDLTWREGLMMAPLLVLTILFGFYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++ NY
Sbjct: 485 VQQLVNNY 492


>gi|182679340|ref|YP_001833486.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635223|gb|ACB95997.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 507

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/483 (56%), Positives = 361/483 (74%), Gaps = 2/483 (0%)

Query: 6   LSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS + FLP +G +F+ L        R S    AL  + I F  S++ ++ FD   S+FQ+
Sbjct: 7   LSALIFLPLVGALFIALLPGDSEASRSSARWAALITTLITFALSVYAYTQFDPASSAFQL 66

Query: 65  IEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           IE   W      Y LGVDG+SI  +VLT FL PFCIL+SW+SIQ   +EYM+AFL+LES+
Sbjct: 67  IEEKSWFGLGLVYKLGVDGMSIPFLVLTAFLMPFCILASWESIQTRVKEYMVAFLILESL 126

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           ++G F +LD +LFY+FFE SLIPMF+IIG+WGG  RIYA++KFFLYT  GS+ ML A++ 
Sbjct: 127 LLGVFTALDTILFYLFFEGSLIPMFLIIGIWGGPRRIYASFKFFLYTLVGSLLMLLAVMA 186

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           M     T+ I  L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGS
Sbjct: 187 MYGIAGTTDITVLLK-TAFPASMQKWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGS 245

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LAGI+LKMGGYG IRF LP+FP AS YFAP++F LS+IAIIY SLV++VQ DIKKLIA
Sbjct: 246 VILAGILLKMGGYGFIRFSLPMFPEASAYFAPLVFALSVIAIIYTSLVALVQNDIKKLIA 305

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSS+AHMG+VT+G+FS  + GV+GA+FQM+SHG+V+SALF CVGV+YDRLHTRDI AYGG
Sbjct: 306 YSSVAHMGFVTMGLFSMTEQGVQGAIFQMVSHGIVASALFLCVGVVYDRLHTRDIAAYGG 365

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           +V  MPRY    M+FTMAN+GLPGTSGFIGEFL ++  FQ ++TV + A+ GV+ SA Y+
Sbjct: 366 IVERMPRYGTAFMIFTMANVGLPGTSGFIGEFLTMIGTFQINSTVVLFAATGVIFSAAYA 425

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           L+LYR+V+FG  +   ++ L DLS RE  ++ P+ VLT+++G++P PI D  +  + ++I
Sbjct: 426 LYLYRRVLFGALEKANLKTLLDLSGREIALLAPLIVLTLYYGVHPAPILDGCAASVEALI 485

Query: 485 ENY 487
             Y
Sbjct: 486 RGY 488


>gi|86749704|ref|YP_486200.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris HaA2]
 gi|86572732|gb|ABD07289.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris HaA2]
          Length = 505

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/488 (55%), Positives = 356/488 (72%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP +G   V L        RR+   ++L  + I F  SL +   FD   
Sbjct: 6   MTWPVLSVVTFLPLVGAALVYLARGDDEAARRNARWISLWTTLITFAVSLILVWRFDAAD 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+    ++H+GVDGIS+  V+LTT L PFCIL+SWKSI    REYM+AFL
Sbjct: 66  PGFQFVEKAPWLGATIAFHMGVDGISLPFVILTTALMPFCILASWKSITVRVREYMMAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+++IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 VLETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ + W   T+ I  L   +  P ++Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYWTAGTTDIPTLMT-TAIPRNLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA IMLKMGGYG +RF LP+FP AS YFAP++F LS+IAI+Y SLV+++Q DI
Sbjct: 245 PTAGSVVLAAIMLKMGGYGFLRFSLPMFPDASVYFAPLVFSLSVIAIVYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV G++FQM+SHG+VS ALF CVGVIYDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGNTQGVAGSVFQMISHGIVSGALFLCVGVIYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YA V +VFTMAN+GLPGTSGF+GEFL ++  F+ +   A +A+ GV+L
Sbjct: 365 AAYGGLVNRMPIYAFVFLVFTMANVGLPGTSGFVGEFLTLLGTFRVNVPTATIATLGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE  ++ P+ VLT+ FG YP P+ D  +  
Sbjct: 425 SAAYALWLYRKVVFGALTKPALADIKDLTWREGIILAPLVVLTILFGFYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++ NY
Sbjct: 485 VQQLVNNY 492


>gi|209885064|ref|YP_002288921.1| NADH-quinone oxidoreductase subunit m [Oligotropha carboxidovorans
           OM5]
 gi|209873260|gb|ACI93056.1| NADH-quinone oxidoreductase subunit m [Oligotropha carboxidovorans
           OM5]
          Length = 501

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/485 (55%), Positives = 358/485 (73%), Gaps = 2/485 (0%)

Query: 4   PFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS++TFLP +G  ++ L       G+R+   +AL  + INF  SL     FD  +  F
Sbjct: 5   PVLSVITFLPAVGALLVYLVRGDDEAGKRNARWIALWTTLINFAISLVPLLRFDASQPGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q  E+  W+    +YH+GVDGIS+  V+LTT L PF IL+SWKSIQ   REYM+AFLVLE
Sbjct: 65  QFEEHAQWLGAAMNYHMGVDGISLPFVILTTALMPFAILASWKSIQVRVREYMMAFLVLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TLMVGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + +  +  T+ I  L   +K P ++Q W W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MALYAQAGTTDIPTLMT-TKLPHNLQIWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG +RF LP+FPLAS  FAP+++ LS+IAIIY SLV+++Q D+KKL
Sbjct: 244 GSVILAAILLKMGGYGFLRFSLPMFPLASHDFAPLVWTLSVIAIIYTSLVALMQEDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVGVIYDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAGTMQGVAGGVFQMISHGIVSGALFLCVGVIYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP YA   ++FTMAN+GLPGTSGF+GEF+ ++  F+ S   A LA+ GV+LSA 
Sbjct: 364 GGLVNRMPLYAFTFLLFTMANVGLPGTSGFVGEFMTLLGTFKVSVATAFLATIGVILSAG 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYRK+VFG      +  +KD++ RE  +  P+ +LT+ FG+YP P+ D  +  +  
Sbjct: 424 YALWLYRKIVFGELTKPSLASIKDMTGREITLFVPLIILTILFGVYPKPVLDLSAASVHQ 483

Query: 483 IIENY 487
           ++ENY
Sbjct: 484 LVENY 488


>gi|91977343|ref|YP_570002.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris BisB5]
 gi|91683799|gb|ABE40101.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris BisB5]
          Length = 505

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/488 (54%), Positives = 355/488 (72%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLG-CGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP +G  ++  S       RR+   +AL  + I F  SL +   +D   
Sbjct: 6   MTWPVLSVVTFLPVVGAALVYLSRGDDEAARRNARWIALWTTLITFAVSLILLWRYDAAN 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             FQ +E   W+     YH+GVDGIS+  V+LTT L PFCI++SWKS+    REYM+AFL
Sbjct: 66  PGFQFVEKAPWLASGIGYHMGVDGISLPFVILTTALMPFCIIASWKSVTMRVREYMMAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+++IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 VLETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ + W   T+ I  L   +  P ++Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYWTAGTTDIPTLMN-TAVPRNLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA I+LKMGGYG +RF LP+FP AS YFAP+++ LS+IAI+Y SLV+++Q DI
Sbjct: 245 PTAGSVVLAAILLKMGGYGFLRFSLPMFPEASLYFAPLVYALSVIAIVYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV G++FQM+SHG+VS ALF CVGV+YDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGNTQGVAGSVFQMISHGIVSGALFLCVGVVYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YA V +VFTMAN+GLPGTSGF+GEFL ++  F+ +   A +A+ GV+L
Sbjct: 365 AAYGGLVNRMPIYAFVFLVFTMANVGLPGTSGFVGEFLTLLGTFRVNIPTATIATLGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE   + P+ VLT+ FG YP P+ D  +  
Sbjct: 425 SAAYALWLYRKVVFGTLTKPALGTIKDLTWREGITLAPLVVLTILFGFYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++ NY
Sbjct: 485 VQQLVNNY 492


>gi|27380016|ref|NP_771545.1| NADH dehydrogenase subunit M [Bradyrhizobium japonicum USDA 110]
 gi|27353170|dbj|BAC50170.1| NADH dehydrogenase I chain M [Bradyrhizobium japonicum USDA 110]
          Length = 502

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 352/486 (72%), Gaps = 2/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+ TFLP +G  ++ L        RR+   +AL  + I F  S+ +   FD   + F
Sbjct: 5   PILSVTTFLPLVGALIVYLTRGDDEAARRNSRWIALWTTLITFAVSVILVMRFDPSNADF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E  +W+    +YH+GVDGIS+  V+LTT L P CI++SWKS+    REYM+AFL+LE
Sbjct: 65  QFVEKANWLATGITYHMGVDGISLPFVILTTALMPICIIASWKSVTSRVREYMMAFLILE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + ++G F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ ML AI
Sbjct: 125 TFLVGTFAALDLVLFYLFFEGGLIPMFLIIGIWGGPRRVYASFKFFLYTLLGSVLMLLAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + + W   T+ I  L   +  P S+Q W W+AFF SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 MALYWNGATTDIPTLMH-TAVPRSLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LK+GGYG +RF LP+FPLAS  FAP+IF LS+IAIIY SLV+++Q D+KKL
Sbjct: 244 GSVVLAAILLKLGGYGFLRFSLPMFPLASHDFAPLIFTLSVIAIIYTSLVALMQEDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVG++YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTMGIFAGTLQGVAGGVFQMISHGIVSGALFLCVGIVYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV+ MP YA+  MVFTMAN+GLPGTSGF+GEF+ ++  F+ S   A  AS GV+LSA 
Sbjct: 364 GGLVNRMPLYALTFMVFTMANVGLPGTSGFVGEFMTLLGTFKTSIPTAFFASTGVILSAC 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+LWLYRKVVFG      +  +KDL+ RE   ++P+  LT+ FGIYP P+ D     +  
Sbjct: 424 YALWLYRKVVFGTLVKPSLMTIKDLTFRECLTLFPLIALTILFGIYPKPVLDMSEASVQQ 483

Query: 483 IIENYT 488
           ++ NY 
Sbjct: 484 LVNNYN 489


>gi|75676066|ref|YP_318487.1| NADH dehydrogenase subunit M [Nitrobacter winogradskyi Nb-255]
 gi|74420936|gb|ABA05135.1| NADH dehydrogenase subunit M [Nitrobacter winogradskyi Nb-255]
          Length = 502

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 352/486 (72%), Gaps = 3/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVI--LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           P LS+ TFLP +G  +I  +         R+   +AL  + + F  SL + + FD   + 
Sbjct: 5   PILSVTTFLPAVGAILIYVMARGSDEAANRTARWIALWTTIVTFAVSLLLVTRFDPTNTG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQ +E   W+     YH+GVDGIS+  V+LTT L P CI++SWKSI      YM+AFLVL
Sbjct: 65  FQFVEQATWLATGIRYHMGVDGISLPFVILTTALMPLCIIASWKSITRRVPAYMMAFLVL 124

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E+++IG F +LD+LLFY+FFE  LIPMF+IIG+WGG  R+YA +KFFLYT  GS+ ML A
Sbjct: 125 ETLMIGTFSALDLLLFYVFFEGGLIPMFLIIGIWGGPRRVYATFKFFLYTLLGSVLMLLA 184

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           I+ + W   T+ I  L   S  P+++Q W W+AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 185 IMALYWNAGTTDIPTLMQTS-VPYNLQKWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LA IMLKMGGYG +RF LP+FPLAS  FAP++F LS +AI+Y SLV+++Q D+KK
Sbjct: 244 AGSVILAAIMLKMGGYGFLRFSLPMFPLASHDFAPLVFVLSAVAIVYTSLVALMQEDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+GIF+G   G+ G +FQM+SHG+VS ALF CVGV+YDR+HTR+I A
Sbjct: 304 LIAYSSVAHMGFVTMGIFAGTMQGIHGGVFQMVSHGIVSGALFLCVGVVYDRMHTREIAA 363

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGLV+ MP YA+V ++FTMAN+GLPGTSGF+GEFL ++  F+ S   AV A+ GV+LSA
Sbjct: 364 YGGLVNRMPLYALVFLIFTMANVGLPGTSGFVGEFLALIGTFKVSIPTAVAATLGVILSA 423

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LWLYRK+VFG      +  +KDL+ RE   + P+ VLT+ FG+YP P+ D  +  + 
Sbjct: 424 AYALWLYRKIVFGALVKPSLASIKDLTFREGLTLAPLVVLTILFGVYPKPVLDFSAASVQ 483

Query: 482 SIIENY 487
           +++ NY
Sbjct: 484 NLVNNY 489


>gi|144900798|emb|CAM77662.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 504

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/499 (53%), Positives = 366/499 (73%), Gaps = 3/499 (0%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+ TFLP LG +F++          R+   VAL  S   F+ SLF+   FD   +
Sbjct: 3   DWPLLSLTTFLPLLGALFILAIRGEAQVVARNARNVALLTSVATFVVSLFILGYFDAASA 62

Query: 61  SFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ+ E   W+     +Y +GVDGIS+  V+L TFLTP CILSS  ++++  +EYM+AFL
Sbjct: 63  EFQLKESAVWLPGTAITYSMGVDGISVWFVLLATFLTPICILSSVGAVEKRVKEYMVAFL 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+M++G F +LDM+LFY+FFE  L+PMF+IIGVWGG+ R+YAAYK FLYT  GS+ ML
Sbjct: 123 VLETMMVGMFCALDMVLFYVFFEGVLLPMFIIIGVWGGARRVYAAYKLFLYTLLGSVLML 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ M ++ +T+ I  L A S FP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 183 VAMLAMYFDARTTDIPTLMAHS-FPQAMQLWLWLAFFASFAVKVPMWPVHTWLPDAHVEA 241

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAG++LKMG YG IRF +P+FPLA++YF P+++ LS++A+IY SLV++VQ D+
Sbjct: 242 PTAGSVILAGVLLKMGAYGFIRFSVPMFPLATEYFTPLVYTLSIVAVIYTSLVALVQEDM 301

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVTIGIFS    GVEGA++QMLSHG+VS ALF CVGV+YDR+HTR+I
Sbjct: 302 KKLIAYSSVAHMGYVTIGIFSMTTQGVEGALYQMLSHGVVSGALFLCVGVVYDRMHTREI 361

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGGL   MP+YA+V M  TMA++GLPGT GFIGEFLV++ VFQ +  VA+ A+ G+VL
Sbjct: 362 ARYGGLAERMPKYALVFMFMTMASVGLPGTGGFIGEFLVLLGVFQVNTWVALFAATGLVL 421

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+L+LYR+VVFG    + ++ + DLS RE  M  P+ V+ ++ GIYP+   +     
Sbjct: 422 GAAYALYLYRRVVFGRLTRDDLKSILDLSPREVLMFAPLIVIVIWMGIYPITFLEPMHAS 481

Query: 480 LSSIIENYTLKTGYSDSVK 498
           ++ +I+NY L    ++S+ 
Sbjct: 482 VAKLIDNYELARAAAESLS 500


>gi|163850505|ref|YP_001638548.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium extorquens PA1]
 gi|163662110|gb|ABY29477.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium extorquens PA1]
          Length = 527

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/476 (53%), Positives = 352/476 (73%), Gaps = 2/476 (0%)

Query: 12  LPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +P  G  F++         +R+    AL  + + F+ SL  W+ +D    SFQ++E + W
Sbjct: 13  VPLAGAAFILTLGEETAAVKRNARWAALITTVVTFLLSLAAWARYDIASPSFQLVESHAW 72

Query: 71  IDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFL 130
           +     + LGVDG S+ L++LTTFL PFCI +SW S++   +EY +AFLVLE+ +IG F 
Sbjct: 73  LAETIRFKLGVDGFSMPLILLTTFLMPFCIGASWLSVENRVKEYFVAFLVLETTMIGVFC 132

Query: 131 SLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKK 190
           +LD++LFY+FFEA LIPMF+IIG+WGG  RIYA++KFFLYT  GS+ ML AI+ M WE  
Sbjct: 133 ALDLVLFYLFFEAGLIPMFLIIGIWGGKRRIYASFKFFLYTLLGSVLMLLAIMAMYWEAG 192

Query: 191 TSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGI 250
           T+ I  L A  +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGSV LAGI
Sbjct: 193 TTDIPTLLA-HRFPVHMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAGI 251

Query: 251 MLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAH 310
           +LKMGGYG IR  LP+ P AS  FAP++F LS+IAII+ SL +M+QTDIKKLIAYSS+AH
Sbjct: 252 LLKMGGYGFIRISLPMLPDASAQFAPLVFALSVIAIIFTSLTAMMQTDIKKLIAYSSVAH 311

Query: 311 MGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMP 370
           MG+VT+G+F+  + G++GA+F M+SHG+VS ALF CVGV+YDR+HTR+I AYGGLV  MP
Sbjct: 312 MGFVTLGLFTLNEQGIQGALFLMISHGIVSGALFLCVGVVYDRMHTREIAAYGGLVKRMP 371

Query: 371 RYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRK 430
            YA  MMVFTMAN+GLPGTSGF+GEFL +M  F+ + TVA  + FG++LSA Y+LWLY +
Sbjct: 372 LYAAAMMVFTMANVGLPGTSGFVGEFLAMMGAFKANPTVAFFSVFGIILSAGYALWLYAR 431

Query: 431 VVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           V++G      +Q + DL  RE+ ++ P+  LT+++G++P P+ DTF+    ++++N
Sbjct: 432 VIYGKLDKPNLQGILDLDTREKIIIAPLVALTIWYGVHPAPVLDTFAPSTEALVQN 487


>gi|188580273|ref|YP_001923718.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium populi BJ001]
 gi|179343771|gb|ACB79183.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium populi BJ001]
          Length = 527

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/476 (53%), Positives = 353/476 (74%), Gaps = 2/476 (0%)

Query: 12  LPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +P  G  F++         +R+    AL  + + F+ SL  W+ +D    SFQ++E + W
Sbjct: 13  VPLAGAAFILTLGEETAAVKRNARWAALITTVVTFLLSLVAWARYDIASPSFQLVESHAW 72

Query: 71  IDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFL 130
           +     + LGVDG S+ L++LTTFL PFCI +SW S++   +EY +AFLVLE+ +IG F 
Sbjct: 73  LAETIRFKLGVDGFSMPLILLTTFLMPFCIGASWLSVENRVKEYFVAFLVLETTMIGVFC 132

Query: 131 SLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKK 190
           +LD++LFY+FFEA LIPMF+IIG+WGG  RIYA++KFFLYT  GS+ ML AI+ M WE  
Sbjct: 133 ALDLVLFYLFFEAGLIPMFLIIGIWGGKRRIYASFKFFLYTLLGSVLMLLAIMAMYWEAG 192

Query: 191 TSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGI 250
           T+ I  L A  +FP  +Q+W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGSV LAGI
Sbjct: 193 TTDIPTLLA-HRFPVGLQWWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAGI 251

Query: 251 MLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAH 310
           +LKMGGYG IR  LP+ P AS  FAP++F LS+IAII+ SL +M+QTDIKKLIAYSS+AH
Sbjct: 252 LLKMGGYGFIRISLPMLPDASASFAPLVFALSVIAIIFTSLTAMMQTDIKKLIAYSSVAH 311

Query: 311 MGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMP 370
           MG+VT+G+F+  + G++GA+F M+SHG+VS ALF CVGV+YDR+HTR+I AYGGLV  MP
Sbjct: 312 MGFVTLGLFTLNEQGIQGALFLMISHGIVSGALFLCVGVVYDRMHTREIAAYGGLVKRMP 371

Query: 371 RYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRK 430
            YA  MMVFTMAN+GLPGTSGF+GEFL +M  F+ + TVA  + FG++LSA Y+LWLY +
Sbjct: 372 LYAAAMMVFTMANVGLPGTSGFVGEFLAMMGAFRANPTVAFFSVFGIILSAGYALWLYAR 431

Query: 431 VVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           V++G      +Q + DL  RE+ ++ P+  LT+++G++P P+ DTF+    ++++N
Sbjct: 432 VIYGKLDKPNLQGILDLDNREKIIIAPLVALTIWYGVHPAPVLDTFAPSTEALMQN 487


>gi|85717017|ref|ZP_01047979.1| NADH dehydrogenase subunit M [Nitrobacter sp. Nb-311A]
 gi|85696141|gb|EAQ34037.1| NADH dehydrogenase subunit M [Nitrobacter sp. Nb-311A]
          Length = 502

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/486 (53%), Positives = 351/486 (72%), Gaps = 3/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLG--CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           P LS+ TFLP +G  +I   +  G     R+   +AL  + +    SL +   FD   + 
Sbjct: 5   PILSVTTFLPAVGAVLIYVMARGGDEAANRTARWIALWTTIVTLAVSLILVDRFDPANTG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQ +E   W+     YH+GVDGIS+  V+LTT L P CI++SWKSI      YM+AFL+L
Sbjct: 65  FQFVEQATWLATGIRYHMGVDGISLPFVILTTALMPLCIVASWKSIARRVPAYMMAFLIL 124

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E+++IG F +LD+LLFY+FFE  LIPMF+IIG+WGG  R+YA +KFFLYT  GS+ ML A
Sbjct: 125 ETLMIGTFSALDLLLFYVFFEGGLIPMFLIIGIWGGPRRVYATFKFFLYTLLGSVLMLLA 184

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           I+ + W   T+ I  L   +  P+++Q W W+AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 185 IMALYWNAGTTDIPTLM-QTAVPYNLQKWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LA I+LKMGGYG +RF LP+FPLAS  FAP++F LS +AI+Y SLV+++Q D+KK
Sbjct: 244 AGSVILAAILLKMGGYGFLRFSLPMFPLASHDFAPLVFVLSAVAIVYTSLVALMQEDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+GIF+G   G+ G +FQM+SHG+VS ALF CVGV+YDR+HTR+I A
Sbjct: 304 LIAYSSVAHMGFVTMGIFAGTMQGIHGGVFQMVSHGIVSGALFLCVGVVYDRMHTREIAA 363

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGLV+ MP YA+V +VFTMAN+GLPGTSGF+GEFL ++  F+ S   AV A+ GV+LSA
Sbjct: 364 YGGLVNRMPLYALVFLVFTMANVGLPGTSGFVGEFLSLIGTFKVSIPTAVAATLGVILSA 423

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LWLYRK+VFG      +  +KDL+ RE   + P+ VLTV FG+YP P+ D  +  + 
Sbjct: 424 AYALWLYRKIVFGALVKPSLATIKDLTFREGLTLAPLVVLTVLFGVYPKPVLDFSAASVQ 483

Query: 482 SIIENY 487
           +++ NY
Sbjct: 484 NLVNNY 489


>gi|218529202|ref|YP_002420018.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium chloromethanicum CM4]
 gi|240137570|ref|YP_002962041.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           [Methylobacterium extorquens AM1]
 gi|254560041|ref|YP_003067136.1| NADH-quinone oxidoreductase subunit M [Methylobacterium extorquens
           DM4]
 gi|218521505|gb|ACK82090.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium chloromethanicum CM4]
 gi|240007538|gb|ACS38764.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           [Methylobacterium extorquens AM1]
 gi|254267319|emb|CAX23151.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           [Methylobacterium extorquens DM4]
          Length = 527

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/476 (53%), Positives = 352/476 (73%), Gaps = 2/476 (0%)

Query: 12  LPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +P  G  F++         +R+    AL  + + F+ SL  W+ +D    SFQ++E + W
Sbjct: 13  VPLAGAAFILTLGEETAAVKRNARWAALITTIVTFLLSLAAWARYDIASPSFQLVESHAW 72

Query: 71  IDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFL 130
           +     + LGVDG S+ L++LTTFL PFCI +SW S++   +EY +AFLVLE+ +IG F 
Sbjct: 73  LAETIRFKLGVDGFSMPLILLTTFLMPFCIGASWLSVENRVKEYFVAFLVLETTMIGVFC 132

Query: 131 SLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKK 190
           +LD++LFY+FFEA LIPMF+IIG+WGG  RIYA++KFFLYT  GS+ ML AI+ M WE  
Sbjct: 133 ALDLVLFYLFFEAGLIPMFLIIGIWGGKRRIYASFKFFLYTLLGSVLMLLAIMAMYWEAG 192

Query: 191 TSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGI 250
           T+ I  L A  +FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGSV LAGI
Sbjct: 193 TTDIPTLLA-HRFPVHMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAGI 251

Query: 251 MLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAH 310
           +LKMGGYG IR  LP+ P AS  FAP++F LS+IAII+ SL +M+QTDIKKLIAYSS+AH
Sbjct: 252 LLKMGGYGFIRISLPMLPDASAQFAPLVFALSVIAIIFTSLTAMMQTDIKKLIAYSSVAH 311

Query: 311 MGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMP 370
           MG+VT+G+F+  + G++GA+F M+SHG+VS ALF CVGV+YDR+HTR+I AYGGLV  MP
Sbjct: 312 MGFVTLGLFTLNEQGIQGALFLMISHGIVSGALFLCVGVVYDRMHTREIAAYGGLVKRMP 371

Query: 371 RYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRK 430
            YA  MMVFTMAN+GLPGTSGF+GEFL +M  F+ + TVA  + FG++LSA Y+LWLY +
Sbjct: 372 LYAAAMMVFTMANVGLPGTSGFVGEFLAMMGAFKANPTVAFFSVFGIILSAGYALWLYAR 431

Query: 431 VVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           V++G      +Q + DL  RE+ ++ P+  LT+++G++P P+ DTF+    ++++N
Sbjct: 432 VIYGKLDKPNLQGILDLDTREKIIIAPLVALTIWYGVHPAPVLDTFAPSTEALVQN 487


>gi|288958977|ref|YP_003449318.1| NADH dehydrogenase I chain M [Azospirillum sp. B510]
 gi|288911285|dbj|BAI72774.1| NADH dehydrogenase I chain M [Azospirillum sp. B510]
          Length = 508

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/503 (52%), Positives = 367/503 (72%), Gaps = 12/503 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCG------RRSFFGVALGISTINFIFSLFVWSVFDK 57
           P LS  TFLP +GV +IL    L C       RR+   +AL  + + F+ +L +W+ FD 
Sbjct: 5   PILSFATFLPLVGVALIL----LFCRGDSPDVRRNVRYIALWTTLVTFVLTLLIWANFDP 60

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
               +QM+E   WI  F  +YH+GVDGIS+L VVL+ FL P CIL+SW+S+Q   +EYMI
Sbjct: 61  RNPGYQMVEKAGWIPEFGINYHMGVDGISVLFVVLSGFLMPLCILASWESVQVRLKEYMI 120

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL LE+++IG F +LD +LFY+FFE  LIPMF+IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 121 AFLALETLMIGMFCALDFVLFYMFFEGVLIPMFLIIGVWGGPRRVYAAFKFFLYTLLGSV 180

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML AI+ M +   T+ I  + A ++FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AH
Sbjct: 181 LMLLAILAMYYVAGTTDIPTITA-TQFPRGMQLWLWLAFFASFAVKVPMWPVHTWLPDAH 239

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APTAGSV LAG++LKMGGYG +RF +P+ P A++YFAP+I+ LS++A+IY SLV++ Q
Sbjct: 240 VEAPTAGSVILAGVLLKMGGYGFLRFNIPILPEATEYFAPLIYTLSVVAVIYTSLVALAQ 299

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKLIAYSS+AHMG+VTIG+F+  + G+EG++FQMLSHG+VS ALF CVGV+YDRLHT
Sbjct: 300 EDMKKLIAYSSVAHMGFVTIGMFALNQQGIEGSVFQMLSHGVVSGALFLCVGVVYDRLHT 359

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGGLV NMP+YAVV +  TMA++GLPGT+GF+GEFLV+M VF+++  VA LA+ G
Sbjct: 360 REIARYGGLVKNMPKYAVVFLFMTMASVGLPGTAGFVGEFLVLMGVFRDNTWVAALAATG 419

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           +VL A Y+LWLYR++V+G      ++ + D++ RE  +  P+  + ++ GIYP    +  
Sbjct: 420 MVLGAAYALWLYRRIVYGKLTKPDLKAMFDMTPREIAVFLPLIAVVLWMGIYPSSFLNVT 479

Query: 477 SVPLSSIIENYTLKTGYSDSVKG 499
           S  +  +I+ Y  K   S +  G
Sbjct: 480 SASVEQLIQTYQTKLAASHAASG 502


>gi|299135020|ref|ZP_07028211.1| proton-translocating NADH-quinone oxidoreductase, chain M [Afipia
           sp. 1NLS2]
 gi|298589997|gb|EFI50201.1| proton-translocating NADH-quinone oxidoreductase, chain M [Afipia
           sp. 1NLS2]
          Length = 502

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/486 (54%), Positives = 351/486 (72%), Gaps = 3/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVI--LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           P LS+ TFLP  G  ++  L         R+   +AL  + I F  SL +   FD  +  
Sbjct: 5   PVLSVTTFLPVAGAVLLYLLARGNDAVAARNARWIALWTTVITFAVSLVLLLHFDPSQPG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQ +E   W+    +YH+GVDGIS+  V+LTT L PFCIL+SWKSIQ   REYM+AFL L
Sbjct: 65  FQFVEKGQWLGAAINYHMGVDGISLPFVILTTALMPFCILASWKSIQNRVREYMMAFLFL 124

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E+++IG F SLD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML A
Sbjct: 125 ETLMIGTFSSLDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLMLLA 184

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           I+ +  +  T+ I  L   +  P ++Q W W+AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 185 IMALYAKAGTTDIPTLMT-TNLPHNLQRWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LA I+LKMGGYG +RF LP+FPLAS  FAP+++ LS IAI+Y SLV+++Q D+KK
Sbjct: 244 AGSVVLAAILLKMGGYGFLRFSLPMFPLASHDFAPLVWTLSAIAIVYTSLVALMQEDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVGVIYDR+HTR+I A
Sbjct: 304 LIAYSSVAHMGFVTMGIFAGTMQGVAGGVFQMISHGIVSGALFLCVGVIYDRMHTREIAA 363

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGLV+ MP YA   ++FTMAN+GLPGTSGF+GEFL ++  F+ S   A+ A+ GV+LSA
Sbjct: 364 YGGLVNRMPLYAFTFLLFTMANVGLPGTSGFVGEFLTLLGTFKVSVPTAIFATLGVILSA 423

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LWLYRK+VFG      +  +KD++ RE  +  P  VLT+ FG+YP P+ D  +  + 
Sbjct: 424 AYALWLYRKIVFGEMTKASLASIKDMTGREIAIFVPFIVLTILFGVYPKPVLDMSAASIH 483

Query: 482 SIIENY 487
            ++ENY
Sbjct: 484 QLVENY 489


>gi|298291834|ref|YP_003693773.1| proton-translocating NADH-quinone oxidoreductase, chain M [Starkeya
           novella DSM 506]
 gi|296928345|gb|ADH89154.1| proton-translocating NADH-quinone oxidoreductase, chain M [Starkeya
           novella DSM 506]
          Length = 504

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 276/487 (56%), Positives = 361/487 (74%), Gaps = 3/487 (0%)

Query: 2   NLPFLSIVTFLPFLGVF--VILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           + P LS+VTFLP +G    V++        +R+   VAL  + + F+ SL + + FD   
Sbjct: 3   DWPILSVVTFLPLVGALLIVLMIRGDDEVAQRNARWVALWATLVTFVISLLLLAGFDMAG 62

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           + FQ +E+  W+  F +Y +GVDGIS+  ++LTT L P CIL+SW+SI    +EYMI FL
Sbjct: 63  TEFQFVEHRAWLGDFAAYRMGVDGISLPFLLLTTLLMPMCILASWESIHVRVKEYMICFL 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+++IG F SLD+L FYIFFE  LIPMF+IIG+WGG  RIYA +KFFLYT  GS+ M+
Sbjct: 123 VLETLMIGTFASLDLLQFYIFFEGGLIPMFLIIGIWGGKRRIYATFKFFLYTLAGSVLMM 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ M W+  T+ I  L     FP  +QYW+WIAFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 183 LAIMAMYWQAGTTDIAVLLK-HGFPSRMQYWLWIAFFASFAVKMPMWPVHTWLPDAHVEA 241

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LAGI+LKMGGYG +RF LP+FP AS YFAP +F LS+IAI+Y SLV+++Q DI
Sbjct: 242 PTAGSVILAGILLKMGGYGFLRFSLPMFPEASAYFAPFVFTLSVIAIVYTSLVALMQEDI 301

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSIAHMGYVT+GIF+  + G++GA+FQM+SHG VS ALF CVGVIYDR+HTR+I
Sbjct: 302 KKLIAYSSIAHMGYVTMGIFTLTQEGIQGAVFQMVSHGFVSGALFLCVGVIYDRMHTREI 361

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGG+VH MP YA V MVFTMAN+GLPGTSGFIGEFL +++ F  +  VA  A+ GV+L
Sbjct: 362 AAYGGIVHRMPLYATVFMVFTMANVGLPGTSGFIGEFLTLLATFGRNTWVAFFATTGVIL 421

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYR+V+FG  + E ++ L DLS RE   + P+ +LT+ FG++P PI D  +V 
Sbjct: 422 SAAYALWLYRRVIFGALEKESLKGLTDLSGREMLSLVPLLLLTILFGVWPQPILDACNVA 481

Query: 480 LSSIIEN 486
           + +I+  
Sbjct: 482 VGAIVAR 488


>gi|217979061|ref|YP_002363208.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylocella silvestris BL2]
 gi|217504437|gb|ACK51846.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylocella silvestris BL2]
          Length = 503

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/494 (54%), Positives = 362/494 (73%), Gaps = 2/494 (0%)

Query: 6   LSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS + FLP +G  F++           +    A   + I F+ +++ ++ FD   S FQ+
Sbjct: 7   LSCIVFLPLVGAAFILCLRGEDEATLNNARWAAFATTVIVFLLTVYAYAKFDTSLSGFQL 66

Query: 65  IEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           +E   W      Y LGVDG+SI  V+LT FL PFCI +SWKSI    ++YMIAFLVLE+M
Sbjct: 67  VEQKGWFGSGLIYKLGVDGVSIPFVLLTGFLMPFCIAASWKSITYRVKDYMIAFLVLETM 126

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           ++G F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ ML AI+ 
Sbjct: 127 MLGVFCALDLVLFYLFFEGGLIPMFLIIGIWGGKRRVYASFKFFLYTLVGSLLMLLAIMA 186

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           M     T+ I+ L A S FP S+Q W+++AFF S A+K+PM+P HTWLP+AHV+APTAGS
Sbjct: 187 MYGFAGTTDIVQLLATS-FPASMQKWLFLAFFASLAVKMPMWPVHTWLPDAHVEAPTAGS 245

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LAGI+LKMGGYG IRF LP+FP AS YFAP+I+ LS+IAIIY SLV++VQ D+KKLIA
Sbjct: 246 VILAGILLKMGGYGFIRFSLPMFPDASAYFAPLIYALSIIAIIYTSLVALVQEDMKKLIA 305

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSS+AHMG+VT+G+F+  + GV+GAMFQM+SHGLVS ALF CVGV+YDR+HTRDI AYGG
Sbjct: 306 YSSVAHMGFVTMGLFTMTEQGVQGAMFQMISHGLVSGALFLCVGVVYDRMHTRDIAAYGG 365

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           LV  MP YAVV M+FTMAN+GLPGTSGFIGEFL ++  F+ ++ + + A+ GV+LSA Y+
Sbjct: 366 LVARMPLYAVVFMIFTMANVGLPGTSGFIGEFLTLLGGFRVNSWIGLFATTGVILSAAYA 425

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           L+LYR+VVFGV     ++ + DLS RE  +  P+  LT++FG +P P+ D+ +  ++++I
Sbjct: 426 LFLYRRVVFGVLDKPALRNILDLSPREAAIFAPLVALTLYFGFHPKPVLDSSAASVAALI 485

Query: 485 ENYTLKTGYSDSVK 498
           +NY      + + +
Sbjct: 486 QNYDAAIARTRTAE 499


>gi|92117731|ref|YP_577460.1| NADH dehydrogenase subunit M [Nitrobacter hamburgensis X14]
 gi|91800625|gb|ABE63000.1| NADH dehydrogenase subunit M [Nitrobacter hamburgensis X14]
          Length = 502

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 353/486 (72%), Gaps = 3/486 (0%)

Query: 4   PFLSIVTFLPFLGVFVILFSSY--LGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           P LS+VTFLP LG  +I   +        R+   +AL  + + F  SL + + FD     
Sbjct: 5   PILSVVTFLPLLGALLIWLLARGSDDAADRTARWIALWTTVVTFAVSLILVARFDPADPG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQ +E+  W+     YH+GVDGIS+ L++LTT L P CI++SW++I      YMIAFLVL
Sbjct: 65  FQFVEHASWLTTGIRYHMGVDGISLPLLILTTALMPVCIIASWRAISRRVPAYMIAFLVL 124

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E++++G F +LD+LLFY+FFE  LIPMF+IIG+WGG  R+YA +KFFLYT  GS+ ML A
Sbjct: 125 ETLMVGTFSALDLLLFYVFFEGVLIPMFLIIGIWGGPRRVYATFKFFLYTLLGSVLMLLA 184

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           I+ + W   T+ I  L   +  P+++Q W W+AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 185 IMALYWNAGTTDIPTLMR-TAVPYNLQMWAWLAFFASFAVKMPMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LA I+LKMGGYG +RF LP+FPLAS  FAP+IF LS IAIIY SLV+++Q D+KK
Sbjct: 244 AGSVILAAILLKMGGYGFLRFSLPMFPLASHDFAPLIFVLSAIAIIYTSLVALMQDDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVG+IYDR+HTR+I A
Sbjct: 304 LIAYSSVAHMGFVTMGIFAGTMQGVHGGVFQMISHGIVSGALFLCVGIIYDRMHTREIAA 363

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL ++  F+ S   A  A+ G++LSA
Sbjct: 364 YGGLVNRMPLYALVFMTFTMANVGLPGTSGFVGEFLSLIGTFKVSIPTAFAATTGIILSA 423

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LWLYRK+VFG      +  +KDL++RE   + P+ VLT+ FG+YP P+ D  +  + 
Sbjct: 424 AYALWLYRKIVFGALVKPSLATIKDLTVRECLTLMPLFVLTILFGVYPKPVLDLSAASVQ 483

Query: 482 SIIENY 487
           +++ NY
Sbjct: 484 NLVNNY 489


>gi|170742523|ref|YP_001771178.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium sp. 4-46]
 gi|168196797|gb|ACA18744.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium sp. 4-46]
          Length = 506

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 250/457 (54%), Positives = 344/457 (75%), Gaps = 1/457 (0%)

Query: 30  RRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLV 89
           +R+    AL  +   F+ SL  W  +D   ++FQ++E + W+     + LGVDG S+ L+
Sbjct: 32  QRNARWAALAATVATFLLSLVAWGRYDSSTAAFQLVESHAWLTESIRFKLGVDGFSMPLL 91

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           +LTTFL PFCI +SW +I    +EY +AFLVLE+ +IG F +LD++LFY+FFEA LIPMF
Sbjct: 92  LLTTFLMPFCIAASWHAIGHRVKEYFVAFLVLETTMIGVFCALDLVLFYLFFEAGLIPMF 151

Query: 150 VIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQY 209
           +IIG+WGG  RIYA++KFFLYT  GS+ ML AI+ M W+  T+ I  L    +FP  +Q 
Sbjct: 152 LIIGIWGGKRRIYASFKFFLYTLLGSVLMLLAILAMYWQAGTTDIPTLL-QHRFPTGLQT 210

Query: 210 WMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPL 269
           W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGSV LAGI+LKMGGYG IR  LP+FP 
Sbjct: 211 WLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAGILLKMGGYGFIRVSLPMFPD 270

Query: 270 ASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGA 329
           AS  FAP++F LS++AIIY SLV++VQTDIKKLIAYSS+AHMG+VT+G+F+  + G++GA
Sbjct: 271 ASHLFAPLVFALSIVAIIYTSLVALVQTDIKKLIAYSSVAHMGFVTLGLFTMTEQGIQGA 330

Query: 330 MFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGT 389
           +F M+SHG+VS ALF CVGVIYDR+HTR+I AYGGLV+ MP YAV MMVFTMAN+GLPGT
Sbjct: 331 LFLMISHGIVSGALFLCVGVIYDRMHTREIAAYGGLVNRMPLYAVAMMVFTMANVGLPGT 390

Query: 390 SGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSL 449
           SGF+GEFL ++  F+ +  V+  + FG++LSA Y+LWL+ +V++G      ++ + DL  
Sbjct: 391 SGFVGEFLSMLGAFRANPMVSFFSVFGIILSAAYALWLFARVIYGKLDKPSLRDIADLDR 450

Query: 450 RERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           RE  ++ P+ VLT+++G +P PI DTF+    ++++ 
Sbjct: 451 REMAILAPLVVLTIYYGFHPSPILDTFAPSTEALMQG 487


>gi|220924017|ref|YP_002499319.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Methylobacterium nodulans ORS 2060]
 gi|219948624|gb|ACL59016.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium nodulans ORS 2060]
          Length = 506

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 344/457 (75%), Gaps = 1/457 (0%)

Query: 30  RRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLV 89
           +R+    AL  +   F+ SL  W  +D   ++FQ++E + W+     + LGVDG ++ L+
Sbjct: 32  QRNARWAALIATVATFLLSLVAWGRYDSSTAAFQLVESHAWLTESIRFKLGVDGFAMPLL 91

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           +LTTFL PFCI +SW SI    +EY +AFLVLE+ +IG F +LD++LFY+FFEA LIPMF
Sbjct: 92  LLTTFLMPFCIAASWHSIGVRVKEYFVAFLVLETTMIGVFCALDLVLFYLFFEAGLIPMF 151

Query: 150 VIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQY 209
           +IIG+WGG  RIYA++KFFLYT  GS+ ML AI+ M W+  T+ I  L    +FP ++Q 
Sbjct: 152 LIIGIWGGKRRIYASFKFFLYTLLGSVLMLLAILAMYWQAGTTDIPTLL-QHRFPANLQT 210

Query: 210 WMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPL 269
           W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGSV LA I+LKMGGYG IRF LP+FP 
Sbjct: 211 WLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAAILLKMGGYGFIRFSLPMFPD 270

Query: 270 ASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGA 329
           AS  FAP+IF LS++AIIY SLV++ QTDIKKLIAYSS+AHMG+VT+G+F+  + G++GA
Sbjct: 271 ASHLFAPLIFALSIVAIIYTSLVALAQTDIKKLIAYSSVAHMGFVTLGLFTMTEQGIQGA 330

Query: 330 MFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGT 389
           +F M+SHG+VS ALF CVGVIYDR+HTR+I AYGGLV+ MP YAV +MVFTMAN+GLPGT
Sbjct: 331 LFLMISHGIVSGALFLCVGVIYDRMHTREIAAYGGLVNRMPLYAVALMVFTMANVGLPGT 390

Query: 390 SGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSL 449
           SGF+GEFL ++  F+ +  V+  + FG++LSA Y+LWLY +V++G  +   +Q + DL  
Sbjct: 391 SGFVGEFLSMVGAFRTNPMVSFFSVFGIILSAAYALWLYARVIYGKLEKPSLQAITDLDR 450

Query: 450 RERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           RE  ++ P+ VLT+++G +P P+ D F+    ++++ 
Sbjct: 451 REIAILAPLVVLTIYYGFHPSPVLDVFAPSTEALMQG 487


>gi|83592902|ref|YP_426654.1| NADH dehydrogenase subunit M [Rhodospirillum rubrum ATCC 11170]
 gi|83575816|gb|ABC22367.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodospirillum rubrum ATCC 11170]
          Length = 510

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 267/490 (54%), Positives = 356/490 (72%), Gaps = 4/490 (0%)

Query: 1   MN-LPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           MN LP LSI+TFLP +G VF++          R+   VAL  +   F+ SL +W  FD  
Sbjct: 1   MNALPLLSIITFLPLVGAVFILTVKGEEAVVARNARNVALLTTGFTFLVSLGLWFGFDPA 60

Query: 59  RSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
           +S FQ +E   W+ DY  +Y +GVDGIS+L V+L+TFLTP CIL+SW SI +  +EYM+A
Sbjct: 61  QSGFQFVEKVSWLPDYGINYQMGVDGISVLFVLLSTFLTPLCILASWTSITKRVKEYMVA 120

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FLVLE+M++G F +LD ++FY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+ 
Sbjct: 121 FLVLETMMVGMFCALDFVVFYVFFEGVLIPMFLIIGIWGGGRRVYASFKFFLYTLAGSVL 180

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           M+ A++ M  E  T+ I  L +   FP ++Q W+W+A F SFA+K+PM+P HTWLP+AHV
Sbjct: 181 MMVAMLAMYIEAGTTDIPTLMS-HGFPAAMQTWLWLAMFASFAVKVPMWPVHTWLPDAHV 239

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMG YG +RF +P+ PLAS  FAP IF LS+I +IY SLV++VQ 
Sbjct: 240 EAPTAGSVILAGVLLKMGAYGFLRFSIPMLPLASADFAPFIFALSVIGVIYTSLVALVQE 299

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKLIAYSSIAHM +VT GIF+  +  VEGA++QMLSHG+VS ALF CVGV+YDRLHTR
Sbjct: 300 DMKKLIAYSSIAHMAFVTAGIFAVNQMSVEGALYQMLSHGVVSGALFLCVGVVYDRLHTR 359

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGGL  NMPRYA+V MVF MA++GLPGT GFIGEFL++M VFQ S  VA+  + GV
Sbjct: 360 EISRYGGLAKNMPRYALVFMVFMMASIGLPGTGGFIGEFLIMMGVFQISTWVALFIATGV 419

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L A Y L+LYR+V+FG  + E ++ L DL+ RE  +  P+ VL ++ G+YP    D   
Sbjct: 420 ILGAAYMLYLYRRVIFGKLEKEDLKGLLDLNRREVAIFAPLLVLVLWMGVYPSTFLDFMH 479

Query: 478 VPLSSIIENY 487
             ++ ++  Y
Sbjct: 480 TSVADLVSTY 489


>gi|84502628|ref|ZP_01000747.1| NADH dehydrogenase subunit M [Oceanicola batsensis HTCC2597]
 gi|84389023|gb|EAQ01821.1| NADH dehydrogenase subunit M [Oceanicola batsensis HTCC2597]
          Length = 518

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/507 (51%), Positives = 359/507 (70%), Gaps = 15/507 (2%)

Query: 5   FLSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSI TFLP +   +  I        G+R+   VAL  + + FI SLF+   FD   + F
Sbjct: 4   LLSITTFLPAIAALILAIFLRGEDEAGQRNAKWVALIATVLTFIVSLFILVGFDPSDTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW ++    +EYMIAFL+LE
Sbjct: 64  QFVEEREWL-MGLKYKMGVDGISVLFVLLTTFMMPLTIAASW-NVTSRVKEYMIAFLLLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F++LD++LFY+FFEA LIPMF+IIG+WGG  RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKNRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L  +      FS+         Q  +W+AFF SFA+K+PM+P HTW
Sbjct: 182 VAMVADAGTTDIPALLTHEFGSETFSVLGIQIVGGMQTLLWLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   AP++F++S IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPIGSDLLAPLVFWMSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+MVQ D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQMLSHG +S ALF CVGVIY
Sbjct: 302 VAMVQEDMKKLIAYSSVAHMGYVTMGIFTANQQGIDGAIFQMLSHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTRDI AYGGLV+ MP YA++ M+FTMAN+GLPGTSGFIGEFL +M +FQ +  VA+
Sbjct: 362 DRMHTRDIDAYGGLVNKMPAYALIFMLFTMANVGLPGTSGFIGEFLTLMGIFQVNTWVAL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RE+ +  P+  +T+  G+YP  
Sbjct: 422 VATSGVILSAAYALWLYRRVVMGDLIKESLRSITDMTAREKWIFAPLVAMTLLLGVYPSL 481

Query: 472 IRDTFSVPLSSIIENYTLKTGYSDSVK 498
           + D     + ++IE++      +D + 
Sbjct: 482 VTDVIGPSVEALIEDHNTALAAADRLD 508


>gi|83311874|ref|YP_422138.1| NADH dehydrogenase subunit M [Magnetospirillum magneticum AMB-1]
 gi|82946715|dbj|BAE51579.1| NADH:ubiquinone oxidoreductase subunit 4 [Magnetospirillum
           magneticum AMB-1]
          Length = 504

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 266/499 (53%), Positives = 358/499 (71%), Gaps = 3/499 (0%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+ TFLP  G +F++          R+   VAL  S   F+ SLF+ + F+    
Sbjct: 3   DWPLLSLTTFLPLAGALFILTIRGETEVVARNSRNVALLTSIATFVVSLFILAKFNGASP 62

Query: 61  SFQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ+ E   W      +Y +GVDGIS+  V+L+TFLTP CIL+++ S+++  +EYM+AF+
Sbjct: 63  DFQLKETALWFPGTTIAYSMGVDGISMWFVLLSTFLTPICILAAFGSVEKRVKEYMVAFM 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+M+IG F +LD++LFYIFFEA LIPMF+IIGVWGG  R+YAA+KFFLYT  GS+ ML
Sbjct: 123 ILETMMIGMFCALDLVLFYIFFEAVLIPMFIIIGVWGGQRRVYAAFKFFLYTLLGSVLML 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ M ++  T+ I  L A S FPF +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 183 IAMLAMYFDAHTTDIPSLMAHS-FPFKMQLWLWLAFFASFAVKVPMWPVHTWLPDAHVEA 241

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LAG++LKMG YG IRF +P+ P AS YF P+I+ LS++A+IY SLV++VQ D+
Sbjct: 242 PTGGSVILAGVLLKMGAYGFIRFSIPMLPDASVYFTPLIYTLSIVAVIYTSLVALVQDDM 301

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVTIGIFS    GVEGA+FQMLSHG+V+SALF CVGVIYDR+HTR+I
Sbjct: 302 KKLIAYSSVAHMGYVTIGIFSMTTQGVEGAVFQMLSHGIVASALFLCVGVIYDRMHTREI 361

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGGL   MP YAVV M+FTMA++GLPGT+GF+GEFLV+M VFQ +  VA  A+ G+VL
Sbjct: 362 ARYGGLATRMPIYAVVFMLFTMASVGLPGTAGFVGEFLVLMGVFQVNTWVAFFAATGLVL 421

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
              Y L+LYR+VVFG    E ++ + D++ RE  +  P+ VLT++ G+ P    +     
Sbjct: 422 GCTYMLYLYRRVVFGRLTREDLKGILDMTPREIAVFAPLIVLTIWMGVAPGTFLEPMHAS 481

Query: 480 LSSIIENYTLKTGYSDSVK 498
           ++ +I NY L     D + 
Sbjct: 482 VTKLISNYELARAAHDGLS 500


>gi|296444806|ref|ZP_06886769.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylosinus trichosporium OB3b]
 gi|296257754|gb|EFH04818.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylosinus trichosporium OB3b]
          Length = 503

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/494 (53%), Positives = 360/494 (72%), Gaps = 5/494 (1%)

Query: 6   LSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           L+ +TFLP +G  F++          R+    AL  + I F  SL VW  FD   ++FQ+
Sbjct: 7   LTGLTFLPLVGAAFILTLKGEDEATLRNAKWAALLTTVIVFALSLVVWGRFDTASAAFQL 66

Query: 65  IEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           +E   W     +Y +GVDG SI  V+LTTFLTPF IL+SW+S++   +EY++AFLVLE++
Sbjct: 67  VEQRAWFGSGLTYKMGVDGFSIPFVLLTTFLTPFAILASWESVKFRVKEYLVAFLVLETL 126

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           +IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML AI+ 
Sbjct: 127 MIGVFCALDLVLFYLFFEGGLIPMFLIIGVWGGKRRVYASFKFFLYTLAGSLLMLIAILA 186

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           +  +  T+ I  L   ++FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APTAGS
Sbjct: 187 IYGKTGTTDIAVLLE-TQFPPEMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPTAGS 245

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LA I+LKMGGYG IRF LP+FP AS  FAP++F LS+IA+IY SLV++VQ DIKKLIA
Sbjct: 246 VILAAILLKMGGYGFIRFSLPMFPDASAQFAPLVFALSVIAVIYTSLVALVQEDIKKLIA 305

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSSIAHMG+VT+G+F+    G++GAMF M+SHG VS ALF CVGVIYDR+HTR+I AYGG
Sbjct: 306 YSSIAHMGFVTMGLFTMTTQGLQGAMFLMISHGFVSGALFLCVGVIYDRMHTREIAAYGG 365

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           LV+ MP YA   MVFT+AN+GLPGTSGF+GEFL +   F  ++ VA+ A+ GVVLSA Y+
Sbjct: 366 LVNRMPLYAFTFMVFTLANVGLPGTSGFVGEFLTLTGAFVANSWVALFATSGVVLSAAYA 425

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           L+LYR+V+FG      +  + DLS RE  +  P+  LT+++G+ P PI D  +  +++++
Sbjct: 426 LYLYRRVIFGPLDKPSLAAITDLSARELVLFVPLIALTIYYGVQPQPIIDASAASVANLL 485

Query: 485 ENYTLKTGYSDSVK 498
           +++   T  +D++K
Sbjct: 486 QSH---TALADALK 496


>gi|83858402|ref|ZP_00951924.1| NADH dehydrogenase subunit M [Oceanicaulis alexandrii HTCC2633]
 gi|83853225|gb|EAP91077.1| NADH dehydrogenase subunit M [Oceanicaulis alexandrii HTCC2633]
          Length = 515

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 350/493 (70%), Gaps = 9/493 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF------SSYLGCGRRSFFGVALGISTINFIFSLFVWSVF 55
            LP LS +TFLP LG   IL       S       R+  G+AL ++   F  SL +   F
Sbjct: 4   QLPILSAITFLPALGAVAILLLRALMRSEERAVLDRNAKGIALFVTLFVFALSLLMLVEF 63

Query: 56  DKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREY 114
           D G++ FQ +E   W+     SY +GVDGIS+L VVLT FL P CILSSWK + +   +Y
Sbjct: 64  DAGQAGFQFVESLPWLPALGISYKMGVDGISVLFVVLTAFLLPICILSSWK-LDKRVADY 122

Query: 115 MIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFG 174
           M AFL+LE++VIG F +LDM LFYIFFE SLIPMF+IIGVWGG  RIYAA+KFFLYTF G
Sbjct: 123 MAAFLLLETLVIGVFCALDMFLFYIFFEGSLIPMFLIIGVWGGQNRIYAAFKFFLYTFLG 182

Query: 175 SIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPN 234
           S+ ML A++VM  +  T+ I  L A   F   +Q W+W+AFF SFA+K+PM+P HTWLP+
Sbjct: 183 SVLMLAAMIVMFTQVGTTDIEVLLA-HPFARDLQTWLWLAFFASFAVKMPMWPVHTWLPD 241

Query: 235 AHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSM 294
           AHVQAPTAGSV LAGI+LK+GGYG +RF +P+FP AS++FAP++F LS+IAI+  SL++ 
Sbjct: 242 AHVQAPTAGSVILAGILLKLGGYGFLRFSIPMFPNASEFFAPMVFILSIIAIVVTSLIAF 301

Query: 295 VQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRL 354
            QTDIKKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHG++S+ALF C+GVIYDR 
Sbjct: 302 RQTDIKKLIAYSSVAHMGFVTLGIFTMTELGVQGAIFQMLSHGVISAALFLCIGVIYDRF 361

Query: 355 HTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLAS 414
           HTR+I  YGGLVH MP YA V  +F MAN+GLPGTSGFIGE + +   FQ    VA  A+
Sbjct: 362 HTREISFYGGLVHKMPVYAAVFGLFAMANVGLPGTSGFIGEIMTMTGAFQVDPRVAAGAA 421

Query: 415 FGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
            GV+ SA+Y L  Y+KVVFGV    K++   DL+ RE   +  +AVL V+FG +  PI D
Sbjct: 422 LGVIFSAVYMLVAYKKVVFGVVTNPKLEAATDLNAREWINLGVLAVLAVYFGFFSTPITD 481

Query: 475 TFSVPLSSIIENY 487
           T    +  +I++Y
Sbjct: 482 TTRASVDQLIQHY 494


>gi|170748465|ref|YP_001754725.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium radiotolerans JCM 2831]
 gi|170654987|gb|ACB24042.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacterium radiotolerans JCM 2831]
          Length = 506

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 350/460 (76%), Gaps = 3/460 (0%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLT 96
           AL  + + F+ SL  WS +D   SSFQ++E + W+     + LGVDG S+ L++LTTFL 
Sbjct: 39  ALATTVVTFLLSLVAWSRYDAASSSFQLVESHAWLTETIRFKLGVDGFSMPLILLTTFLM 98

Query: 97  PFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWG 156
           PFCI +SW SI    +EY +AFLVLE+ +IG F SLD+LLFY+FFEA LIPMF+IIG+WG
Sbjct: 99  PFCIGASWHSIHFRVKEYFVAFLVLETTMIGVFASLDLLLFYLFFEAGLIPMFLIIGIWG 158

Query: 157 GSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFF 216
           G  RIYA++KFFLYT  GS+ ML A++ M W+  T+ I  L    +FP  +Q W+W+AFF
Sbjct: 159 GQRRIYASFKFFLYTLLGSVLMLLAVMAMYWQAGTTDIPTLL-QYRFPVQMQTWLWLAFF 217

Query: 217 CSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAP 276
            SFA+K+PM+P HTWLP+AHV+APTAGSV LAGI+LKMGGYG IR  LP+ P+ASQ FAP
Sbjct: 218 ASFAVKMPMWPVHTWLPDAHVEAPTAGSVILAGILLKMGGYGFIRISLPMLPVASQEFAP 277

Query: 277 VIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSH 336
            +F LS+IAII+ SL +M+QTDIKKLIAYSS+AHMG+VT+G+F+  + G++GA+F M+SH
Sbjct: 278 FVFALSVIAIIFTSLTAMMQTDIKKLIAYSSVAHMGFVTLGLFTLNEQGIQGALFLMISH 337

Query: 337 GLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEF 396
           G+VS ALF CVGV+YDR+HTR+I AYGGLV  MP YAV M++FTMAN+GLPGTSGF+GEF
Sbjct: 338 GIVSGALFLCVGVVYDRMHTREIAAYGGLVKRMPLYAVAMLIFTMANVGLPGTSGFVGEF 397

Query: 397 LVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVY 456
           L ++  F+ +  VA  ++FG++LSA Y+LWLY +V++G  +   +Q + DL  RE+ ++ 
Sbjct: 398 LAMLGAFKANPNVAFFSTFGIILSAAYALWLYARVIYGKLEKPNLQGILDLDTREKIILA 457

Query: 457 PIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDS 496
           P+ VLT+++G++P P+ D F+    +++ +  +KT  S++
Sbjct: 458 PLVVLTIYYGVHPAPVLDVFAPSTDALMAS--IKTALSNT 495


>gi|255263730|ref|ZP_05343072.1| NADH-quinone oxidoreductase subunit m [Thalassiobium sp. R2A62]
 gi|255106065|gb|EET48739.1| NADH-quinone oxidoreductase subunit m [Thalassiobium sp. R2A62]
          Length = 513

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/504 (52%), Positives = 357/504 (70%), Gaps = 17/504 (3%)

Query: 5   FLSIVTFLPFL--GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSIVTF+P L  G+  +         +R+   VAL  +   F+ SL +   FD   + F
Sbjct: 4   LLSIVTFIPLLAAGILALFLRGDDEAAQRNAKWVALAATATTFLVSLAILGQFDPSDTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   W+     Y +GVDGIS+L V+LTTFL P  I S W  ++   +EYMIAFL+LE
Sbjct: 64  QMVEQRDWL-LGMQYKMGVDGISVLFVMLTTFLMPLVIASCWD-VKHRVKEYMIAFLILE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F +LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMLGVFCALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I+ L  +      F++         Q  MWIAFF SFA+K+PM+P HTW
Sbjct: 182 VSMFADAGTTDIVTLLNHNFGSETFNVLGVQVIGGMQTMMWIAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+AS   AP++ ++S IAI Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVASDLLAPLVLWMSAIAIAYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQQDMKKLIAYSSVAHMGYVTMGIFAANQQGIDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL +M VFQ +  VAV
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLMGVFQVNTWVAV 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 422 IATSGVILSASYGLWLYRRVVMGDLIKESLKSITDMTRRERAIFAPLVVMTLLLGVYPAL 481

Query: 472 IRDTFSVPLSSIIENYTLKTGYSD 495
           + D     + +++ +Y  +T  +D
Sbjct: 482 VTDIIGPSVEALVGSY--ETAVAD 503


>gi|90423917|ref|YP_532287.1| NADH dehydrogenase subunit M [Rhodopseudomonas palustris BisB18]
 gi|90105931|gb|ABD87968.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodopseudomonas palustris BisB18]
          Length = 506

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 268/488 (54%), Positives = 354/488 (72%), Gaps = 2/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M  P LS+VTFLP +G  ++ +        +R+   +AL  + I F  SL + + FD   
Sbjct: 6   MTWPILSVVTFLPLVGALLLLVIRGSDPAAQRNARWIALWTTLITFAVSLILVARFDSSV 65

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           + FQ +E   W+     YH+GVDGIS+  V+LTT L PFCI++SWKSI     EYM+AFL
Sbjct: 66  ADFQFVEKAPWLAAGIGYHMGVDGISLPFVILTTALMPFCIIASWKSITRRVGEYMMAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+++IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+ ML
Sbjct: 126 VLETLMIGTFSALDLVLFYLFFEGGLIPMFLIIGVWGGPRRVYASFKFFLYTLLGSVLML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ +     T+ I  L   +  P S+Q W W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 186 LAIMALYLNAGTTDIPTLM-HTAVPRSLQTWAWLAFFASFAVKMPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGSV LA IMLKMGGYG +RF LP+FP AS  FAP+IF LS+IAI+Y SLV+++Q DI
Sbjct: 245 PTAGSVVLAAIMLKMGGYGFLRFSLPMFPDASHDFAPLIFALSVIAIVYTSLVALMQEDI 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMG+VT+GIF+G   GV G +FQM+SHG+VS ALF CVG++YDR+HTR+I
Sbjct: 305 KKLIAYSSVAHMGFVTMGIFAGTTQGVAGGVFQMVSHGIVSGALFLCVGIVYDRMHTREI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGLV+ MP YAVV MVFTMAN+GLPGTSGF+GEFL ++  F+ +   A +A+ GV+L
Sbjct: 365 SAYGGLVNRMPIYAVVFMVFTMANVGLPGTSGFVGEFLTLLGTFKVNIPTATVATLGVIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA Y+LWLYRKVVFG      +  +KDL+ RE   + P+ +LT+ FG+YP P+ D  +  
Sbjct: 425 SAAYALWLYRKVVFGALVKPSLASIKDLTWRESLTLVPLLILTLLFGVYPKPVLDMSAAS 484

Query: 480 LSSIIENY 487
           +  ++  Y
Sbjct: 485 VQHLVTTY 492


>gi|159043877|ref|YP_001532671.1| NADH dehydrogenase subunit M [Dinoroseobacter shibae DFL 12]
 gi|157911637|gb|ABV93070.1| proton-translocating NADH-quinone oxidoreductase [Dinoroseobacter
           shibae DFL 12]
          Length = 515

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/499 (52%), Positives = 359/499 (71%), Gaps = 15/499 (3%)

Query: 5   FLSIVTFLPFLGVFVI--LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSI+TF+P +   ++           RR+   +AL  +++ FI SLF+ + FD   + F
Sbjct: 4   LLSIITFIPAVAALILALFLRGDDEAARRNAKWLALIATSVTFILSLFLLAGFDPQDTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+    +Y +GVDGISIL V+LTTFL P  I S W +++   +EYMIAFLVLE
Sbjct: 64  QFVEERPWV-LGLTYKMGVDGISILFVMLTTFLMPITIASCW-TVETRVKEYMIAFLVLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMIGVFTALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSI-----------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L        +I           Q  +W+AFF SFA+K+PM+P HTW
Sbjct: 182 VAMYVDAGTTDIPTLLTHQFGTTTIEVLGIHILGGMQVLLWLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+AS   AP++ +LS IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVASDIMAPLVLWLSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQTD+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQTDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA+V M+FTMAN+GLPGTSGF+GEFL ++ VFQ +  VA 
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYALVFMLFTMANVGLPGTSGFVGEFLTLVGVFQVNTWVAF 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VVFG    E ++ + D++LRER +  P+ V+T+  G+YP  
Sbjct: 422 VAATGVILSAGYALWLYRRVVFGDLIKESLKTINDMTLRERAIFAPLIVMTLLLGVYPSL 481

Query: 472 IRDTFSVPLSSIIENYTLK 490
           + D     +  ++  YT +
Sbjct: 482 VTDIIGPSVEGMLTQYTAQ 500


>gi|126736046|ref|ZP_01751790.1| NADH-quinone oxidoreductase chain M [Roseobacter sp. CCS2]
 gi|126714603|gb|EBA11470.1| NADH-quinone oxidoreductase chain M [Roseobacter sp. CCS2]
          Length = 513

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 262/495 (52%), Positives = 354/495 (71%), Gaps = 15/495 (3%)

Query: 6   LSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LS+ TFLP LG  +  +         +R+   VAL  + + FI SLF+ + F+   + FQ
Sbjct: 5   LSLTTFLPLLGAVILALFLRGDDEAAQRNAKWVALVTTAVTFICSLFILANFNPADTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           M+E   W+     Y +GVDGISIL V+LTTFL P  I S W  ++   +EYMIAFL+LE+
Sbjct: 65  MVETREWL-LGLQYKMGVDGISILFVMLTTFLMPLVIASCWD-VKARVKEYMIAFLILET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G FL+LD++LFY+FFEA LIPMF+IIG+WGG  RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFLALDLVLFYLFFEAGLIPMFLIIGIWGGKNRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMS--KFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M     T+ I  L A +     FSI         Q  +W+AFF SFA+K+PM+P HTWL
Sbjct: 183 AMFSAAGTTDIPTLMAFTFETENFSILGVQIIGGMQTLLWLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+   P++  LS IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSEVMGPLVLTLSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIYD
Sbjct: 303 ALVQDDMKKLIAYSSVAHMGYVTMGIFAVNQQGIDGAIFQMISHGFISGALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFLV+M +FQ +  +A+ 
Sbjct: 363 RMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLVLMGIFQVNTWIALF 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA Y+LWLYR+VVFG    E ++ + D+  RER +  P+  +T+  G+YP  +
Sbjct: 423 ATSGVILSAAYALWLYRRVVFGDLIKESLKTITDMGTRERVIFAPLVAMTLLLGVYPALV 482

Query: 473 RDTFSVPLSSIIENY 487
            D     +++++ NY
Sbjct: 483 LDIIGPSVNALVGNY 497


>gi|126461958|ref|YP_001043072.1| NADH dehydrogenase subunit M [Rhodobacter sphaeroides ATCC 17029]
 gi|126103622|gb|ABN76300.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 513

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/500 (51%), Positives = 361/500 (72%), Gaps = 15/500 (3%)

Query: 6   LSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI+TF+P +   +  +         +R+   +AL  ++  F+ SLF+ + FD   + FQ
Sbjct: 5   LSIITFIPLVAALIMALFLRGDDAAAQRNAKWLALLATSATFLVSLFLLAGFDAQDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E Y WI     Y +GVDGISIL V+LTTFL PF I S+W+ ++   +EYMIAFL+LE+
Sbjct: 65  FVESYDWIAGL-QYKMGVDGISILFVMLTTFLMPFTIASAWE-VETRVKEYMIAFLILET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F +LD++LFY+FFEA LIPMF+IIG+WGG +RIYAA+KFFLYTF GS+ ML A++
Sbjct: 123 LMLGVFCALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYAAFKFFLYTFLGSVLMLIAMI 182

Query: 184 VMCWEKKTSSIIDLYA-------MSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M ++  T+ I  L +       M+   F I    Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYYDAGTTDIPTLLSHEFSSGTMTLAGFQIVGGLQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+  +P++F++S IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPIGSELLSPLVFWMSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++ Q+D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQMLSHG +S ALF CVGVIYD
Sbjct: 303 ALAQSDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMLSHGFISGALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGFIGEFL ++ +FQ +  VA++
Sbjct: 363 RMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFIGEFLTLVGIFQVNTWVAMV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA Y LWLYR+VVFG    E ++ ++D+  RE+ +  P+  +T+  G+YP  +
Sbjct: 423 ATSGVILSAAYGLWLYRRVVFGELVKEALRTIRDMDRREKAIFAPLVAMTLLLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENYTLKTG 492
            D     ++ +  +Y   T 
Sbjct: 483 TDIIGPSVARLTTDYQSATA 502


>gi|91761985|ref|ZP_01263950.1| NADH dehydrogenase subunit M [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717787|gb|EAS84437.1| NADH dehydrogenase subunit M [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 497

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 356/488 (72%), Gaps = 3/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           MN P LS +  LP +G   +LFS         +  VAL  S +NF+ SL++W  FD   S
Sbjct: 1   MNFPILSSLILLPVVGSLFLLFSKDKNSNTGKY--VALFTSFVNFLISLYLWYQFDPTTS 58

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W+    +Y +G+DGISIL +VLT  +TP CI+S   ++++  R+++IA LV
Sbjct: 59  DFQFVEDREWLKGIINYKIGIDGISILFIVLTALITPLCIISVNNTVKDRLRDFLIAILV 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +ES++IG F SLD+++FY+FFEA LIPMF+IIG+WGG+ R+Y+A+KFFLYT  GS+ ML 
Sbjct: 119 MESLMIGVFCSLDLVIFYLFFEAGLIPMFLIIGIWGGARRVYSAFKFFLYTLLGSVLMLI 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ + W   T+ I  LY +       Q  +W+AFF SFA+K PM+P HTWLP+AHV+AP
Sbjct: 179 AIISIYWISGTTDITQLYELG-IDTKYQNLLWLAFFSSFAVKTPMWPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I+LKM GYG IRF L LFP+AS  F P+++ LSLIAI+Y SLV+++Q D+K
Sbjct: 238 TAGSVLLAAILLKMAGYGFIRFSLGLFPVASDLFTPLVYALSLIAIVYTSLVALMQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIF+  + G+EG++ QM+SHGLVS+ALF CVGV+YDR+H+R I 
Sbjct: 298 KLIAYSSVAHMGFVTLGIFTITQQGIEGSIVQMISHGLVSAALFLCVGVVYDRMHSRLIA 357

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGLV  MP+Y+++ M+FT+A +GLPGTSGFIGEFL++M  F+++  VAV+AS GV+  
Sbjct: 358 TYGGLVSVMPKYSILFMLFTLAALGLPGTSGFIGEFLILMGAFKDNFLVAVIASLGVIFG 417

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y LWLYR+VVFG  K +++ ++ DL+  E+ +++ +A+  +FFG YP P+ +T  + +
Sbjct: 418 AAYMLWLYRRVVFGEIKNKELLKMPDLNNSEKFILWCLAIPVLFFGFYPEPLINTIEISV 477

Query: 481 SSIIENYT 488
             +IE Y 
Sbjct: 478 KDLIEMYN 485


>gi|71083594|ref|YP_266313.1| NADH dehydrogenase subunit M [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062707|gb|AAZ21710.1| NADH Dehydrogenase I Chain M [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 497

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 356/488 (72%), Gaps = 3/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           MN P LS +  LP +G   +LFS         +  VAL  S +NF+ SL++W  FD   S
Sbjct: 1   MNFPILSSLILLPVVGSLFLLFSKDKNSNTGKY--VALFTSFVNFLISLYLWYQFDPTTS 58

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W+    +Y +G+DGISIL +VLT  +TP CI+S   ++++  R+++IA LV
Sbjct: 59  DFQFVEDREWLKGIINYKIGIDGISILFIVLTALITPLCIISVNNTVKDRLRDFLIAILV 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +ES++IG F SLD+++FY+FFEA LIPMF+IIG+WGG+ R+Y+A+KFFLYT  GS+ ML 
Sbjct: 119 MESLMIGVFCSLDLVIFYLFFEAGLIPMFLIIGIWGGARRVYSAFKFFLYTLLGSVLMLI 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ + W   T+ I  LY +       Q  +W+AFF SFA+K PM+P HTWLP+AHV+AP
Sbjct: 179 AIISIYWISGTTDITQLYELG-IDTKYQNLLWLAFFSSFAVKTPMWPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I+LKM GYG IRF L LFP+AS  F P+++ LSLIAI+Y SLV+++Q D+K
Sbjct: 238 TAGSVLLAAILLKMAGYGFIRFSLGLFPVASDLFTPLVYALSLIAIVYTSLVALMQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIF+  + G+EG++ QM+SHGLVS+ALF CVGV+YDR+H+R I 
Sbjct: 298 KLIAYSSVAHMGFVTLGIFTITQQGIEGSIVQMISHGLVSAALFLCVGVVYDRMHSRLIA 357

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGLV  MP+Y+++ M+FT+A +GLPGTSGFIGEFL++M  F+++  VAV+AS GV+  
Sbjct: 358 TYGGLVSVMPKYSILFMLFTLAALGLPGTSGFIGEFLILMGAFKDNFLVAVIASLGVIFG 417

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y LWLYR+VVFG  K +++ ++ DL+  E+ +++ +A+  +FFG YP P+ +T  + +
Sbjct: 418 AAYMLWLYRRVVFGEIKNKELLKMPDLNNSEKFILWCLAIPVLFFGFYPEPLINTIEISV 477

Query: 481 SSIIENYT 488
             +IE Y 
Sbjct: 478 KDLIEMYN 485


>gi|85703189|ref|ZP_01034293.1| NADH dehydrogenase subunit M [Roseovarius sp. 217]
 gi|85672117|gb|EAQ26974.1| NADH dehydrogenase subunit M [Roseovarius sp. 217]
          Length = 525

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/495 (52%), Positives = 356/495 (71%), Gaps = 15/495 (3%)

Query: 5   FLSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSIVTF+P +   +  +         +R+   VAL  +T+ F+ SLF+   FD   + F
Sbjct: 14  LLSIVTFIPAVAAAILAVFLRGQDAAAQRNAKWVALIATTLTFVVSLFILFQFDPSNTGF 73

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW ++    +EYMIAFL+LE
Sbjct: 74  QMVEEREWL-LGLQYKMGVDGISVLFVMLTTFIMPLTIAASW-TVTTRVKEYMIAFLLLE 131

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+
Sbjct: 132 TLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGRERIYASFKFFLYTFLGSVLMLVAM 191

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I DL  +      FSI         Q  M++AFF SFA+K+PM+P HTW
Sbjct: 192 VAMFSDAGTTDIADLLKHEFESETFSILGVHVIGGMQTLMFLAFFASFAVKMPMWPVHTW 251

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ ++   P++ ++S IAI+Y SL
Sbjct: 252 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGTEVLTPLVLWMSAIAIVYTSL 311

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++ Q D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQM+SHG +S ALF CVGVIY
Sbjct: 312 VALAQEDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMISHGFISGALFLCVGVIY 371

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ VFQ +  VA 
Sbjct: 372 DRMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLVGVFQVNTWVAA 431

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VVFG    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 432 VATSGVILSAAYALWLYRRVVFGDLIKESLRTITDMNKRERAIFAPLVVMTLLLGVYPRL 491

Query: 472 IRDTFSVPLSSIIEN 486
           + D     + ++I N
Sbjct: 492 VTDITGPSVEALISN 506


>gi|294083723|ref|YP_003550480.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663295|gb|ADE38396.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 501

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 265/494 (53%), Positives = 360/494 (72%), Gaps = 9/494 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF----SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           N P L+I+TFLP  GV  +L        +    RS   V L I+  NFI SL +   FD 
Sbjct: 4   NWPLLTIITFLPLAGVIFLLMIRGDDEIVANNARS---VTLWITGFNFIVSLSLLLGFDS 60

Query: 58  GRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
             + +Q  E+  W+ +   +YH+GVDGIS+  V+L+TFLTP  +L+SW++I    REYMI
Sbjct: 61  NVAGYQFEEFAEWLPNTGINYHMGVDGISMPFVLLSTFLTPLAVLASWRAISHRVREYMI 120

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFLVLE+M+IG F+SLDML+FY+FFEA LIPMF+IIG+WGG+ R+YAA+KFFL+T  GS+
Sbjct: 121 AFLVLETMMIGMFVSLDMLMFYLFFEAVLIPMFLIIGIWGGARRVYAAFKFFLFTLLGSV 180

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML  ++ M  +  T+ I  L A S F   +Q+W+++ FF SFA+K+PM+P HTWLP+AH
Sbjct: 181 LMLVCMLAMYVQTGTTDIPMLTAHS-FGTGMQFWLFLGFFASFAVKVPMWPVHTWLPDAH 239

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APTAGS+ LAG++LKMGGYG +RF LP+FP AS+ FAPVIF LS+IA+IY SLV++ Q
Sbjct: 240 VEAPTAGSMILAGVLLKMGGYGFLRFSLPMFPHASELFAPVIFALSVIAVIYTSLVALAQ 299

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           +D+KK+IAYSS+AHMG+VTIGIF+  + G+ GAMFQM+SHGLVS+ALFFCVGV+YDRLHT
Sbjct: 300 SDMKKMIAYSSVAHMGFVTIGIFTFTEQGIAGAMFQMISHGLVSAALFFCVGVVYDRLHT 359

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I AYGG+   MPRYAV  M   +A++GLPGTSGF+GE LV++  ++ S  VA   + G
Sbjct: 360 REIDAYGGVAKVMPRYAVFFMFMMLASVGLPGTSGFVGEMLVLVGAWKASTWVAFFTATG 419

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           +VL A Y LWLYR+V+FG     +VQ ++ + LRE  +  PI++L + FGIYP  + D  
Sbjct: 420 LVLGATYMLWLYRRVMFGKVTKAEVQSMEPMQLRELGIFVPISILVLVFGIYPAFLLDVM 479

Query: 477 SVPLSSIIENYTLK 490
           +V +  II+  ++ 
Sbjct: 480 AVSIQIIIDELSVS 493


>gi|84516720|ref|ZP_01004078.1| NADH dehydrogenase subunit M [Loktanella vestfoldensis SKA53]
 gi|84509188|gb|EAQ05647.1| NADH dehydrogenase subunit M [Loktanella vestfoldensis SKA53]
          Length = 513

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 267/496 (53%), Positives = 361/496 (72%), Gaps = 17/496 (3%)

Query: 6   LSIVTFLPFLGVFVILFSSYLG---CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           L++ TFLP LG  VIL     G     +R+   VAL  + + FI SLF+ + FD   + F
Sbjct: 5   LTLTTFLPVLGA-VILALGLRGDDAAAQRNAKWVALVTTIVTFICSLFILTNFDPANTDF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   WI     Y +GVDGISIL V+LTTFL P  I S W ++    +EYMIAFL+LE
Sbjct: 64  QMVETADWI-MGLQYKMGVDGISILFVMLTTFLMPLVIASCW-NVTTRVKEYMIAFLILE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G FL+LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMLGVFLALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L  +A     FSI         Q  +W+AFF SFA+K+PM+P HTW
Sbjct: 182 VSMFSQAGTTDIPTLMGFAFGTEDFSILGVQIVGGMQTLLWLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+  AP++ +LS IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSEVMAPLVLWLSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQADMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA+V + FTMAN+GLPGTSGF+GEFL ++ VFQ +  VA+
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYALVFLFFTMANVGLPGTSGFVGEFLTLVGVFQVNTWVAL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+ SA Y+LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 422 VATSGVIFSAGYALWLYRRVVLGDLIKESLRSITDMTRRERLIFAPLVVMTLLLGVYPAL 481

Query: 472 IRDTFSVPLSSIIENY 487
           + D     ++++I+NY
Sbjct: 482 VLDMIGPSVAALIDNY 497


>gi|254510814|ref|ZP_05122881.1| NADH dehydrogenase i, m subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534525|gb|EEE37513.1| NADH dehydrogenase i, m subunit [Rhodobacteraceae bacterium KLH11]
          Length = 514

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/506 (51%), Positives = 362/506 (71%), Gaps = 15/506 (2%)

Query: 6   LSIVTFLPFL--GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P +  G+  +         +R+   VAL  +++ F+ S+ +++ FD   + FQ
Sbjct: 5   LSIVTFIPAIAAGILALFLHGEDAAAQRNAKWVALVATSVTFLVSIGIYTGFDPANTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           M+E   W+     Y +GVDGIS+L V+LTTF+ P  IL+SW ++ +  +EYMIAFL+LE+
Sbjct: 65  MVEEGEWL-LGLKYKMGVDGISVLFVLLTTFIMPLTILASW-NVTDRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  +  S   FS+         Q  M++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYADAGTTDIEALMSHQFSSEGFSVLGIYIVGGMQTLMFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S     V+ ++S IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSAVMTDVVLWMSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 ALVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M+FTMAN+GLPGTSGFIGEFL +M  FQ +  V  +
Sbjct: 363 RMHTRDIEAYGGLVIRMPAYALVFMLFTMANVGLPGTSGFIGEFLTLMGAFQVNTWVTAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG    E ++ + D+S RER +  P+ ++T+  G+YP  +
Sbjct: 423 AATGVIFSAGYALWLYRRVVFGDLIKESLKAMTDMSARERLIFAPLILMTILLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSDSVK 498
            D      +++I NY      +++V 
Sbjct: 483 TDVIGNSTAALISNYDTALAAAEAVT 508


>gi|260428146|ref|ZP_05782125.1| NADH-quinone oxidoreductase subunit m [Citreicella sp. SE45]
 gi|260422638|gb|EEX15889.1| NADH-quinone oxidoreductase subunit m [Citreicella sp. SE45]
          Length = 516

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 352/479 (73%), Gaps = 13/479 (2%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
              R+   +A+  S+  F+ SLF+   FD   + FQM+E   WI    +Y +GVDGIS+L
Sbjct: 29  AADRNAKWLAMIASSATFVISLFILFQFDPSNTDFQMVEEGSWI-MGLNYKMGVDGISVL 87

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+LTTF+ P  ILSSW  ++   +EYMIAFL+LE++++G F++LD++LFY+FFEA LIP
Sbjct: 88  FVMLTTFIMPLTILSSW-GVKTRVKEYMIAFLMLETLMLGVFMALDLVLFYMFFEAGLIP 146

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDL----YAMSKF 203
           MF+IIG+WGG  RIYA++KFFLYTF GS+ ML A+V M  +  T+ I  L    +A + F
Sbjct: 147 MFLIIGIWGGQNRIYASFKFFLYTFLGSVLMLVAMVAMYVDAGTTDIPTLLRHEFAFADF 206

Query: 204 PF-------SIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGG 256
                     +Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LA I+LKMGG
Sbjct: 207 SVLGIHVVGGMQTMLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMGG 266

Query: 257 YGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTI 316
           YG +RF LP+FP+ S+  AP++F++S IAI+Y SLV++VQ D+KKLIAYSS+AHMGYVT+
Sbjct: 267 YGFLRFSLPMFPVGSEVMAPLVFWMSAIAIVYTSLVALVQEDMKKLIAYSSVAHMGYVTM 326

Query: 317 GIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVM 376
           GIF+  + GV+GA+FQMLSHG VS ALF CVGVIYDR+HTR+I AYGGLV+ MP YA++ 
Sbjct: 327 GIFAANQQGVDGAIFQMLSHGFVSGALFLCVGVIYDRMHTREIDAYGGLVNRMPAYALIF 386

Query: 377 MVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVS 436
           M+FTMAN+GLPGTSGF+GEFL +M +FQ +  VA +A+ GV+ SA Y+LWLYR+VVFG  
Sbjct: 387 MLFTMANVGLPGTSGFVGEFLTLMGIFQVNTWVAFVAASGVIFSAAYALWLYRRVVFGDL 446

Query: 437 KCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSD 495
             E ++ ++D++ RE+ +  P+ V+T++ G+YP    D     + ++++NY      +D
Sbjct: 447 IKESLKTIQDMTSREKWIFAPLVVMTLWLGVYPAAALDIIGPSVEALVDNYDTAVAAAD 505


>gi|323138157|ref|ZP_08073230.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylocystis sp. ATCC 49242]
 gi|322396619|gb|EFX99147.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylocystis sp. ATCC 49242]
          Length = 508

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 267/502 (53%), Positives = 363/502 (72%), Gaps = 15/502 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGV--ALGISTI-NFIFSLFVWSVFDKGRSSF 62
           LS +TFLP +GV  +L     G    S   +  A  ++T+  F  SL+VWS FD   ++F
Sbjct: 7   LSGLTFLPLVGVAFLLTQK--GDDEASLRNIRWATFLTTLATFALSLYVWSGFDASSAAF 64

Query: 63  QMIEYYHWIDYFCS------YHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
           Q +E   W     +      Y +GVDG S+ LV+LTTF+ PF IL+SW+S+ +  +EYMI
Sbjct: 65  QFVEEKSWFGAEGAGKGGLVYKMGVDGFSMPLVLLTTFIMPFSILASWESVTKRVKEYMI 124

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFLVLE+++IG F +LD++LFY+FFE  LIPMF+IIG+WGG  R+YA++KFFLYT  GS+
Sbjct: 125 AFLVLETLMIGVFCALDLVLFYLFFEGGLIPMFLIIGIWGGKRRVYASFKFFLYTLAGSL 184

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML AI+ M     T+ I  L   + FP  +Q W+W+AFF SFA+K+PM+P HTWLP+AH
Sbjct: 185 LMLIAILAMYGVAGTTDITVLLK-TDFPKEMQTWLWLAFFASFAVKMPMWPVHTWLPDAH 243

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APTAGSV LA I+LKMGGYG IRF LP+FP AS YFAP+++ +S+IAI+Y SLV++VQ
Sbjct: 244 VEAPTAGSVILAAILLKMGGYGFIRFSLPMFPDASAYFAPLVYAMSVIAIVYTSLVALVQ 303

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            DIKKLIAYSS+AHMGYVT+G+F+    GV+GAMFQM+SHG VS ALF CVGVIYDR+HT
Sbjct: 304 EDIKKLIAYSSVAHMGYVTMGLFTLNPQGVQGAMFQMISHGFVSGALFLCVGVIYDRMHT 363

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I AYGGLV+ MP YA V M+FTMAN+GLPGT+GFIGEFL +M  F+ ++ VA++A+ G
Sbjct: 364 REIAAYGGLVNRMPIYAFVFMLFTMANVGLPGTTGFIGEFLSLMGAFKANSWVALIATSG 423

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           V+ SA Y+L+LYR+VVFG  +   ++ + DL+ RE  +  P+  LT+++G+ P  I    
Sbjct: 424 VIFSAAYALYLYRRVVFGALEKASLKDIVDLTPREIAIFAPLIALTIYYGVLPGQILSAT 483

Query: 477 SVPLSSIIENYTLKTGYSDSVK 498
              + ++I+++   T   D+VK
Sbjct: 484 QASVDNLIQSH---TALLDAVK 502


>gi|146278029|ref|YP_001168188.1| NADH dehydrogenase subunit M [Rhodobacter sphaeroides ATCC 17025]
 gi|145556270|gb|ABP70883.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 513

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 256/495 (51%), Positives = 355/495 (71%), Gaps = 15/495 (3%)

Query: 6   LSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI+TF+P +   +  +         +R+   +AL  ++  F+ SLF+ + FD   + FQ
Sbjct: 5   LSIITFIPLVAALIMALFLRGEDAAAQRNAKWLALLATSATFLVSLFLLAGFDPDNTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E Y WI     Y +GVDGISIL V+LTTFL P  I S+W+ ++   +EYMIAFLVLE+
Sbjct: 65  FVETYDWIAGL-KYKMGVDGISILFVMLTTFLMPLTIASAWE-VENRVKEYMIAFLVLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD++LFY+FFEA LIPMF+IIG+WGG ERIYAA+KFFLYTF GS+ ML A++
Sbjct: 123 LMIGVFCALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYAAFKFFLYTFLGSVLMLIAMI 182

Query: 184 VMCWEKKTSSIIDLYAMS-----------KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWL 232
            M ++  T+ I  L A             +    +Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYFDAGTTDIPTLMAHEFSSGTLLIAGFQIVGGLQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   +P++ +LS IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDLLSPLVLWLSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++ Q+D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQMLSHG +S ALF CVGVIYD
Sbjct: 303 ALAQSDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMLSHGFISGALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ +FQ +  VA++
Sbjct: 363 RMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLVGIFQVNTWVAMV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA Y LWLYR+VVFG    E ++ ++D+  RE+ +  P+  +T+  G+YP  +
Sbjct: 423 ATTGVILSAAYGLWLYRRVVFGELVKEALRTIRDMDRREKAIFAPLVAMTLLLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENY 487
            D     ++ +  +Y
Sbjct: 483 TDIIGPSVARLTSDY 497


>gi|77463086|ref|YP_352590.1| NADH dehydrogenase subunit M [Rhodobacter sphaeroides 2.4.1]
 gi|221638942|ref|YP_002525204.1| NADH dehydrogenase subunit M [Rhodobacter sphaeroides KD131]
 gi|332557959|ref|ZP_08412281.1| NADH:ubiquinone oxidoreductase subunit M [Rhodobacter sphaeroides
           WS8N]
 gi|77387504|gb|ABA78689.1| NADH dehydrogenase I chain M (NADH-ubiquinone oxidoreductase chain
           13) [Rhodobacter sphaeroides 2.4.1]
 gi|221159723|gb|ACM00703.1| Proton-translocating NADH-quinone oxidoreductase, chain M precursor
           [Rhodobacter sphaeroides KD131]
 gi|332275671|gb|EGJ20986.1| NADH:ubiquinone oxidoreductase subunit M [Rhodobacter sphaeroides
           WS8N]
          Length = 513

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/500 (51%), Positives = 360/500 (72%), Gaps = 15/500 (3%)

Query: 6   LSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI+TF+P +   +  +         +R+   +AL  ++  F+ SLF+ + FD   + FQ
Sbjct: 5   LSIITFIPLVAALIMALFLRGDDAAAQRNAKWLALLATSATFLVSLFLLAGFDAQDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E Y WI     Y +GVDGISIL V+LTTFL P  I S+W+ ++   +EYMIAFL+LE+
Sbjct: 65  FVESYDWIAGL-QYKMGVDGISILFVMLTTFLMPLTIASAWE-VETRVKEYMIAFLILET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F +LD++LFY+FFEA LIPMF+IIG+WGG +RIYAA+KFFLYTF GS+ ML A++
Sbjct: 123 LMLGVFCALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYAAFKFFLYTFLGSVLMLIAMI 182

Query: 184 VMCWEKKTSSIIDLYA-------MSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M ++  T+ I  L +       M+   F I    Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYYDAGTTDIPTLLSHEFSSGTMTLAGFQIVGGLQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+  +P++F++S IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPIGSELLSPLVFWMSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++ Q+D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQMLSHG +S ALF CVGVIYD
Sbjct: 303 ALAQSDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMLSHGFISGALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGFIGEFL ++ +FQ +  VA++
Sbjct: 363 RMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFIGEFLTLVGIFQVNTWVAMV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA Y LWLYR+VVFG    E ++ ++D+  RE+ +  P+  +T+  G+YP  +
Sbjct: 423 ATSGVILSAAYGLWLYRRVVFGELVKEALRTIRDMDRREKAIFAPLVAMTLLLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENYTLKTG 492
            D     ++ +  +Y   T 
Sbjct: 483 TDIIGPSVARLTTDYQSATA 502


>gi|260434163|ref|ZP_05788134.1| NADH-quinone oxidoreductase subunit m [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417991|gb|EEX11250.1| NADH-quinone oxidoreductase subunit m [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 513

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/495 (52%), Positives = 356/495 (71%), Gaps = 15/495 (3%)

Query: 6   LSIVTFLPFL--GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P +  G+  +         +R+   +AL  +T+ F+ S+ +++ FD     FQ
Sbjct: 5   LSIVTFIPAISAGLMALFLHGNDAAAQRNAKWIALVATTVTFLVSIGIYTEFDPSNPGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           M+E   W      Y +GVDGIS+L V+LTTF+ P  IL+SW ++ +  +EYMIAFL+LE+
Sbjct: 65  MVEEAEWF-MGLKYKMGVDGISVLFVLLTTFIMPLTILASW-NVTDRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  +  S   FS+         Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYADAGTTDIAALMTHQFSSESFSVLGIHIVGGMQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S     ++ +LS IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSAVMTDLVLWLSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 ALVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M+FTMAN+GLPGTSGFIGEFL +M  FQ +  V  +
Sbjct: 363 RMHTRDIDAYGGLVIRMPAYALVFMLFTMANVGLPGTSGFIGEFLTLMGTFQVNTWVTAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG    E ++ + D+S RER +  P+ V+T+  G+YP  +
Sbjct: 423 AASGVIFSAAYALWLYRRVVFGDLIKESLKSITDMSTRERLIFAPLIVMTILLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENY 487
            D      +++I NY
Sbjct: 483 TDVIGTSTAALISNY 497


>gi|259419140|ref|ZP_05743057.1| NADH-quinone oxidoreductase subunit m [Silicibacter sp. TrichCH4B]
 gi|259345362|gb|EEW57216.1| NADH-quinone oxidoreductase subunit m [Silicibacter sp. TrichCH4B]
          Length = 521

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 267/505 (52%), Positives = 365/505 (72%), Gaps = 19/505 (3%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   V+           +R+   VAL  ++I F  SLF++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAVMALLMRGEDEAAQRNAKYVALMATSITFFVSLFIYFQFDPSNTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW S+    +EYMIAFL+LE+
Sbjct: 65  FVEERAWI-FGLKYKMGVDGISVLFVLLTTFVMPLTILASW-SVTTRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LDM+LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTFFGS+ ML A+V
Sbjct: 123 LMLGVFMALDMVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFFGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMFPFHTW 231
            M ++  T+ I+ L A  +F ++            +Q  +++AFF SFA+K+PM+P HTW
Sbjct: 183 AMYFDAGTTDIVKLLA-HEFSYASMNVLGIHVLGGMQTLLFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+    VI ++S IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSEVMTDVILWMSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+MVQ D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHG +S+ALF CVGVIY
Sbjct: 302 VAMVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMLSHGFISAALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGFIGEFL +M VFQ +  VA+
Sbjct: 362 DRMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFIGEFLTLMGVFQENTWVAL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+ SA Y+LWLYR+VVFG    E ++ +KD++ RE+ +  P+  +T+  GIYP  
Sbjct: 422 VATTGVIFSACYALWLYRRVVFGDLIKESLKSIKDMNAREKWIFAPLVAMTLLLGIYPSV 481

Query: 472 IRDTFSVPLSSIIENYTLKTGYSDS 496
           + D       ++++  ++ T  +D+
Sbjct: 482 VTDVIGPSTEALVQ--SVNTAVADA 504


>gi|260574776|ref|ZP_05842779.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodobacter sp. SW2]
 gi|259023193|gb|EEW26486.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodobacter sp. SW2]
          Length = 512

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/508 (50%), Positives = 362/508 (71%), Gaps = 21/508 (4%)

Query: 5   FLSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSI+TFLP +   +  +         +R+   +AL  ++  FI SLF+ + FD   +  
Sbjct: 4   LLSIITFLPLVAATILALFLRGDDAAAQRNAKWLALVATSATFILSLFLLAGFDPADTGM 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E Y WI     Y +GVDGIS+L V+LTTFL P  I + W  ++   +EYMIAFLVLE
Sbjct: 64  QFLEDYDWI-VGLHYKMGVDGISVLFVLLTTFLMPITIAACWP-VEVRVKEYMIAFLVLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIG+WGG ERIYAA+KFFLYTF GS+ ML A+
Sbjct: 122 TLMIGVFTALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYAAFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPMFPF 228
           +VM  +  T+   D+ A+ +F F+              +Q  +++AFF SFA+KIPM+P 
Sbjct: 182 IVMYVQAGTT---DMVALMQFDFAHETLGIGGFQIVGGLQTLLFLAFFASFAVKIPMWPV 238

Query: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288
           HTWLP+AHVQAPTAGSV LA +MLKMGGYG +RF LP+FP+ ++   P++ ++S+IAI+Y
Sbjct: 239 HTWLPDAHVQAPTAGSVILAAVMLKMGGYGLLRFSLPMFPVGAEVLGPLVLWMSVIAIVY 298

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
            SLV++ Q+D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHG +S ALF  VG
Sbjct: 299 TSLVALAQSDMKKLIAYSSVAHMGFVTMGIFAVNQQGVDGAIFQMLSHGFISGALFLIVG 358

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           VIYDR+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ +FQ +  
Sbjct: 359 VIYDRMHTREIDAYGGLVNRMPVYALIFMFFTMANVGLPGTSGFVGEFLTLVGIFQVNTW 418

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA +A+ GV+LSA Y+LWLYR+VVFG    E ++ + D++ RER +  P+ V+T+  G+Y
Sbjct: 419 VAAVATTGVILSAAYALWLYRRVVFGDLIKEALKTITDMTGRERAIFAPLVVMTLLLGVY 478

Query: 469 PVPIRDTFSVPLSSIIENYTLKTGYSDS 496
           P  + D     + +++ +Y    G SD+
Sbjct: 479 PSLVTDLIGPSVGALVADYHTAPGVSDA 506


>gi|254455716|ref|ZP_05069145.1| NADH dehydrogenase i chain m [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082718|gb|EDZ60144.1| NADH dehydrogenase i chain m [Candidatus Pelagibacter sp. HTCC7211]
          Length = 493

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 248/488 (50%), Positives = 362/488 (74%), Gaps = 1/488 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           MN P LS +  LP +G   + F+        +   V+L  +++NF+ S+++W  FD+  S
Sbjct: 1   MNFPILSSLILLPTIGALFLFFTKDKEGNNSTAKYVSLFTTSVNFLISIYLWVSFDQSTS 60

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           +FQ IE   WI+ F +Y +GVDGISIL ++LTTF+TP CI+S   S+++  R+++IA L+
Sbjct: 61  NFQFIEDRTWIEGFINYKVGVDGISILFIILTTFITPLCIISVNNSVKKRLRDFLIAILI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LES +IG F +LD+++FY+FFEA LIPMF+IIG+WGG +R+Y+A+KFFLYT  GS+ ML 
Sbjct: 121 LESFMIGVFCALDLVVFYLFFEAGLIPMFLIIGIWGGPKRVYSAFKFFLYTLLGSVLMLV 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ + W   T+ +I LY +       Q  +W+AFF SFA+K PM+P HTWLP+AHV+AP
Sbjct: 181 AIISIYWISGTTDVIKLYELG-IDAKYQNLLWLAFFSSFAVKTPMWPVHTWLPDAHVEAP 239

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I+LKM GYG IRF L LFP+AS+ F P+I+ LS+IAII  SL++++Q D+K
Sbjct: 240 TAGSVLLAAILLKMAGYGFIRFSLGLFPIASEVFTPLIYALSVIAIIVTSLIALMQEDMK 299

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+G+F+  + G+EG++ QM+SHGLVS+ALF CVGV+YDR+H+R I 
Sbjct: 300 KLIAYSSVAHMGFVTLGVFTIQQQGIEGSIIQMISHGLVSAALFLCVGVVYDRMHSRLIS 359

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           +YGG+V  +P+Y+++ M+FT+A +GLPGTSGF+GEFL++M+VF+++  VAVLAS GV+L 
Sbjct: 360 SYGGIVTIIPKYSILFMIFTLAALGLPGTSGFVGEFLILMAVFKDNFLVAVLASIGVILG 419

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y LWLY++V+FG      ++ + DL   E  ++  +A+ T++FG YP P+ +T  V +
Sbjct: 420 AAYMLWLYKRVIFGKLINSDLKSMMDLDRSEYFILTCLAIPTLYFGFYPDPLINTIEVSV 479

Query: 481 SSIIENYT 488
           + +I+ Y 
Sbjct: 480 NDLIDMYN 487


>gi|89070157|ref|ZP_01157486.1| NADH dehydrogenase subunit M [Oceanicola granulosus HTCC2516]
 gi|89044274|gb|EAR50420.1| NADH dehydrogenase subunit M [Oceanicola granulosus HTCC2516]
          Length = 525

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 350/501 (69%), Gaps = 22/501 (4%)

Query: 6   LSIVTFLPFLGVFVI--LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LS+ TF P LG  ++           + +   VA   +   F+ SLF+   FD   S FQ
Sbjct: 5   LSLTTFFPLLGALILALFLRGDDAAAQSNAKWVAFATTLATFVISLFILFGFDGSSSEFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   W+     Y +GVDGIS+L V+LTTFL P  I + W ++    +EYMIAFLVLE+
Sbjct: 65  FVEDRQWL-LGLRYRMGVDGISVLFVMLTTFLMPITIAACW-NVTHRVKEYMIAFLVLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F+SLD++LFY+FFE  LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMIGVFVSLDLMLFYLFFEGGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSII----DLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPM 225
            M  +  T+ I     D+  +  + F+               Q  MW+AFF SFA+K+PM
Sbjct: 183 AMYAQAGTTCIAACGPDVVGLLDYNFASETIPLFGFQIIGGAQTLMWLAFFASFAVKMPM 242

Query: 226 FPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIA 285
           +P HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+AS+  AP++ +LS IA
Sbjct: 243 WPVHTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVASELLAPLVLWLSAIA 302

Query: 286 IIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFF 345
           I+Y SLV++VQ D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQMLSHG +S ALF 
Sbjct: 303 IVYTSLVALVQEDMKKLIAYSSVAHMGYVTMGIFAANQQGIDGAIFQMLSHGFISGALFL 362

Query: 346 CVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQN 405
           CVGVIYDR+HTRDI AYGGLV+ MP YA + M+FTMAN+GLPGTSGFIGEFL +M VFQ 
Sbjct: 363 CVGVIYDRMHTRDIDAYGGLVNRMPAYAAIFMLFTMANVGLPGTSGFIGEFLTLMGVFQV 422

Query: 406 SNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFF 465
           +  VA +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RE+ +  P+ V+T+  
Sbjct: 423 NTWVAAIATTGVILSAGYALWLYRRVVMGDLIKESLRSITDMTGREKAIFAPLVVMTILL 482

Query: 466 GIYPVPIRDTFSVPLSSIIEN 486
           G+YP  + D     + S+I N
Sbjct: 483 GVYPSLVTDIIGPSVESLIAN 503


>gi|149202652|ref|ZP_01879624.1| NADH dehydrogenase subunit M [Roseovarius sp. TM1035]
 gi|149143934|gb|EDM31968.1| NADH dehydrogenase subunit M [Roseovarius sp. TM1035]
          Length = 525

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/495 (52%), Positives = 353/495 (71%), Gaps = 15/495 (3%)

Query: 5   FLSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSIVTF+P +   +  +         +R+   VAL  +T+ F+ SLF+   FD   + F
Sbjct: 14  LLSIVTFIPAVAAAILAVFLRGSDEAAQRNAKWVALIATTLTFVVSLFILFDFDASNTGF 73

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW  +    +EYMIAFL+LE
Sbjct: 74  QFVEEREWL-LGLKYKMGVDGISVLFVMLTTFMMPLTIAASW-GVTTRVKEYMIAFLLLE 131

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+
Sbjct: 132 TLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVAM 191

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L  +      FSI         Q  M++AFF SFA+K+PM+P HTW
Sbjct: 192 VAMFSDAGTTDIAALLKHEFESETFSILGVQVIGGMQTLMFLAFFASFAVKMPMWPVHTW 251

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+   P++ ++S IAI+Y SL
Sbjct: 252 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPIGSEVLTPLVLWMSAIAIVYTSL 311

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++ Q+D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQMLSHG +S ALF CVGVIY
Sbjct: 312 VALAQSDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMLSHGFISGALFLCVGVIY 371

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ VFQ +  VA 
Sbjct: 372 DRMHTREIDAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLVGVFQVNTWVAA 431

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 432 VATSGVILSAAYALWLYRRVVMGDLIKESLRTITDMTKRERAIFAPLVVMTLLLGVYPRL 491

Query: 472 IRDTFSVPLSSIIEN 486
           + D     + ++I N
Sbjct: 492 VTDITGPSVEALISN 506


>gi|99080600|ref|YP_612754.1| NADH dehydrogenase subunit M [Ruegeria sp. TM1040]
 gi|99036880|gb|ABF63492.1| proton-translocating NADH-quinone oxidoreductase chain M [Ruegeria
           sp. TM1040]
          Length = 521

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 266/505 (52%), Positives = 364/505 (72%), Gaps = 19/505 (3%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   V+           +R+   VAL  ++I FI SLF++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAVMALLMRGDDEAAQRNAKYVALMATSITFIVSLFIYFQFDPSDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW S+    +EYMIAFLVLE+
Sbjct: 65  FVEERDWI-FGLKYKMGVDGISVLFVMLTTFVMPLTILASW-SVTNRVKEYMIAFLVLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LDM+LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTFFGS+ ML A+V
Sbjct: 123 LMLGVFMALDMVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFFGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMFPFHTW 231
            M ++  T+ I+ L +  +F +             +Q  +++AFF SFA+K+PM+P HTW
Sbjct: 183 AMYFDAGTTDIVKLLS-HEFSYEGFNVLGIHVLGGMQTLLFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S+    VI ++S IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSEVMTDVILWMSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+MVQ D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHG +S+ALF CVGVIY
Sbjct: 302 VAMVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMLSHGFISAALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGF+GEFL +M  FQ +  VA 
Sbjct: 362 DRMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFVGEFLTLMGAFQENTWVAF 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+ SA Y+LWLYR+VVFG    E ++ +KD++ RE+ +  P+ V+T+  G+YP  
Sbjct: 422 VATTGVIFSACYALWLYRRVVFGDLIKESLKAIKDMNAREKWIFAPLIVMTLLLGVYPSV 481

Query: 472 IRDTFSVPLSSIIENYTLKTGYSDS 496
           + D       ++++  ++ T  +D+
Sbjct: 482 VTDVIGPSTEALVQ--SVNTAVADA 504


>gi|302383062|ref|YP_003818885.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193690|gb|ADL01262.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 495

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 264/489 (53%), Positives = 346/489 (70%), Gaps = 4/489 (0%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGV--ALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LS+VTFLP +G  +IL   +    RR       AL  + +    S  +   FD    ++Q
Sbjct: 8   LSVVTFLPLVGALLILAGRFAAPARRDDIARWGALVTTLVTLAVSAVLVLSFDSTNPAYQ 67

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E Y W      YHLGVDGISIL V+LT FL P CIL+SWKSI+    +YMIAFLVLE+
Sbjct: 68  FVENYAWFAG-AGYHLGVDGISILFVLLTAFLMPICILASWKSIETRVVDYMIAFLVLET 126

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +VIG F SLD+ LFYIFFE +L+PMF+IIGVWGG+ RIYAAYKFFLYT  GS+ ML A++
Sbjct: 127 LVIGVFTSLDLFLFYIFFEGTLVPMFIIIGVWGGANRIYAAYKFFLYTLLGSVLMLLAML 186

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M  E  T+SI +L   +  P   Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAPTAG
Sbjct: 187 WMANEAGTTSIPELKTFAFSP-QAQSVLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAG 245

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+GGYG I F +P+FP AS  + P++F LS+IAI Y SLV+  QTDIKKLI
Sbjct: 246 SVILAGILLKLGGYGFILFNVPMFPEASIQYQPLVFTLSVIAIAYTSLVAFRQTDIKKLI 305

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHMG+VT+GIF+G   G++GA+FQMLSHGL+S ALF CVGV+YDR+HTR+I  YG
Sbjct: 306 AYSSVAHMGFVTMGIFAGNAQGMQGAIFQMLSHGLISGALFLCVGVVYDRMHTREIAFYG 365

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL + MP YA + ++FTMAN+GLPGTSGFIGE L +  V+Q S   A +A+ GV+LSA+Y
Sbjct: 366 GLTNRMPWYAAIFLMFTMANVGLPGTSGFIGEMLTMTGVYQASTWAAFVAATGVILSAVY 425

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           +L LYR V+FG      +  +KD+ LRE  +  P+ V T++ G+ P  + +  +  + ++
Sbjct: 426 ALTLYRNVMFGEITNPALATIKDIDLRELVIFVPLIVGTIWLGVQPDLVLNYTAASVDAV 485

Query: 484 IENYTLKTG 492
           +  + L TG
Sbjct: 486 VNGWQLATG 494


>gi|86137581|ref|ZP_01056158.1| NADH dehydrogenase subunit M [Roseobacter sp. MED193]
 gi|85825916|gb|EAQ46114.1| NADH dehydrogenase subunit M [Roseobacter sp. MED193]
          Length = 515

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 358/504 (71%), Gaps = 15/504 (2%)

Query: 6   LSIVTFLPF--LGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P     V  +L        +R+   +AL  +++ F+ SL ++  FD   + FQ
Sbjct: 5   LSIVTFIPAGAAAVMALLMRGEDEAAQRNAKWLALMATSLTFLVSLGIYFQFDPNNTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW ++    +EYMIAFL+LE+
Sbjct: 65  FVEERDWI-FGLQYKMGVDGISVLFVMLTTFVMPLTILASW-NVSTRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYVFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  + +T+ I+ L  ++ S   F +         Q  M++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYVDAQTTDIVQLLTHSFSAASFDVLGIHVVGGMQTLMFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +     +I ++S IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVMTDLILWMSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           +MVQ D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 AMVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGF+GEFL +M  FQ +  VA +
Sbjct: 363 RMHTRDINAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFVGEFLTLMGAFQKNTWVAAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG      ++ ++D+  RER +  P+ V+T+  G+YP  +
Sbjct: 423 AASGVIFSAGYALWLYRRVVFGDLIKGSLKTIQDMDARERFIFAPLVVMTILLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSDS 496
            D  S    ++I N+      +D+
Sbjct: 483 TDIISPSTEALIANFNQSLAAADT 506


>gi|262277289|ref|ZP_06055082.1| NADH-quinone oxidoreductase subunit m (nadhdehydrogenase i subunit
           m) (ndh-1 subunit m) [alpha proteobacterium HIMB114]
 gi|262224392|gb|EEY74851.1| NADH-quinone oxidoreductase subunit m (nadhdehydrogenase i subunit
           m) (ndh-1 subunit m) [alpha proteobacterium HIMB114]
          Length = 499

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/502 (51%), Positives = 361/502 (71%), Gaps = 10/502 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG-----VALGISTINFIFSLFVWSVFD 56
            +P L++ TFLP +GVF +LF      G   F       ++L  S I F+ S+ + + F+
Sbjct: 3   EIPILTLTTFLPLIGVFFLLFLK----GEEEFVSRTSGYISLLTSGIVFLASILILNNFN 58

Query: 57  KGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
                FQ +E + WI  F +Y +G+DGIS+  ++LTTF+TP CIL++  S+++  RE++I
Sbjct: 59  YNNPDFQFVEQHDWIFNFVNYKVGIDGISLSFILLTTFITPICILATINSVKKRLREFLI 118

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           A L++E+M+IG F SLD+ +FY+FFEA LIPMF+IIG+WGG +R+Y+A+KFFLYT FGSI
Sbjct: 119 ALLLMETMMIGVFCSLDLFIFYLFFEAGLIPMFLIIGIWGGEKRVYSAFKFFLYTLFGSI 178

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           FML +I+ + ++  T  +  L  + +     Q ++W+ FF SFA+K PM+P HTWLP+AH
Sbjct: 179 FMLISIIYIYFDAGTLDVEKLLNI-QINKDYQKYLWLGFFASFAVKTPMWPVHTWLPDAH 237

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT+GSV LA I+LKM GYG IRF L LFP AS YFAP++F LS+IAIIY SLV++VQ
Sbjct: 238 VEAPTSGSVILAAILLKMAGYGFIRFSLGLFPDASVYFAPLVFALSIIAIIYTSLVALVQ 297

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKLIAYSS+AHMG+VTIGIF   K G+EG++FQM+SHG++SSALF CVGV+YDR+HT
Sbjct: 298 KDMKKLIAYSSVAHMGFVTIGIFVFNKQGIEGSIFQMISHGIISSALFLCVGVVYDRMHT 357

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGG+V+ MP+YAV+ MVFT+ ++GLPGTSGF+GE LV++  F+ +  +A  A+ G
Sbjct: 358 REISEYGGVVNIMPKYAVMFMVFTLGSLGLPGTSGFVGEILVLIGSFKYNYWIAFFAATG 417

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           V+LSA YSLWLYR+VVFG    EK++ L DL+  E  ++ P+ ++T+  G YP  I D  
Sbjct: 418 VILSACYSLWLYRRVVFGKITNEKIRNLTDLNKNEYLILTPLLIMTIILGFYPALILDLI 477

Query: 477 SVPLSSIIENYTLKTGYSDSVK 498
           S  +  +  N T     + +VK
Sbjct: 478 SSSVDKVSSNMTDYIKLAGAVK 499


>gi|114765012|ref|ZP_01444159.1| NADH dehydrogenase subunit M [Pelagibaca bermudensis HTCC2601]
 gi|114542559|gb|EAU45584.1| NADH dehydrogenase subunit M [Roseovarius sp. HTCC2601]
          Length = 516

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/480 (52%), Positives = 351/480 (73%), Gaps = 15/480 (3%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
              R+   +A+  ++  F+ SLF+   FD   + FQM+E   WI    +Y +GVDGIS+L
Sbjct: 29  AADRNAKWLAMIATSATFVISLFILFQFDASNTGFQMVEEGTWI-MGMNYKMGVDGISVL 87

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+LTTF+ P  IL+SW  ++   +EYMIAFL+LE++++G F++LD++LFY+FFEA LIP
Sbjct: 88  FVMLTTFMMPLTILASWD-VKLRVKEYMIAFLLLETLMLGVFMALDLVLFYLFFEAGLIP 146

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFS- 206
           MF+IIG+WGG  RIYA++KFFLYTF GS+ ML A+V M  +  T+ I  L A  +F F+ 
Sbjct: 147 MFLIIGIWGGKNRIYASFKFFLYTFLGSVLMLVAMVAMYADAGTTDIPTLLA-HEFAFAD 205

Query: 207 -----------IQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMG 255
                      +Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LA I+LKMG
Sbjct: 206 FEVLGIHIVGGLQTMLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMG 265

Query: 256 GYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVT 315
           GYG +RF LP+FP+ S+  AP++F++S IAI+Y SLV++VQ D+KKLIAYSS+AHMGYVT
Sbjct: 266 GYGFLRFSLPMFPVGSEVMAPLVFWMSAIAIVYTSLVALVQEDMKKLIAYSSVAHMGYVT 325

Query: 316 IGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVV 375
           +GIF+  + G++GA+FQM+SHG +S ALF CVGVIYDR+HTR+I AYGGLV+ MP YA++
Sbjct: 326 MGIFAANQQGIDGAIFQMISHGFISGALFLCVGVIYDRMHTREIDAYGGLVNRMPAYALI 385

Query: 376 MMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGV 435
            M+FTMAN+GLPGTSGFIGEFL +M +FQ +  VA +A+ GV+ SA Y+LWLYR+VV G 
Sbjct: 386 FMLFTMANVGLPGTSGFIGEFLTLMGIFQVNTWVAAVAASGVIFSAAYALWLYRRVVLGD 445

Query: 436 SKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSD 495
              E ++ ++D++ RE+ +  P+ V+T++ G+YP    D     + +++ NY      +D
Sbjct: 446 LIKESLRTIQDMTSREKWIFAPLVVMTLWLGVYPAAALDIIGPSVEALVGNYDTAVAAAD 505


>gi|149914596|ref|ZP_01903126.1| NADH dehydrogenase subunit M [Roseobacter sp. AzwK-3b]
 gi|149811389|gb|EDM71224.1| NADH dehydrogenase subunit M [Roseobacter sp. AzwK-3b]
          Length = 515

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/472 (52%), Positives = 349/472 (73%), Gaps = 13/472 (2%)

Query: 27  GCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISI 86
              +RS   VAL  +++ F+ S+F+ + FD   + FQM+E   W+     Y +GVDGIS+
Sbjct: 28  AAAQRSAKWVALSATSLTFLVSIFILTGFDPNDTGFQMVEEREWL-LGLQYKMGVDGISV 86

Query: 87  LLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLI 146
           L V+LTTF+ P  I +SW ++ +  +EYMIAFL+LE++++G F++LD++LFY+FFEA LI
Sbjct: 87  LFVMLTTFIMPITIAASW-NVTKRVKEYMIAFLLLETLMLGVFMALDLVLFYLFFEAGLI 145

Query: 147 PMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDL--YAMSKFP 204
           PMF+IIG+WGG ER+YA++KFFLYTF GS+ ML A+V M  +  T+ I+DL  +      
Sbjct: 146 PMFLIIGIWGGKERVYASFKFFLYTFLGSVLMLIAMVAMFSDAGTTDIVDLMNHQFGSES 205

Query: 205 FSI---------QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMG 255
           FS+         Q  M+IAFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LA I+LKMG
Sbjct: 206 FSVLGIHIVGGMQTLMFIAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMG 265

Query: 256 GYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVT 315
           GYG +RF LP+FP+ ++   P+I ++S IAI+Y SLV++ Q D+KKLIAYSS+AHMGYVT
Sbjct: 266 GYGFLRFSLPMFPVGAELLTPLILWMSAIAIVYTSLVALAQEDMKKLIAYSSVAHMGYVT 325

Query: 316 IGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVV 375
           +GIFS  + G++GA+FQM+SHG +S ALF  VGVIYDR+HTR+I AYGGLV+ MP YA++
Sbjct: 326 MGIFSVNQQGIDGAIFQMISHGFISGALFLIVGVIYDRMHTREIDAYGGLVNRMPAYALI 385

Query: 376 MMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGV 435
            ++FTMAN+GLPGTSGFIGEFL ++ VFQ +  VA++A+ GV+LSA Y+LWLYR+V+ G 
Sbjct: 386 FLLFTMANVGLPGTSGFIGEFLTLVGVFQVNTWVALVATTGVILSAAYALWLYRRVMLGD 445

Query: 436 SKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENY 487
              E ++ + D++ RER +  P+ V+T+  G+YP  + D     + ++I NY
Sbjct: 446 LIKESLKSINDMTGRERAIFAPLVVMTLLLGVYPSLVTDIIGPSVEALISNY 497


>gi|312116314|ref|YP_004013910.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221443|gb|ADP72811.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 512

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/485 (52%), Positives = 345/485 (71%), Gaps = 2/485 (0%)

Query: 4   PFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P L+ +  LP +G  ++ +         ++   +AL  + + F  SL + S FD     F
Sbjct: 5   PILTTLMLLPAVGALLLAVLRGTDEAALKNARWIALWTTVVTFALSLILLSDFDYANPGF 64

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E+  W+    +Y++GVDG+S+  V+LTTFL P  IL+SWKSI    +EYMIAFL+LE
Sbjct: 65  QFVEHRPWLSDTITYYVGVDGLSLPFVILTTFLMPLTILASWKSITVRVKEYMIAFLILE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFE  LIPMF+IIGVWGG  R+YA++KFFLYT  GS+FML AI
Sbjct: 125 ALMIGVFCALDLVLFYLFFEGGLIPMFIIIGVWGGPRRVYASFKFFLYTLLGSLFMLIAI 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           +VM     T+ I  L     FP ++Q W+W AF  SFA+K+PM+P HTWLP+AHV+APTA
Sbjct: 185 LVMYGMAGTTEIPALLKYD-FPVNVQAWLWFAFLASFAVKLPMWPVHTWLPDAHVEAPTA 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LA I+LKMGGYG IRF LP+FP AS  FAP++F L + AIIY SLV+  Q D+KKL
Sbjct: 244 GSVVLAAILLKMGGYGFIRFSLPMFPDASVQFAPLMFTLGVAAIIYTSLVAFAQKDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHMG+VTIG+FSG + GV+GA+FQM+SHG+VS ALF  VGV+YDR+HTR+I AY
Sbjct: 304 IAYSSVAHMGFVTIGVFSGTEQGVQGAVFQMISHGIVSGALFLAVGVVYDRMHTREIAAY 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGL   MP YA   MVFTMAN+GLPGTSGFIGEFL ++  FQ +   A  A FG++LSA+
Sbjct: 364 GGLADRMPIYAFFFMVFTMANVGLPGTSGFIGEFLTLLGTFQANTVAAFFACFGLILSAV 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y+L LYR+++FG  +   +  +KD+S RE  ++ P+ +LT+  G YP P+ D  S  + +
Sbjct: 424 YALTLYRRMIFGKLEKPSLATIKDMSPREIGIMAPLLILTIVLGFYPKPVLDMTSGSVKA 483

Query: 483 IIENY 487
           +I  Y
Sbjct: 484 MILPY 488


>gi|56697602|ref|YP_167971.1| NADH dehydrogenase subunit M [Ruegeria pomeroyi DSS-3]
 gi|56679339|gb|AAV96005.1| NADH dehydrogenase I, M subunit [Ruegeria pomeroyi DSS-3]
          Length = 513

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/472 (53%), Positives = 347/472 (73%), Gaps = 13/472 (2%)

Query: 27  GCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISI 86
              +R+   VAL  +T+ F+ S+ +++ FD   + FQM+E   W+     Y +GVDGIS+
Sbjct: 28  AAAQRNAKWVALFATTVTFLVSIGIYTGFDPADTGFQMVEEGEWL-MGLKYKMGVDGISV 86

Query: 87  LLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLI 146
           L V+LTTF+ P  IL+SW+ +    +EYMIAFL+LE++++G F++LD++LFY+FFEA LI
Sbjct: 87  LFVLLTTFIMPLTILASWE-VTTRVKEYMIAFLLLETLMLGVFMALDLVLFYLFFEAGLI 145

Query: 147 PMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDL--YAMSKFP 204
           PMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+V M  +  T+ I  L  +  S   
Sbjct: 146 PMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVAMVSMYVDAGTTDIALLMKHQFSSES 205

Query: 205 FSI---------QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMG 255
           FS+         Q  M++AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LA I+LKMG
Sbjct: 206 FSLLGVHVLGGAQTLMFLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMG 265

Query: 256 GYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVT 315
           GYG +RF LP+FP+ ++    +I +LS IA++Y SLV+MVQ D+KKLIAYSS+AHMG+VT
Sbjct: 266 GYGFLRFSLPMFPVGAEVMTDLILWLSAIAVVYTSLVAMVQEDMKKLIAYSSVAHMGFVT 325

Query: 316 IGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVV 375
           +GIF+  + GV+GA+FQMLSHG +S+ALF CVGVIYDR+HTRDI AYGGLV+ MP YA V
Sbjct: 326 MGIFAANQQGVDGAIFQMLSHGFISAALFLCVGVIYDRMHTRDIDAYGGLVNRMPTYARV 385

Query: 376 MMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGV 435
            M+FTMAN+GLPGTSGFIGEFL +M  FQ +  VA +A+ GV+ SA Y+LWLYR+VVFG 
Sbjct: 386 FMLFTMANVGLPGTSGFIGEFLTLMGTFQKNTWVAAVAASGVIFSAGYALWLYRRVVFGD 445

Query: 436 SKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENY 487
              E ++ + D++ RER +  P+ V+T+  G+YP  + D      +++I N+
Sbjct: 446 LIKESLKAITDMTSRERAIFAPLIVMTILLGVYPALVTDIIGPSTAALISNF 497


>gi|83951759|ref|ZP_00960491.1| NADH dehydrogenase subunit M [Roseovarius nubinhibens ISM]
 gi|83836765|gb|EAP76062.1| NADH dehydrogenase subunit M [Roseovarius nubinhibens ISM]
          Length = 518

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/505 (50%), Positives = 357/505 (70%), Gaps = 15/505 (2%)

Query: 6   LSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           L++ TF+P +   +  I         +R+   VAL  + + F+ S+ + + FD      Q
Sbjct: 5   LTMTTFIPLIAAAILAIFLRGEDEFAQRAAKWVALVATVLTFLVSIAILAQFDPANPGMQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           M+E   W+     Y +GVDGISIL V+LTTF+ P  I +SW ++    +EYMIAFLVLE+
Sbjct: 65  MVEEAPWL-MDIKYKMGVDGISILFVMLTTFMMPITIAASW-NVTTRVKEYMIAFLVLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I+ L  +  +   FS+         Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMFADAGTTDIVALMKHEFASESFSVLGIHVLGGMQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +    P+I ++S IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVLTPLILWMSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++ Q D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIYD
Sbjct: 303 ALAQQDMKKLIAYSSVAHMGYVTMGIFAANQQGIDGAIFQMISHGFISGALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I AYGGLV+ MP YA++ ++FTMAN+GLPGTSGFIGEFL I+ VFQ +  VA++
Sbjct: 363 RMHTREIDAYGGLVNRMPAYALIFLLFTMANVGLPGTSGFIGEFLTILGVFQVNTWVALV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP  +
Sbjct: 423 AATGVILSAGYALWLYRRVVMGELIKESLKSISDMTTRERAIFAPLVVMTLLLGVYPSLV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSDSV 497
            D     + ++I NY      + +V
Sbjct: 483 TDIIGPSVEALITNYDTAVSEAQAV 507


>gi|163741475|ref|ZP_02148866.1| NADH dehydrogenase subunit M [Phaeobacter gallaeciensis 2.10]
 gi|161385209|gb|EDQ09587.1| NADH dehydrogenase subunit M [Phaeobacter gallaeciensis 2.10]
          Length = 515

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/503 (51%), Positives = 357/503 (70%), Gaps = 15/503 (2%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   ++           +R+   VAL  +TI F+ SL ++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAILALFLRGEDEAAQRNAKSVALFATTITFLVSLGIYFQFDPSDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW  +    +EYMIAFL+LE+
Sbjct: 65  FVEEAEWI-FGLKYKMGVDGISVLFVMLTTFVMPLTILASW-GVNTRVKEYMIAFLMLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTFFGS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFFGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  ++ S   F +         Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYADAGTTDIAQLLTHSFSAGSFDLLGIHVVGGMQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +     +I ++S IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVMTDLILWMSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ+D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 ALVQSDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGFIGEFL +M  FQ +  VA +
Sbjct: 363 RMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFIGEFLTLMGTFQKNTWVAAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG      ++ +KD++ RER +  P+ V+T+  G+YP  +
Sbjct: 423 AATGVIFSAGYALWLYRRVVFGDLIKGSLKTIKDMTARERFIFAPLVVMTILLGVYPALV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSD 495
            D  S    ++I N+      +D
Sbjct: 483 TDIISPSTEALIANFNQSLAAAD 505


>gi|163746217|ref|ZP_02153576.1| NADH dehydrogenase subunit M [Oceanibulbus indolifex HEL-45]
 gi|161380962|gb|EDQ05372.1| NADH dehydrogenase subunit M [Oceanibulbus indolifex HEL-45]
          Length = 520

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/514 (50%), Positives = 362/514 (70%), Gaps = 21/514 (4%)

Query: 1   MNLPFLSIVTFLPFLGVFVI---LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           M+   LSI+TF+P     ++   L       GR + + +A   +T+ F+ SLFV   FD 
Sbjct: 1   MDTHLLSIITFVPAFAALILAVFLRGDDAAAGRNAKW-LAFITTTVTFLISLFVLFEFDP 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             + FQ ++   W+     Y LGVDGISIL V+LTTF+ P  I +SW +++   +EYMIA
Sbjct: 60  SNTDFQFVDEADWL-LGLKYRLGVDGISILFVMLTTFMMPLVIAASW-NVEHRVKEYMIA 117

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ 
Sbjct: 118 FLLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVL 177

Query: 178 MLFAIVVMCWEKKTSSI----IDL----YAMSKFPF-------SIQYWMWIAFFCSFAIK 222
           ML A+V M  E  T+ I    I L    +    F          +Q  M++AFF SFA+K
Sbjct: 178 MLVAMVAMFTEAGTTCIGGCEISLLTHNFGSDNFELLGIQVVGGMQTLMFLAFFASFAVK 237

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PM+P HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ ++   P+I ++S
Sbjct: 238 MPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGAEVMTPLILWMS 297

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSA 342
            IAI+Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S A
Sbjct: 298 AIAIVYTSLVALVQQDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMISHGFISGA 357

Query: 343 LFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSV 402
           LF  VGVIYDR+HTRDI AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL +M+ 
Sbjct: 358 LFLSVGVIYDRMHTRDIDAYGGLVNRMPAYAMVFMFFTMANVGLPGTSGFVGEFLTLMAT 417

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLT 462
           FQ +  VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D++ RE+ ++ P+  +T
Sbjct: 418 FQVNTWVAAVATTGVIFSAAYALWLYRRVVMGDLIKESLKAITDMTAREKWIIAPLVAMT 477

Query: 463 VFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDS 496
           +  G+YP  + D     +++++ENY +    +D+
Sbjct: 478 LILGVYPALVLDMIGPSVAALVENYDMALEAADT 511


>gi|254474527|ref|ZP_05087913.1| NADH dehydrogenase i, m subunit [Ruegeria sp. R11]
 gi|214028770|gb|EEB69605.1| NADH dehydrogenase i, m subunit [Ruegeria sp. R11]
          Length = 515

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/503 (51%), Positives = 360/503 (71%), Gaps = 15/503 (2%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   ++           +R+   VAL  +TI F+ SL ++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAILALFLRGEDEAAQRNAKYVALFATTITFLVSLGIYFEFDPANTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW  ++   +EYMIAFL+LE+
Sbjct: 65  FVEEAEWI-FGLKYKMGVDGISVLFVMLTTFVMPLTILASWD-VKTRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTFFGS+ ML A++
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFFGSVLMLIAMI 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  ++ S   F +         Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMFADAGTTDIEALLTHSFSAGSFDVLGIHIVGGMQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ ++    ++ ++S IAI+Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGAEVMTDLVLWMSAIAIVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 AIVQDDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGFIGEFL +M  FQ +  VA++
Sbjct: 363 RMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFIGEFLTLMGTFQKNTWVAMI 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG    E ++ +KD++ RER +  P+ ++T+  G+YP  +
Sbjct: 423 ATTGVIFSAGYALWLYRRVVFGDLIKESLKTIKDMTARERFIFAPLVIMTILLGVYPAVV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSD 495
            D  S    ++I N+      +D
Sbjct: 483 TDIISPSTEALIANFNQSLAAAD 505


>gi|163738814|ref|ZP_02146228.1| NADH dehydrogenase subunit M [Phaeobacter gallaeciensis BS107]
 gi|161388142|gb|EDQ12497.1| NADH dehydrogenase subunit M [Phaeobacter gallaeciensis BS107]
          Length = 515

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/503 (51%), Positives = 357/503 (70%), Gaps = 15/503 (2%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   ++           +R+   VAL  +TI F+ SL ++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAILALFLRGEDEAAQRNAKSVALFATTITFLVSLGIYFQFDPSDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW  +    +EYMIAFL+LE+
Sbjct: 65  FVEEAEWI-FGLKYKMGVDGISVLFVMLTTFVMPLTILASW-GVNTRVKEYMIAFLMLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTFFGS+ ML A+V
Sbjct: 123 LMLGVFIALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFFGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  ++ S   F +         Q  +++AFF SFA+K+PM+P HTWL
Sbjct: 183 AMYADAGTTDIAQLLTHSFSAGSFDLLGIHVVGGMQTLLFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +     +I ++S IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVMTDLILWMSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQ+D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 ALVQSDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGFIGEFL +M  FQ +  VA +
Sbjct: 363 RMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFIGEFLTLMGTFQKNTWVAAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG      ++ +KD++ RER +  P+ V+T+  G+YP  +
Sbjct: 423 AATGVIFSAGYALWLYRRVVFGDLIKGSLKTIKDMTARERFIFAPLVVMTILLGVYPALV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSD 495
            D  S    ++I N+      +D
Sbjct: 483 TDIISPSTEALIANFNESLAAAD 505


>gi|266663|sp|P29925|NQO13_PARDE RecName: Full=NADH-quinone oxidoreductase chain 13; AltName:
           Full=NADH dehydrogenase I, chain 13; AltName:
           Full=NDH-1, chain 13
 gi|150615|gb|AAA25599.1| NADH dehydrogenase [Paracoccus denitrificans]
          Length = 513

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/497 (51%), Positives = 353/497 (71%), Gaps = 17/497 (3%)

Query: 6   LSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI+TFLP +   +  +          R+   +AL  +T  F+ SLFV   FD   + FQ
Sbjct: 5   LSIITFLPIVAAIIMALFLRGQDEAAARNAKWLALLTTTATFVISLFVLFRFDPANTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E + WI   C Y +GVDGIS+L V+LTTF+ P  ILS+W+ +Q+  +EYMIAFLVLE 
Sbjct: 65  FVEDHAWIMGVC-YKMGVDGISVLFVLLTTFMMPLTILSTWQ-VQDKVKEYMIAFLVLEG 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A++
Sbjct: 123 LMIGVFTALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAMI 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMFPFHTW 231
            M     T+ I  L     FP              +Q  +++AFF SFA+K+PM+P HTW
Sbjct: 183 AMYRMAGTTDIPTLLTF-DFPSENFRLLGMTVVGGMQMLLFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA ++LKMGGYG +RF LP+FP+AS    P +F+LS IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVLLAAVLLKMGGYGFLRFSLPMFPVASGVAQPYVFWLSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++ Q+D+KK+IAYSS+AHMGYVT+G+F+  + GV+GA+FQMLSHG +S ALF CVGVIY
Sbjct: 302 VALAQSDMKKVIAYSSVAHMGYVTMGVFAANQIGVDGAIFQMLSHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA V M FTMAN+GLPGTSGF+GEFL +M VF+    VA+
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYAAVFMFFTMANVGLPGTSGFVGEFLTLMGVFRVDTWVAL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+V  G    E ++ + D++ RER +  P+  +T+  G+YP  
Sbjct: 422 VATSGVILSAAYALWLYRRVTLGQLIKESLKSITDMTPRERWVFIPLIAMTLILGVYPRL 481

Query: 472 IRDTFSVPLSSIIENYT 488
           + D     +++++++Y 
Sbjct: 482 VTDVTGPAVAALVQDYN 498


>gi|197105255|ref|YP_002130632.1| NADH dehydrogenase I, M subunit [Phenylobacterium zucineum HLK1]
 gi|196478675|gb|ACG78203.1| NADH dehydrogenase I, M subunit [Phenylobacterium zucineum HLK1]
          Length = 494

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/495 (52%), Positives = 346/495 (69%), Gaps = 7/495 (1%)

Query: 3   LPFLSIVTFLPFLGVFVILFSSYLG-----CGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           +P LS++T+ P +GV  IL     G         +   +A   +   F  S+ +   FD 
Sbjct: 1   MPLLSLITYAPLVGVAGILALRLFGRPDDAKAVEASKWIAFVTTLATFALSVLLVVQFDP 60

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
               FQ +E   W     SY +GVDGIS+L V+LT FL P CI +SW+SI++   EYMIA
Sbjct: 61  ANPGFQFVEEVPWFASL-SYRMGVDGISVLFVLLTAFLMPLCIAASWRSIEKRVPEYMIA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FLVLE++VIG F +LD++LFYIFFE  L+PMF+IIG+WGG+ R+YAA+KFFLYT  GS+ 
Sbjct: 120 FLVLETLVIGVFCALDLVLFYIFFEFGLVPMFLIIGIWGGARRVYAAFKFFLYTLLGSVL 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML AI+ M     TSSI +L A    P  +Q W+W+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 180 MLAAILFMIASTGTSSIPELMAYDFAP-GVQTWLWLAFFASFAVKMPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAGI+LKMGGYG +RF LP+FP AS  FAP++F LS+IAI+Y SLV+  QT
Sbjct: 239 EAPTAGSVILAGILLKMGGYGFMRFSLPMFPNASDLFAPLVFALSVIAIVYTSLVAFRQT 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMG+VT+GIFSG   G +GA+FQM+SHG++S ALF CVGV+YDR+HTR
Sbjct: 299 DIKKLIAYSSVAHMGFVTMGIFSGNAQGEQGALFQMISHGVISGALFLCVGVVYDRMHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGGLV+ MP YA V M+FTM N+GLPGTSGF+GE L +  V+Q S   A++A+ GV
Sbjct: 359 EIAFYGGLVNRMPWYAAVFMLFTMGNVGLPGTSGFVGEILTMTGVYQASTWTALVAATGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA+Y+L LYR+V+FG     K+  + DL  RE  +  P+ V T++ G+ P  + D  +
Sbjct: 419 ILSAMYALTLYRRVIFGELTNPKLAAITDLDWREVAIFAPLIVSTLYLGVQPNVVFDLTA 478

Query: 478 VPLSSIIENYTLKTG 492
             +  ++  Y    G
Sbjct: 479 ASVDQLVAAYQAAVG 493


>gi|89053686|ref|YP_509137.1| NADH dehydrogenase subunit M [Jannaschia sp. CCS1]
 gi|88863235|gb|ABD54112.1| NADH dehydrogenase subunit M [Jannaschia sp. CCS1]
          Length = 514

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 260/499 (52%), Positives = 357/499 (71%), Gaps = 15/499 (3%)

Query: 5   FLSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            +SIVTFLP +   +  +         + +   +A   +   F+ S+F+   FD   + F
Sbjct: 4   LISIVTFLPLVAAIIMAVFLRGEDEAAQLNAKRLAFAATAATFLVSIFLLVQFDASNTDF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q++E   W+ +  +Y +GVDGISIL V+LTTFL P  I + W S++   +EYMIA L+LE
Sbjct: 64  QLVEEAPWL-FGLTYKVGVDGISILFVMLTTFLMPITIAACW-SVKTRVKEYMIALLILE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F++LDM+LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMIGVFVALDMVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL----YAMSKFPFS-------IQYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L    +    F  +       +Q  +++AFF SFA+K+PM+P HTW
Sbjct: 182 VAMYVDAGTTDIPTLLNHNFGTETFTVAGFTVVGGLQTMLFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+AS  FAP+I +LS+IAIIY SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVASDIFAPLILWLSVIAIIYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+MVQ D+KKLIAYSS+AHMG+VT+GIF+  ++GV+GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VAMVQEDMKKLIAYSSVAHMGFVTMGIFAANQNGVDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTRDI AYGGLV  MP YA + M+FTMAN+GLPGTSGF+GEFL ++ VFQ +  + +
Sbjct: 362 DRMHTRDIDAYGGLVVRMPAYAAIFMLFTMANVGLPGTSGFVGEFLTLIGVFQVNTWIGL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           LA  GV+LSA Y+LWLYR+VVFG    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 422 LACTGVILSASYALWLYRRVVFGDLIKESLKSITDMTRRERAIFAPLVVMTILLGVYPSL 481

Query: 472 IRDTFSVPLSSIIENYTLK 490
           + D     + +++ NY L 
Sbjct: 482 VTDIIGPSVEALVTNYELA 500


>gi|126729573|ref|ZP_01745386.1| NADH dehydrogenase subunit M [Sagittula stellata E-37]
 gi|126709692|gb|EBA08745.1| NADH dehydrogenase subunit M [Sagittula stellata E-37]
          Length = 522

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 266/503 (52%), Positives = 356/503 (70%), Gaps = 21/503 (4%)

Query: 5   FLSIVTFLPFLGVF---VILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            LSIVTFLP L      V L  S     R + + +AL  +T  FI SLF+ + FD   + 
Sbjct: 4   LLSIVTFLPALAALILAVFLRGSDAAAQRNAKY-LALIATTATFIISLFILAQFDPSNTG 62

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQM+E   W+    SY +GVDGIS+L V+LTTF+ P  I +SW ++     EYMIAFL+L
Sbjct: 63  FQMVEEGEWL-MGLSYRMGVDGISVLFVMLTTFMMPLVIWASW-NVTHRVTEYMIAFLML 120

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E++++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A
Sbjct: 121 ETLMLGVFMALDLVLFYVFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVA 180

Query: 182 IVVMCWEKKTSSI--------IDLYAMSKFPF-------SIQYWMWIAFFCSFAIKIPMF 226
           +V M  +  T+ I           +A   F          +Q  +++AFF SFA+K+PM+
Sbjct: 181 MVAMYADAGTTCIGACDVSLLTHQFASDDFSVLGITVVGGLQTMLFLAFFASFAVKMPMW 240

Query: 227 PFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAI 286
           P HTWLP AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   A  +F LS++AI
Sbjct: 241 PVHTWLPEAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVMANFVFTLSVVAI 300

Query: 287 IYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFC 346
           IY SLV++VQ D+KKLIAYSS+AHMGYVT+GIF+  + GV+GA+FQM+SHG +S ALF C
Sbjct: 301 IYTSLVALVQEDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMISHGFISGALFLC 360

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGVIYDR+HTR+I AYGGLV+ MP YA++ M+FTMAN+GLPGTSGFIGEFL +  VFQ +
Sbjct: 361 VGVIYDRMHTREIDAYGGLVNRMPAYALIFMLFTMANVGLPGTSGFIGEFLTLAGVFQVN 420

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             VA  A+ GV+LSA Y+LWLYR+VV G    E ++ +KD++ RE+ +  P+  +T++ G
Sbjct: 421 TWVAAGAATGVILSAAYALWLYRRVVMGDLIKESLKTIKDMTAREKAIFAPLVFMTIWMG 480

Query: 467 IYPVPIRDTFSVPLSSIIENYTL 489
           +YP PI D     + +++ NY +
Sbjct: 481 VYPAPILDRIGPSVEALVSNYDM 503


>gi|126740393|ref|ZP_01756081.1| NADH dehydrogenase subunit M [Roseobacter sp. SK209-2-6]
 gi|126718529|gb|EBA15243.1| NADH dehydrogenase subunit M [Roseobacter sp. SK209-2-6]
          Length = 515

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/507 (51%), Positives = 358/507 (70%), Gaps = 21/507 (4%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   V+           +R+   +AL  ++  F+ SL +++ FD   + FQ
Sbjct: 5   LSIVTFVPALAAAVMALLMRGEDAAAQRNAKWLALIATSFTFLLSLGIYAQFDPNDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E Y WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW ++    +EYMIAFL+LE+
Sbjct: 65  FVENYEWI-FGLQYKMGVDGISVLFVLLTTFVMPLTILASW-NVTTRVKEYMIAFLMLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPMFPFH 229
            M  +  T+   D+ A+ K  FS              +Q  M++AFF SFA+K+PM+P H
Sbjct: 183 AMYADAGTT---DIEALLKHSFSAGSFDVLGIHVVGGMQTLMFLAFFASFAVKMPMWPVH 239

Query: 230 TWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYA 289
           TWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +     +I ++S IA++Y 
Sbjct: 240 TWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVMTDLILWMSAIAVVYT 299

Query: 290 SLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           SLV+MVQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGV
Sbjct: 300 SLVAMVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGV 359

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           IYDR+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGF+GEFL +M  FQ +  V
Sbjct: 360 IYDRMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFVGEFLTLMGTFQKNTWV 419

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A +A+ GV+ SA Y+LWLYR+VVFG      ++ ++D+  RER +  P+  +T+  G+YP
Sbjct: 420 AAVAASGVIFSAGYALWLYRRVVFGDLIKGSLKTIQDMDARERFIFAPLVGMTILLGVYP 479

Query: 470 VPIRDTFSVPLSSIIENYTLKTGYSDS 496
             + D      +++IEN+      +D+
Sbjct: 480 SLVTDIIGPSTAALIENFNHSLASADT 506


>gi|254437407|ref|ZP_05050901.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Octadecabacter antarcticus 307]
 gi|198252853|gb|EDY77167.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Octadecabacter antarcticus 307]
          Length = 513

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/497 (51%), Positives = 357/497 (71%), Gaps = 21/497 (4%)

Query: 6   LSIVTFLPFL--GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI TF+P +  G+  +         +R+   +A+  +T+ F+ SLF+   FD   + FQ
Sbjct: 5   LSITTFIPAIAAGILAVFLRDDNEAAQRNAKWLAMAATTMTFLVSLFILFGFDAQDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI    +Y +GVDGISIL V+LTTFL P  I S W ++    +EYMIAFL+LE+
Sbjct: 65  FVEERTWI-MGLNYKMGVDGISILFVMLTTFLMPIVIASCW-TVNTRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPMFPFH 229
            M     T+   D+ ++  FPF+              +Q  +W+AFF SFA+K+PM+P H
Sbjct: 183 GMFSAAGTT---DIPSLMGFPFNTDDFAILGIQIVGGMQTLLWLAFFASFAVKMPMWPVH 239

Query: 230 TWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYA 289
           TWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   AP++ ++S IAI+Y 
Sbjct: 240 TWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVMAPLVLWMSAIAIVYT 299

Query: 290 SLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S ALF CVGV
Sbjct: 300 SLVALVQEDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFISGALFLCVGV 359

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           IYDR+HTR+I AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ VFQ +  V
Sbjct: 360 IYDRMHTREIDAYGGLVNRMPAYAMIFMFFTMANVGLPGTSGFVGEFLTLVGVFQVNTWV 419

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP
Sbjct: 420 AAVATSGVILSAAYALWLYRRVVMGDLIKESLKTITDMTTRERWIFTPLVVMTLLLGVYP 479

Query: 470 VPIRDTFSVPLSSIIEN 486
             + D     ++++++ 
Sbjct: 480 ALVTDIIGPSVAALVDQ 496


>gi|119384964|ref|YP_916020.1| NADH dehydrogenase subunit M [Paracoccus denitrificans PD1222]
 gi|119374731|gb|ABL70324.1| NADH dehydrogenase subunit M [Paracoccus denitrificans PD1222]
          Length = 513

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 257/497 (51%), Positives = 352/497 (70%), Gaps = 17/497 (3%)

Query: 6   LSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI+TFLP +   +  +          R+   +AL  +T  F+ SLFV   FD   + FQ
Sbjct: 5   LSIITFLPIVAAIIMALFLRGQDEAAARNAKWLALLTTTATFVISLFVLFRFDPANTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E + WI     Y +GVDGIS+L V+LTTF+ P  ILS+W+ +Q+  +EYMIAFLVLE 
Sbjct: 65  FVEDHAWI-MGLRYKMGVDGISVLFVLLTTFMMPLTILSTWQ-VQDKVKEYMIAFLVLEG 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYTF GS+ ML A++
Sbjct: 123 LMIGVFTALDLVLFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTFLGSVLMLVAMI 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMFPFHTW 231
            M     T+ I  L     FP              +Q  +++AFF SFA+K+PM+P HTW
Sbjct: 183 AMYRMAGTTDIPTLLTFD-FPSENFRLLGMTVVGGMQMLLFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA ++LKMGGYG +RF LP+FP+AS    P +F+LS IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVLLAAVLLKMGGYGFLRFSLPMFPVASGVAQPYVFWLSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++ Q+D+KK+IAYSS+AHMGYVT+G+F+  + GV+GA+FQMLSHG +S ALF CVGVIY
Sbjct: 302 VALAQSDMKKVIAYSSVAHMGYVTMGVFAANQIGVDGAIFQMLSHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA V M FTMAN+GLPGTSGF+GEFL +M VF+    VA+
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYAAVFMFFTMANVGLPGTSGFVGEFLTLMGVFRVDTWVAL 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+V  G    E ++ + D++ RER +  P+  +T+  G+YP  
Sbjct: 422 VATSGVILSAAYALWLYRRVTLGQLIKESLKSITDMTPRERWVFIPLIAMTLILGVYPRL 481

Query: 472 IRDTFSVPLSSIIENYT 488
           + D     +++++++Y 
Sbjct: 482 VTDVTGPAVAALVQDYN 498


>gi|254450084|ref|ZP_05063521.1| NADH-quinone oxidoreductase chain m [Octadecabacter antarcticus
           238]
 gi|198264490|gb|EDY88760.1| NADH-quinone oxidoreductase chain m [Octadecabacter antarcticus
           238]
          Length = 513

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 256/510 (50%), Positives = 361/510 (70%), Gaps = 22/510 (4%)

Query: 6   LSIVTFLPFL--GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSI TF+P +  G+  +         +R+   +A+  + + F+ SLF+   F+   + FQ
Sbjct: 5   LSITTFIPAIAAGILALFLRGDDEAAQRNAKWLAMAATAMTFLVSLFILIGFNPQDTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI    +Y +GVDGISIL V+LTTFL P  I S W S+    +EYMIAFL+LE+
Sbjct: 65  FVEERTWI-MGLNYKMGVDGISILFVMLTTFLMPIVIASCW-SVNTRVKEYMIAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPMFPFH 229
            M     T+   D+ ++  FPF               +Q  +W+AFF SFA+K+PM+PFH
Sbjct: 183 GMYSAAGTT---DIPSLMGFPFGTDDFAILGIQIVGGMQTLLWLAFFASFAVKMPMWPFH 239

Query: 230 TWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYA 289
           TWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   AP++ ++S IAI+Y 
Sbjct: 240 TWLPDAHVQAPTAGSVVLASILLKMGGYGFLRFSLPMFPVGSDVMAPLVLWMSAIAIVYT 299

Query: 290 SLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG ++ ALF CVGV
Sbjct: 300 SLVALVQEDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFIAGALFLCVGV 359

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           IYDR+HTRDI AYGGLV+ MP YA++ M FTMAN+GLPGTSGF+GEFL ++ VFQ +  V
Sbjct: 360 IYDRMHTRDIDAYGGLVNRMPAYAMIFMFFTMANVGLPGTSGFVGEFLTLVGVFQVNTWV 419

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RER +  P+ ++T+  GIYP
Sbjct: 420 AAVATSGVILSAAYALWLYRRVVMGDLIKESLKTITDMTTRERWIFTPLVIMTLLLGIYP 479

Query: 470 VPIRDTFSVPLSS-IIENYTLKTGYSDSVK 498
             + D     +++ +++  T +  Y  + +
Sbjct: 480 ALVTDIIGPSVTALVVQVETAQAAYDAATQ 509


>gi|254465739|ref|ZP_05079150.1| NADH dehydrogenase i, m subunit [Rhodobacterales bacterium Y4I]
 gi|206686647|gb|EDZ47129.1| NADH dehydrogenase i, m subunit [Rhodobacterales bacterium Y4I]
          Length = 515

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 261/504 (51%), Positives = 354/504 (70%), Gaps = 15/504 (2%)

Query: 6   LSIVTFLPFLGVFVILF--SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LSIVTF+P L   ++           +R+   VAL  +TI F+ SL ++  FD   + FQ
Sbjct: 5   LSIVTFIPALAAAILALFLRGEDKAAQRNAKFVALFATTITFLVSLGIYFEFDPNNTGFQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E   WI +   Y +GVDGIS+L V+LTTF+ P  IL+SW ++    +EYM+AFL+LE+
Sbjct: 65  FVEDAEWI-FGLKYKMGVDGISVLFVMLTTFIMPLTILASW-NVTTRVKEYMVAFLLLET 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++LD++LFY+FFEA LIPMF+IIG+WGG ERIYA++KFFLYTFFGS+ ML A+V
Sbjct: 123 LMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKERIYASFKFFLYTFFGSVLMLVAMV 182

Query: 184 VMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTWL 232
            M  +  T+ I  L  ++ S   F +         Q  M++AFF SFA+K+PM+P HTWL
Sbjct: 183 FMYVDAGTTDIETLLTHSFSAASFDVLGIHIVGGAQTLMFLAFFASFAVKMPMWPVHTWL 242

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ +     V+ ++S IA++Y SLV
Sbjct: 243 PDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGADVMTDVVLWMSAIAVVYTSLV 302

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           +MVQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQMLSHG +S+ALF CVGVIYD
Sbjct: 303 AMVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGIDGAIFQMLSHGFISAALFLCVGVIYD 362

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTRDI AYGGLV  MP YA+V M FTM N+GLPGTSGFIGEFL +M  FQ +  V  +
Sbjct: 363 RMHTRDIDAYGGLVIRMPAYALVFMFFTMGNVGLPGTSGFIGEFLTLMGTFQKNTWVTAV 422

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+ SA Y+LWLYR+VVFG      +  +KD+S RER +  P+  +T+  GIYP  +
Sbjct: 423 AATGVIFSAGYALWLYRRVVFGDLIKGSLMGIKDMSARERFVFAPLIAMTLILGIYPAVV 482

Query: 473 RDTFSVPLSSIIENYTLKTGYSDS 496
            D       ++I N+      +D+
Sbjct: 483 TDIIGPSTEALIANFNQSLAAADT 506


>gi|294677073|ref|YP_003577688.1| NADH-quinone oxidoreductase subunit M [Rhodobacter capsulatus SB
           1003]
 gi|1709413|sp|P50974|NUOM_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|3282578|gb|AAC25004.1| NUOM [Rhodobacter capsulatus]
 gi|294475893|gb|ADE85281.1| NADH-quinone oxidoreductase, M subunit [Rhodobacter capsulatus SB
           1003]
 gi|1586527|prf||2204231H NADH ubiquinone oxidoreductase
          Length = 512

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/477 (52%), Positives = 340/477 (71%), Gaps = 14/477 (2%)

Query: 28  CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIL 87
              R+   VAL  + + F+ SL + + FD      Q +E   WI     Y LGVDGISIL
Sbjct: 29  AADRNAKWVALTATVVTFLVSLLLLAGFDPANPGMQFVEDRAWI-MGLHYKLGVDGISIL 87

Query: 88  LVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIP 147
            V+LTTFL P  I S+W  ++   +EYMIAFLVLE+++IG F++LD++LFY+FFEA LIP
Sbjct: 88  FVMLTTFLMPLTIASAWH-VETRVKEYMIAFLVLEALMIGVFVALDLVLFYLFFEAGLIP 146

Query: 148 MFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDL----YAMSKF 203
           MF+IIG+WGG ERIYAA+KFFLYTF GS+ ML A+V M     T+ I+ L    +  +  
Sbjct: 147 MFLIIGIWGGKERIYAAFKFFLYTFLGSVLMLVAMVAMYMMAGTTDIVTLMSFDFPHADL 206

Query: 204 PF--------SIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMG 255
           PF         +Q  +++AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LA ++LKMG
Sbjct: 207 PFLGWWTLTGGVQTLLFLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVVLAAVLLKMG 266

Query: 256 GYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVT 315
           GYG +RF LP+FP+ ++     +F LS +AI+Y SLV++ Q D+KKLIAYSS+AHMGYVT
Sbjct: 267 GYGFLRFSLPMFPVGAETMTTFVFILSAVAIVYTSLVALAQEDMKKLIAYSSVAHMGYVT 326

Query: 316 IGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVV 375
           +GIF+  + GV+GA+FQMLSHG +S ALF CVGVIYDR+HTR+I AYGGLV+ MP YA++
Sbjct: 327 MGIFAANQQGVDGAIFQMLSHGFISGALFLCVGVIYDRMHTREIAAYGGLVNRMPAYALI 386

Query: 376 MMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGV 435
            M FTMAN+GLPGTSGF+GEFL ++ +FQ +  VA+ A+ GV+LSA Y+LWLYR+VVFG 
Sbjct: 387 FMFFTMANVGLPGTSGFVGEFLTLLGIFQVNTWVALFATSGVILSAAYALWLYRRVVFGE 446

Query: 436 SKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTG 492
              E ++ + D++ RE+ +  P+  +T+  G+YP  + D     ++ +++NY    G
Sbjct: 447 LVKESLKTISDMTTREKAIFAPLVAMTLLLGVYPSLVTDLIGPSVAHLVQNYHADLG 503


>gi|16126181|ref|NP_420745.1| NADH dehydrogenase subunit M [Caulobacter crescentus CB15]
 gi|13423395|gb|AAK23913.1| NADH dehydrogenase I, M subunit [Caulobacter crescentus CB15]
          Length = 494

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 260/492 (52%), Positives = 348/492 (70%), Gaps = 6/492 (1%)

Query: 5   FLSIVTFLPFLGVFVILFSSYL-GCGRRS---FFGVALGISTINFIFSLFVWSVFDKGRS 60
            LS+ TF P  GV VIL +  L G G ++      +AL  + + F  S+ +   FD    
Sbjct: 4   LLSLTTFAPLAGVAVILAARALHGAGEKTDTLAKWIALVTTLVTFGLSIVLTVQFDPKNP 63

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W      Y +GVDGIS+L V+LT FL P CI++SWKS+++   EY+IAFLV
Sbjct: 64  GFQFVEDIAWFAGL-HYRMGVDGISVLFVLLTAFLLPICIVASWKSVEKRVVEYLIAFLV 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++VIG F +LD++LFY+FFE  L+PMF+IIG+WGG  RIYAAYKFFLYT  GS+ ML 
Sbjct: 123 LETLVIGVFCALDIVLFYLFFEGGLVPMFLIIGIWGGKRRIYAAYKFFLYTLLGSVLMLA 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M     TSSI +L    KF   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AILAMIGISGTSSIPELMTF-KFAPWLQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LKMGGYG +RF LP+FP AS+ F P++F LS IAI+Y SLV+  QTDIK
Sbjct: 242 TAGSVILAGILLKMGGYGFMRFSLPMFPNASEMFQPLVFALSAIAIVYTSLVAFRQTDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIFSG  +G +GA+FQMLSHG++S ALF CVGV+YDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMGFVTMGIFSGNAAGEQGALFQMLSHGIISGALFLCVGVVYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL + MP YA V M+FTM N+GLPGTSGF+GE L +  V++ S   A++++ GV+LS
Sbjct: 362 FYGGLTNRMPMYAAVFMLFTMGNVGLPGTSGFVGEILTMTGVYKASTWTAIVSALGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A+Y+L LYR+V+FG     ++  + DL  RE  +  P+ V T+  GIYP  + +  +  +
Sbjct: 422 AMYALTLYRRVMFGEITNPQLATITDLDKREILIFAPLIVSTLVLGIYPNLVFNLTATSV 481

Query: 481 SSIIENYTLKTG 492
            +++  +    G
Sbjct: 482 DALVGAWRAAVG 493


>gi|221234953|ref|YP_002517389.1| NADH dehydrogenase subunit M [Caulobacter crescentus NA1000]
 gi|220964125|gb|ACL95481.1| NADH-quinone oxidoreductase chain M [Caulobacter crescentus NA1000]
          Length = 500

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 260/492 (52%), Positives = 348/492 (70%), Gaps = 6/492 (1%)

Query: 5   FLSIVTFLPFLGVFVILFSSYL-GCGRRS---FFGVALGISTINFIFSLFVWSVFDKGRS 60
            LS+ TF P  GV VIL +  L G G ++      +AL  + + F  S+ +   FD    
Sbjct: 10  LLSLTTFAPLAGVAVILAARALHGAGEKTDTLAKWIALVTTLVTFGLSIVLTVQFDPKNP 69

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W      Y +GVDGIS+L V+LT FL P CI++SWKS+++   EY+IAFLV
Sbjct: 70  GFQFVEDIAWFAGL-HYRMGVDGISVLFVLLTAFLLPICIVASWKSVEKRVVEYLIAFLV 128

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++VIG F +LD++LFY+FFE  L+PMF+IIG+WGG  RIYAAYKFFLYT  GS+ ML 
Sbjct: 129 LETLVIGVFCALDIVLFYLFFEGGLVPMFLIIGIWGGKRRIYAAYKFFLYTLLGSVLMLA 188

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M     TSSI +L    KF   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 189 AILAMIGISGTSSIPELMTF-KFAPWLQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 247

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LKMGGYG +RF LP+FP AS+ F P++F LS IAI+Y SLV+  QTDIK
Sbjct: 248 TAGSVILAGILLKMGGYGFMRFSLPMFPNASEMFQPLVFALSAIAIVYTSLVAFRQTDIK 307

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIFSG  +G +GA+FQMLSHG++S ALF CVGV+YDR+HTR+I 
Sbjct: 308 KLIAYSSVAHMGFVTMGIFSGNAAGEQGALFQMLSHGIISGALFLCVGVVYDRMHTREIA 367

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL + MP YA V M+FTM N+GLPGTSGF+GE L +  V++ S   A++++ GV+LS
Sbjct: 368 FYGGLTNRMPMYAAVFMLFTMGNVGLPGTSGFVGEILTMTGVYKASTWTAIVSALGVILS 427

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A+Y+L LYR+V+FG     ++  + DL  RE  +  P+ V T+  GIYP  + +  +  +
Sbjct: 428 AMYALTLYRRVMFGEITNPQLATITDLDKREILIFAPLIVSTLVLGIYPNLVFNLTATSV 487

Query: 481 SSIIENYTLKTG 492
            +++  +    G
Sbjct: 488 DALVGAWRAAVG 499


>gi|329889343|ref|ZP_08267686.1| NADH-quinone oxidoreductase subunit M [Brevundimonas diminuta ATCC
           11568]
 gi|328844644|gb|EGF94208.1| NADH-quinone oxidoreductase subunit M [Brevundimonas diminuta ATCC
           11568]
          Length = 501

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 260/492 (52%), Positives = 347/492 (70%), Gaps = 7/492 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFG-----VALGISTINFIFSLFVWSVFDKGRS 60
           LSIVTFLP LG   IL +  L  G +         +AL  + +    S+ + + FD    
Sbjct: 11  LSIVTFLPLLGAAAILVARLLNKGGQDAAAPAARWIALITTMVVLAVSVLLVAQFDPSNP 70

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           ++Q +E Y W      YHLGVDGISIL V+LT FL P CI++SWKSI+    EYMIAFL+
Sbjct: 71  AYQFVENYAWFAG-AGYHLGVDGISILFVLLTAFLLPICIVASWKSIETRVVEYMIAFLI 129

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+MVIG F SLD+ LFYIFFE +L+PM++IIG+WGG+ RIYAAYKFFLYT  GS+ ML 
Sbjct: 130 LETMVIGVFTSLDLFLFYIFFEGTLVPMYLIIGIWGGANRIYAAYKFFLYTLLGSVLMLL 189

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M     T+SI +L   +  P ++Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 190 AMLWMAHTTGTTSIPELKQYAFDP-AVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 248

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG I F +P+FPLASQ F P++  LS+IA++Y SLV+  QTDIK
Sbjct: 249 TAGSVILAGILLKLGGYGFILFNIPMFPLASQMFTPLVLTLSVIAVVYTSLVAFRQTDIK 308

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIF+G  +GV+GA+FQMLSHGL+S ALF CVGV+YDR+HTR+I 
Sbjct: 309 KLIAYSSVAHMGFVTMGIFAGNDTGVQGAVFQMLSHGLISGALFLCVGVVYDRMHTREIA 368

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL   MP YA + ++FTMAN+GLPGTSGFIGE L +   +Q S   A++A+ GV+ S
Sbjct: 369 FYGGLTARMPWYAAIFLMFTMANVGLPGTSGFIGEVLTMTGAYQVSTWAALIAASGVIFS 428

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A+Y+L L+R V++G      ++ + D+  RE  +  P+ V T++ G+YP  + D     +
Sbjct: 429 AVYALTLFRNVMYGPITNPALESITDIDKRELLIFVPLIVGTIWLGLYPNAVLDYTGPTV 488

Query: 481 SSIIENYTLKTG 492
            ++   Y    G
Sbjct: 489 EALTSAYRAAIG 500


>gi|295689612|ref|YP_003593305.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Caulobacter segnis ATCC 21756]
 gi|295431515|gb|ADG10687.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Caulobacter segnis ATCC 21756]
          Length = 494

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 255/468 (54%), Positives = 342/468 (73%), Gaps = 6/468 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYL-GCGRRSFF---GVALGISTINFIFSLFVWSVFDKGRSS 61
           LS+ TF P +GV VIL +  L G G ++      +AL  + + F  S+ +   FD     
Sbjct: 5   LSLTTFAPIVGVAVILAARALHGAGEKTDVLAKWIALVTTLVTFGLSIVLTVQFDPKNPG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           FQ +E + W      Y +GVDGIS+L V+LT FL P CI++SWKS+++   EY+IAFLVL
Sbjct: 65  FQFVEDFAWFAGL-HYRMGVDGISVLFVLLTAFLLPICIIASWKSVEKRVVEYLIAFLVL 123

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E++VIG F +LD++LFY+FFE  L+PMF+IIG+WGG  R+YAAYKFFLYT  GS+ ML A
Sbjct: 124 ETLVIGVFAALDLVLFYLFFEFGLVPMFLIIGIWGGKRRVYAAYKFFLYTLLGSVLMLAA 183

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           I+ M     TSSI  L    KF   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 184 ILAMISISGTSSIPALMTF-KFAPWLQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAGI+LKMGGYG +RF LP+FP AS+ F P++F +S IAI+Y SLV+  QTDIKK
Sbjct: 243 AGSVILAGILLKMGGYGFMRFSLPMFPHASEMFQPLVFAMSAIAIVYTSLVAFRQTDIKK 302

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+GIFSG  +G +GA+FQMLSHG++S ALF CVGV+YDR+HTR+I  
Sbjct: 303 LIAYSSVAHMGFVTMGIFSGNAAGEQGALFQMLSHGVISGALFLCVGVVYDRMHTREIAF 362

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGL + MP YA V ++FTM N+GLPGTSGF+GE L +  V++ S   A++A+ GV+LSA
Sbjct: 363 YGGLTNRMPHYAFVFLLFTMGNVGLPGTSGFVGEILTMTGVYKASTWTAIVAATGVILSA 422

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           +Y+L LYR+V++G     +++ + DL  RE  +  P+ ++T+  GIYP
Sbjct: 423 MYALTLYRRVMYGEITNPELKTITDLDAREILLFVPLIIMTLVLGIYP 470


>gi|254460993|ref|ZP_05074409.1| NADH-quinone oxidoreductase chain m [Rhodobacterales bacterium
           HTCC2083]
 gi|206677582|gb|EDZ42069.1| NADH-quinone oxidoreductase chain m [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 514

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 352/496 (70%), Gaps = 15/496 (3%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLG--CGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSIVTF+P L   ++            R+   +A+  ++  F  SLF+   FD   + F
Sbjct: 4   LLSIVTFIPALAALILALFLRGNDEAAARNAKWLAMIATSATFFVSLFILFQFDSSSTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           QM+E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW  +    +EYMIAFL+LE
Sbjct: 64  QMVEEASWV-MGMQYKMGVDGISVLFVMLTTFMMPLVIAASWD-VNTRVKEYMIAFLLLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ ML A+
Sbjct: 122 TLMLGVFMALDLVLFYVFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  +  T+ I  L  ++     FS+         Q  M++AFF SFA+K+PM+P HTW
Sbjct: 182 VAMFVDAGTTDIPTLMTHSFGSESFSLLGIQVVGGLQTLMFLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ ++   P+I ++S IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGAEVMTPLILWMSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKLIAYSS+AHMGYVT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQEDMKKLIAYSSVAHMGYVTMGIFAANQQGIDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV  MP YA++ M FTMAN+GLPGTSGF+GEFL ++ VFQ +  VA 
Sbjct: 362 DRMHTREIDAYGGLVTRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLIGVFQVNTWVAA 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++ RER +  P+ V+T+  G+YP  
Sbjct: 422 VATAGVILSAAYALWLYRRVVMGDLIKESLRTITDMTTRERAIFAPLVVMTLLLGVYPAL 481

Query: 472 IRDTFSVPLSSIIENY 487
           + D     + +++ NY
Sbjct: 482 VLDIIGPSVEALVSNY 497


>gi|110680449|ref|YP_683456.1| NADH dehydrogenase subunit M [Roseobacter denitrificans OCh 114]
 gi|109456565|gb|ABG32770.1| NADH-quinone oxidoreductase chain M [Roseobacter denitrificans OCh
           114]
          Length = 513

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/512 (49%), Positives = 361/512 (70%), Gaps = 27/512 (5%)

Query: 6   LSIVTFLPFLGVFVILF-------SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           LSIVTF+P +   ++         ++ L   R + F      +   F+ SLF+ + FD  
Sbjct: 5   LSIVTFIPAMAALILAVFLRGDDEAANLNAKRVAMFA-----TVATFLVSLFILAGFDPQ 59

Query: 59  RSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
            + FQ +E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW ++    +EYMIAF
Sbjct: 60  DTGFQFVEERDWL-LGLEYKMGVDGISVLFVMLTTFMMPLVIAASW-NVTLRVKEYMIAF 117

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ M
Sbjct: 118 LLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLM 177

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMF 226
           L A+V M  +  T+ I ++    +F F+            +Q  +++AFF SFA+K+PM+
Sbjct: 178 LVAMVGMFADAGTTDI-EMLLRHEFAFANFELLGVQIVGGMQTLLFLAFFASFAVKMPMW 236

Query: 227 PFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAI 286
           P HTWLP+AHVQAPTAGSV LA I+LK+GGYG IRF LP+FP+A+  +AP+I +LS IAI
Sbjct: 237 PVHTWLPDAHVQAPTAGSVVLAAILLKLGGYGFIRFSLPMFPVAADIWAPMILWLSAIAI 296

Query: 287 IYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFC 346
           +Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQM+SHG +S ALF C
Sbjct: 297 VYTSLVALVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMISHGFISGALFLC 356

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGVIYDR+HTRDI AYGGLV+ MP YA++ M+FTMAN+GLPGTSGF+GEFL +M+VFQ +
Sbjct: 357 VGVIYDRMHTRDIDAYGGLVNRMPAYALIFMLFTMANVGLPGTSGFVGEFLTLMAVFQVN 416

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D++ RER +  P+  +T+  G
Sbjct: 417 TWVAAVATTGVIFSAAYALWLYRRVVMGDLIKESLKSITDMTSRERWIFAPLVAMTLLLG 476

Query: 467 IYPVPIRDTFSVPLSSIIENYTLKTGYSDSVK 498
           +YP  + D     +++++  Y      +++  
Sbjct: 477 VYPALVLDITGPSVAALVAGYDTALSAAEAAS 508


>gi|254693552|ref|ZP_05155380.1| NADH dehydrogenase subunit M [Brucella abortus bv. 3 str. Tulya]
 gi|261213817|ref|ZP_05928098.1| NADH dehydrogenase subunit M [Brucella abortus bv. 3 str. Tulya]
 gi|260915424|gb|EEX82285.1| NADH dehydrogenase subunit M [Brucella abortus bv. 3 str. Tulya]
          Length = 395

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 245/394 (62%), Positives = 309/394 (78%), Gaps = 2/394 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS VTFLP +G  +IL         RR+   VAL  +   FI SL VW+ FD    
Sbjct: 3   DWPILSTVTFLPLVGALLILLIKDDSEASRRNIRNVALLTTVFVFILSLVVWAGFDNSNP 62

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQM+E   W+    SYH+GVDGIS+L VVL+ FL PFCIL+SW S+++  +EYMIAFL+
Sbjct: 63  GFQMVEELDWMGSGISYHMGVDGISVLFVVLSAFLMPFCILASWVSVEKRVKEYMIAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+++IG F +LD+ LFY+FFEASLIPMF+IIGVWGG  R+YA+ KFFLYT  GS+ ML 
Sbjct: 123 LETLMIGVFCALDLFLFYVFFEASLIPMFIIIGVWGGKRRVYASLKFFLYTLLGSVLMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M W+  T +I++L   + FP S+Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AIMAMYWQAGTMNIVELLQYN-FPASMQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG IRF LP+FPLAS  FAP IF LS++AIIY SLV+MVQ D+K
Sbjct: 242 TAGSVILAGILLKLGGYGFIRFSLPMFPLASADFAPFIFTLSVVAIIYTSLVAMVQEDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM YVT+GIF+  + G++GA+FQMLSHG+VS ALF CVGVIYDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMAYVTMGIFAANEQGLQGAIFQMLSHGIVSGALFLCVGVIYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           A+GGLV+NMP+YAV  ++FTMAN+GLPGTSGFIG
Sbjct: 362 AFGGLVNNMPKYAVAFLIFTMANVGLPGTSGFIG 395


>gi|315499802|ref|YP_004088605.1| proton-translocating NADH-quinone oxidoreductase, chain m
           [Asticcacaulis excentricus CB 48]
 gi|315417814|gb|ADU14454.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Asticcacaulis excentricus CB 48]
          Length = 500

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 347/490 (70%), Gaps = 12/490 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCG------RRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           LS++TFLP +G F IL   ++          R+   +AL  +      ++ + + FD+  
Sbjct: 9   LSLITFLPLVGAFAILGVKWVSRKDDASVIERNAKWIALWTTLATLALTVILLAGFDRTT 68

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           + +Q +E   W   F SYH+GVDGIS+L V LT  L P CIL+SW S++    EYMIAFL
Sbjct: 69  TDYQFVEKVQWFS-FLSYHMGVDGISVLFVALTALLMPLCILASWDSVKTRLVEYMIAFL 127

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE++VIG F +LD+ LFY+FFE  L+PMF+IIG+WGG +RIYAAYKFFLYT  GS+ ML
Sbjct: 128 VLETLVIGVFTALDLFLFYVFFEGGLVPMFLIIGIWGGKDRIYAAYKFFLYTLLGSVLML 187

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            A++ M     TS   D+  +S + FS   Q W+W AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 188 AAMLYMVGVAGTS---DIPTLSTYAFSQAAQPWLWFAFFASFAVKMPMWPVHTWLPDAHV 244

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           QAPTAGSV LAGI+LK+GGYG IRF LP+FP AS+ F P +  LS+IAI+  SL++  QT
Sbjct: 245 QAPTAGSVLLAGILLKLGGYGFIRFNLPMFPYASELFTPFVLTLSVIAIVVTSLIAFRQT 304

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMG+VT+GIF+G ++GV+GA++QM+SHG +S ALF CVGV+YDR HTR
Sbjct: 305 DIKKLIAYSSVAHMGFVTMGIFAGNQAGVQGAVYQMISHGFISGALFLCVGVVYDRWHTR 364

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGGL   MP +A V ++FTMAN+GLPGTSGF+GE L +  ++Q S   A++A+ GV
Sbjct: 365 EIAFYGGLTKLMPHFAFVFLLFTMANVGLPGTSGFVGEILTMTGLYQASTWAALVAATGV 424

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA+Y+L L+++V++G    E+++   DL+LRE+ +  P+   T+  GIYP  + D  +
Sbjct: 425 ILSAMYALTLFKRVMYGEVTNEQLKGHPDLTLREKIIFAPLIAGTLLLGIYPAFVFDFTT 484

Query: 478 VPLSSIIENY 487
             + +++  Y
Sbjct: 485 ASVDAVVATY 494


>gi|83942653|ref|ZP_00955114.1| NADH dehydrogenase subunit M [Sulfitobacter sp. EE-36]
 gi|83846746|gb|EAP84622.1| NADH dehydrogenase subunit M [Sulfitobacter sp. EE-36]
          Length = 518

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 360/505 (71%), Gaps = 21/505 (4%)

Query: 1   MNLPFLSIVTFLPFLGVFVI---LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           M+   LSI+TF+P     ++   L       GR + + +AL  +T+ F+ SLF+   FD 
Sbjct: 1   MDHHLLSIITFMPSFAALILAVFLRGDDAAAGRNAKW-LALITTTVTFLISLFILFDFDP 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             + FQ ++   W+     Y LGVDGISIL V+LTTF+ P  I +SW +++   +EYMIA
Sbjct: 60  SNTGFQFVDEAQWL-MGLQYRLGVDGISILFVMLTTFMMPLVIAASW-NVETRVKEYMIA 117

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ 
Sbjct: 118 FLLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVL 177

Query: 178 MLFAIVVMCWEKKTSSI--------IDLYAMSKFPFS-------IQYWMWIAFFCSFAIK 222
           ML A+V+M  +  T+ I           +A   F  +       +Q  M++AFF SFA+K
Sbjct: 178 MLVAMVMMYADAGTTCIGGCEVSLLTHTFASDSFSIAGITVVGGLQTMMFLAFFASFAVK 237

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PM+P HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF +P+FP+ +   AP++ ++S
Sbjct: 238 MPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSVPMFPVGADVMAPLVLWMS 297

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSA 342
            IAI+Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S+A
Sbjct: 298 AIAIVYTSLVALVQEDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFISAA 357

Query: 343 LFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSV 402
           LF CVGVIYDR+HTR+I AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL +M  
Sbjct: 358 LFLCVGVIYDRMHTREIDAYGGLVNRMPAYALVFMFFTMANVGLPGTSGFVGEFLTLMGT 417

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLT 462
           FQ +  VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D+S RER +  P+  +T
Sbjct: 418 FQVNTWVAAVATSGVIFSAAYALWLYRRVVMGDLIKESLRTITDMSRRERWIFAPLVAMT 477

Query: 463 VFFGIYPVPIRDTFSVPLSSIIENY 487
           +  G+YP  + D     +++++++Y
Sbjct: 478 LLLGVYPALVLDMIGPSVAALVDSY 502


>gi|83953894|ref|ZP_00962615.1| NADH dehydrogenase subunit M [Sulfitobacter sp. NAS-14.1]
 gi|83841839|gb|EAP81008.1| NADH dehydrogenase subunit M [Sulfitobacter sp. NAS-14.1]
          Length = 518

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 360/505 (71%), Gaps = 21/505 (4%)

Query: 1   MNLPFLSIVTFLPFLGVFVI---LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           M+   LSI+TF+P     ++   L       GR + + +AL  +T+ F+ SLF+   FD 
Sbjct: 1   MDHHLLSIITFMPSFAALILAVFLRGDDAAAGRNAKW-LALITTTVTFLISLFILFDFDP 59

Query: 58  GRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
             + FQ ++   W+     Y LGVDGISIL V+LTTF+ P  I +SW +++   +EYMIA
Sbjct: 60  SNTGFQFVDEAQWL-MGLKYRLGVDGISILFVMLTTFMMPLVIAASW-NVETRVKEYMIA 117

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ 
Sbjct: 118 FLLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVL 177

Query: 178 MLFAIVVMCWEKKTSSI--------IDLYAMSKFPFS-------IQYWMWIAFFCSFAIK 222
           ML A+V+M  +  T+ I           +A   F  +       +Q  M++AFF SFA+K
Sbjct: 178 MLVAMVMMYADAGTTCIGGCEVSLLTHTFASDSFSIAGITVVGGLQTMMFLAFFASFAVK 237

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PM+P HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF +P+FP+ +   AP++ ++S
Sbjct: 238 MPMWPVHTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSVPMFPVGADVMAPLVLWMS 297

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSA 342
            IAI+Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S+A
Sbjct: 298 AIAIVYTSLVALVQEDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFISAA 357

Query: 343 LFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSV 402
           LF CVGVIYDR+HTR+I AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL +M  
Sbjct: 358 LFLCVGVIYDRMHTREIDAYGGLVNRMPAYALVFMFFTMANVGLPGTSGFVGEFLTLMGT 417

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLT 462
           FQ +  VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D+S RER +  P+  +T
Sbjct: 418 FQVNTWVAAVATSGVIFSAAYALWLYRRVVMGDLIKESLRTITDMSRRERWIFAPLVAMT 477

Query: 463 VFFGIYPVPIRDTFSVPLSSIIENY 487
           +  G+YP  + D     +++++++Y
Sbjct: 478 LLLGVYPALVLDMIGPSVAALVDSY 502


>gi|126727170|ref|ZP_01743007.1| NADH dehydrogenase subunit M [Rhodobacterales bacterium HTCC2150]
 gi|126703598|gb|EBA02694.1| NADH dehydrogenase subunit M [Rhodobacterales bacterium HTCC2150]
          Length = 514

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 351/496 (70%), Gaps = 15/496 (3%)

Query: 5   FLSIVTFLPFLG--VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSI+ FLP +   +  +         R +   VAL  +++ F+ S+ + + FD   + F
Sbjct: 4   LLSIIIFLPAVAAVILALFLRGDDKFARLNAKRVALAATSVTFLASIGLLADFDPQNTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   WI    +Y LGVDGISIL V+LTTFL P  +LS W ++    ++YMIAFLVLE
Sbjct: 64  QFVEEATWIAGL-TYKLGVDGISILFVMLTTFLMPIVVLSCW-NVDNRVKDYMIAFLVLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F +LD++LFY+FFEA LIPMF+IIG+WGG +RIYA++KFFLYT  GS+ ML A+
Sbjct: 122 TLMLGVFCALDLILFYLFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTLLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSIIDL--YAMSKFPFSI---------QYWMWIAFFCSFAIKIPMFPFHTW 231
           + M  +  T+ I  L  ++     FS+         Q  MW+AFF SFA+K+PM+P HTW
Sbjct: 182 IAMYVDAGTTDIPTLMTHSFGSETFSLLGIQIIGGAQTLMWLAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   AP++ ++S IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVMAPLVLWMSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQQDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL +M  FQ +  VA 
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYALVFMFFTMANVGLPGTSGFVGEFLTLMGAFQVNTWVAA 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VV G    E ++ + D++  ER +  P+  +T+  G+YP  
Sbjct: 422 IATSGVILSAGYALWLYRRVVMGDLIKESLKSITDMTTMERAIFAPLIAMTLLLGVYPAL 481

Query: 472 IRDTFSVPLSSIIENY 487
           + D     + ++I+NY
Sbjct: 482 VLDIIGPSVEALIDNY 497


>gi|163732044|ref|ZP_02139490.1| NADH dehydrogenase subunit M [Roseobacter litoralis Och 149]
 gi|161394342|gb|EDQ18665.1| NADH dehydrogenase subunit M [Roseobacter litoralis Och 149]
          Length = 513

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/512 (49%), Positives = 361/512 (70%), Gaps = 27/512 (5%)

Query: 6   LSIVTFLPFLGVFVILF-------SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           LSIVTF+P +   ++         ++ L   R + F      +   F+ SLF+ + FD  
Sbjct: 5   LSIVTFIPAMAALILAVFLRGDDEAANLNAKRVAMFA-----TVATFLVSLFILAGFDPQ 59

Query: 59  RSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
            + FQ +E   W+     Y +GVDGIS+L V+LTTF+ P  I +SW ++    +EYMIAF
Sbjct: 60  DTGFQFVEERDWL-LGLEYKMGVDGISVLFVMLTTFMMPLVIAASW-NVTLRVKEYMIAF 117

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ M
Sbjct: 118 LLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLM 177

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFS------------IQYWMWIAFFCSFAIKIPMF 226
           L A+V M  +  T+ I ++    +F F+            +Q  +++AFF SFA+K+PM+
Sbjct: 178 LVAMVGMFADAGTTDI-EMLLRHEFSFADFDLLGIQIVGGMQTLLFLAFFASFAVKMPMW 236

Query: 227 PFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAI 286
           P HTWLP+AHVQAPTAGSV LA I+LK+GGYG IRF LP+FP+A+  +AP+I +LS IAI
Sbjct: 237 PVHTWLPDAHVQAPTAGSVVLAAILLKLGGYGFIRFSLPMFPVAADIWAPMILWLSAIAI 296

Query: 287 IYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFC 346
           +Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + GV+GA+FQM+SHG +S ALF C
Sbjct: 297 VYTSLVALVQEDMKKLIAYSSVAHMGFVTMGIFAANQQGVDGAIFQMISHGFISGALFLC 356

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGVIYDR+HTR+I AYGGLV+ MP YA++ M+FTMAN+GLPGTSGF+GEFL +M+VFQ +
Sbjct: 357 VGVIYDRMHTREIDAYGGLVNRMPAYALIFMLFTMANVGLPGTSGFVGEFLTLMAVFQVN 416

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D++ RER +  P+  +T+  G
Sbjct: 417 TWVAAVATTGVIFSAAYALWLYRRVVMGDLIKESLKSITDMTSRERWIFAPLVAMTLLLG 476

Query: 467 IYPVPIRDTFSVPLSSIIENYTLKTGYSDSVK 498
           +YP  + D     +++++  Y      +++  
Sbjct: 477 VYPALVLDITGPSVAALVAGYDTALSAAEAAS 508


>gi|254487062|ref|ZP_05100267.1| NADH-quinone oxidoreductase chain m [Roseobacter sp. GAI101]
 gi|214043931|gb|EEB84569.1| NADH-quinone oxidoreductase chain m [Roseobacter sp. GAI101]
          Length = 518

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 254/504 (50%), Positives = 357/504 (70%), Gaps = 19/504 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           M+   LSI+TF+P     +  +          R+   +AL  +++ F+ SLF+   FD  
Sbjct: 1   MDHHLLSIITFMPSFAALILAVFLRGDDAAAARNAKWLALISTSVTFLISLFILFDFDPA 60

Query: 59  RSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
            + FQ ++   WI     Y +GVDGISIL V+LTTF+ P  I +SW ++    +EYMIAF
Sbjct: 61  DTGFQFVDEATWI-MGLQYRMGVDGISILFVMLTTFMMPLVIAASW-NVDTRVKEYMIAF 118

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+LE++++G F++LD++LFY+FFEA LIPMF+IIG+WGG+ RIYA++KFFLYTF GS+ M
Sbjct: 119 LLLETLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGANRIYASFKFFLYTFLGSVLM 178

Query: 179 LFAIVVMCWEKKTSSI--------IDLYAMSKFPFS-------IQYWMWIAFFCSFAIKI 223
           L A+V M  +  T+ I         + +A   F  +       +Q  M++AFF SFA+K+
Sbjct: 179 LVAMVAMYADAGTTCIGGCEVSLLTNTFASETFTVAGISVVGGMQTLMFLAFFASFAVKM 238

Query: 224 PMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSL 283
           PM+P HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   AP + ++S 
Sbjct: 239 PMWPVHTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVIAPWVLWMSA 298

Query: 284 IAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSAL 343
           IAI+Y SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  + G++GA+FQM+SHG +S+AL
Sbjct: 299 IAIVYTSLVALVQQDMKKLIAYSSVAHMGFVTMGIFTFNQQGLDGAIFQMVSHGFISAAL 358

Query: 344 FFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVF 403
           F CVGVIYDR+HTR+I AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL +M++F
Sbjct: 359 FLCVGVIYDRMHTREIDAYGGLVNRMPAYALVFMFFTMANVGLPGTSGFVGEFLTLMAIF 418

Query: 404 QNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTV 463
           Q +  VA +A+ GV+ SA Y+LWLYR+VV G    E ++ + D+S RER +  P+ V+T+
Sbjct: 419 QVNTWVAAVATTGVIFSAAYALWLYRRVVMGDLIKESLKTITDMSGRERWIFAPLVVMTL 478

Query: 464 FFGIYPVPIRDTFSVPLSSIIENY 487
             GIYP  + D     +++++ +Y
Sbjct: 479 LLGIYPALVLDIIGPSVTALVASY 502


>gi|84686451|ref|ZP_01014345.1| NADH dehydrogenase subunit M [Maritimibacter alkaliphilus HTCC2654]
 gi|84665634|gb|EAQ12110.1| NADH dehydrogenase subunit M [Rhodobacterales bacterium HTCC2654]
          Length = 517

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 255/496 (51%), Positives = 347/496 (69%), Gaps = 15/496 (3%)

Query: 5   FLSIVTFLPFLGVFVI--LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSI+TFLP +   ++           +R+   +AL  +T  F+ SL V   FD   + F
Sbjct: 4   LLSIITFLPLVAALILALFLRGDDPAAQRNAKWLALAATTATFLISLGVLFGFDPSDTGF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+     Y +GVDGIS+L V+LTTFL P  I + W ++    +EYMIAFLVLE
Sbjct: 64  QFVEEADWL-MGLQYKMGVDGISVLFVMLTTFLMPITIAACW-NVTTRVKEYMIAFLVLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           ++++G F++LD++LFY+FFEA LIPMF+IIG+WGG  RIYAA+KFFLYTF GS+ ML A+
Sbjct: 122 TLMLGVFMALDLVLFYLFFEAGLIPMFLIIGIWGGKNRIYAAFKFFLYTFLGSVLMLVAM 181

Query: 183 VVMCWEKKTSSI-------IDLYAMSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTW 231
           V M  E  T+ I        D   M     ++    Q  +++AFF SFA+K+PM+P HTW
Sbjct: 182 VYMFMEAGTTDIPTLLNHAFDSTTMRVLGITVTGGAQTLLFVAFFASFAVKMPMWPVHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   A  + +LS IAI+Y SL
Sbjct: 242 LPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVMATFVLWLSAIAIVYTSL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKLIAYSS+AHMGYVT GIF+  + G++GA+FQM+SHG +S ALF CVGVIY
Sbjct: 302 VALVQEDMKKLIAYSSVAHMGYVTAGIFAANQQGIDGAIFQMISHGFISGALFLCVGVIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV+ MP YA+V M FTMAN+GLPGTSGF+GEFL ++ +FQ +  VA 
Sbjct: 362 DRMHTREIDAYGGLVNRMPAYALVFMFFTMANVGLPGTSGFVGEFLTLVGMFQANTWVAA 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A+ GV+LSA Y+LWLYR+VV G    E ++ + D+S RE+ +  P+A +T+  G+YP  
Sbjct: 422 VATSGVILSAAYALWLYRRVVMGDLIKESLKAITDMSRREKWIFAPLAAMTLLLGVYPSL 481

Query: 472 IRDTFSVPLSSIIENY 487
           + D     + +++ +Y
Sbjct: 482 VTDIIGPSVENLLNHY 497


>gi|167646782|ref|YP_001684445.1| NADH dehydrogenase subunit M [Caulobacter sp. K31]
 gi|167349212|gb|ABZ71947.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Caulobacter sp. K31]
          Length = 494

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 253/469 (53%), Positives = 335/469 (71%), Gaps = 6/469 (1%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFG----VALGISTINFIFSLFVWSVFDKGRS 60
            LS+ TF P +GV V+L    L             +AL  + + F  S+ + + FD    
Sbjct: 4   LLSLTTFAPLVGVAVLLAVRALQGDNAKTDSLAKWIALATTLVTFALSIILVAKFDARNP 63

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQ +E   W      Y +GVDGIS+L V+LT FL P C+++SWKSI +   EYMI FLV
Sbjct: 64  GFQFVEDAAWFAGL-HYRMGVDGISVLFVLLTAFLLPICVIASWKSIDKRVVEYMICFLV 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE++VIG F +LD++LFY+FFE  L+PMF+IIG+WGG  R+YAAYKFFLYT  GS+ ML 
Sbjct: 123 LETLVIGVFCALDLILFYLFFEGGLVPMFLIIGIWGGKRRVYAAYKFFLYTLLGSVLMLA 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+ M    +TSSI DL    KF   +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 AILSMIAIARTSSIPDLMHF-KFAPWLQTWLWLAFFASFAVKMPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAGI+LK+GGYG +RF LP+FP AS+ F P++F +S IAI+Y SLV+  QTDIK
Sbjct: 242 TAGSVILAGILLKLGGYGFMRFSLPMFPNASELFQPLVFAMSAIAIVYTSLVAFRQTDIK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHMG+VT+GIFSG   G +GA+FQMLSHG++S ALF CVGV+YDR+HTR+I 
Sbjct: 302 KLIAYSSVAHMGFVTMGIFSGNVQGEQGALFQMLSHGVISGALFLCVGVVYDRMHTREIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL + MP YA V M+FTM N+GLPGTSGF+GE L ++  ++ S   A++AS GV+LS
Sbjct: 362 FYGGLTNRMPWYAAVFMLFTMGNVGLPGTSGFVGEILTMVGTYKASTWTALVASTGVILS 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A+Y+L LYR+V+FG     +++ + DL  RE  +  P+ + T+  G+YP
Sbjct: 422 AVYALNLYRRVMFGEIVNPELKTIADLDKREILIFAPLIIATLVLGVYP 470


>gi|117926897|ref|YP_867514.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Magnetococcus sp. MC-1]
 gi|117610653|gb|ABK46108.1| NADH dehydrogenase subunit M [Magnetococcus sp. MC-1]
          Length = 497

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 258/490 (52%), Positives = 351/490 (71%), Gaps = 6/490 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVA-LGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS++TFLP +G   IL  +++   R     +A +GIST+  I SL ++  FD   + FQ 
Sbjct: 2   LSLLTFLPLIGALAIL--AFVERQRDDIARLAAMGISTVVLILSLLLYGEFDPSVAGFQF 59

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +   W+      Y +GVDGIS   V+LT  LTP CIL+SW+SIQ+  +EYM AFL LES
Sbjct: 60  TQEAAWLPALGIHYRMGVDGISYPFVMLTALLTPICILASWQSIQKRVKEYMAAFLALES 119

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
            VIG F +LD  LFY+ +EA LIPMF+IIGVWGG  R+YAA KFFLYT  GS+ ML A++
Sbjct: 120 FVIGVFCALDFALFYVLWEAMLIPMFLIIGVWGGQNRVYAAMKFFLYTLAGSVLMLVAMI 179

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            +     T SI +L  + + PF+ Q W+++AFF +FA+K+PM+PFHTWLP+AHVQAPTAG
Sbjct: 180 SLYVTTGTFSIPELMEV-QLPFNYQMWLFLAFFIAFAVKVPMWPFHTWLPDAHVQAPTAG 238

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LKMG YG +RF LP+ P AS+Y A  IF LSL+AI+Y +LV++VQTD+KKLI
Sbjct: 239 SVILAGILLKMGAYGFLRFSLPILPDASRYMADFIFVLSLVAIVYTALVALVQTDMKKLI 298

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS++HMG+VTIGIF+  + G+EG++ QM++HG+VS ALF  VGVIYDRLHTR++  +G
Sbjct: 299 AYSSVSHMGFVTIGIFAFNQQGIEGSILQMINHGIVSGALFLIVGVIYDRLHTRELSRFG 358

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL   MP YAV+ M+FTMA++GLPGT+GFIGEFL++M  F  + TVA +A+ G+VL A Y
Sbjct: 359 GLAIRMPIYAVIFMLFTMASVGLPGTNGFIGEFLILMGAFFANTTVAFVAATGLVLGAAY 418

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
            LWLY++V+FG    E+ + L D++ RE  +  P+ VL ++ G YP P  D F   ++ +
Sbjct: 419 MLWLYKQVMFGEMVHEENRSLMDVNGREIALFVPLIVLVLWIGFYPNPFLDAFHSSVAHL 478

Query: 484 IEN-YTLKTG 492
           ++    +KTG
Sbjct: 479 VDQVQVVKTG 488


>gi|310816700|ref|YP_003964664.1| NADH dehydrogenase subunit M [Ketogulonicigenium vulgare Y25]
 gi|308755435|gb|ADO43364.1| NADH dehydrogenase subunit M [Ketogulonicigenium vulgare Y25]
          Length = 507

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 252/504 (50%), Positives = 363/504 (72%), Gaps = 18/504 (3%)

Query: 5   FLSIVTFLPFLGVFVI-LFSSYLGCG-RRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LS+VTFLP LG  V+ LF+       +++   VALG++   F  SLF+ + FD     F
Sbjct: 2   LLSLVTFLPALGALVLALFTRGESPTVQQNARWVALGVTIATFAASLFILAGFDPAYDGF 61

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E   W+    SY LGVDGIS+L V+LTTFL P  IL++W  +Q+  R  MIA+LVLE
Sbjct: 62  QFVEDRAWV-MGMSYRLGVDGISVLFVLLTTFLMPLVILTAWP-VQDRTRTLMIAWLVLE 119

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +++IG F +LD++LFY+FFEA LIPMF+IIGVWGG  R+YAA+KFFLYTF GS+ ML A+
Sbjct: 120 TLMIGVFTALDLVLFYLFFEAGLIPMFLIIGVWGGKNRVYAAFKFFLYTFLGSVLMLVAM 179

Query: 183 VVMCWEKKTSSI-------IDLYAMSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTW 231
           +VM WE  T+ I       I+L A   +PF +    Q  +++AFF SFA+K+PM+P HTW
Sbjct: 180 LVMYWESGTTCIAACGEGAIELIA---YPFPVAGGMQVLLFLAFFASFAVKMPMWPVHTW 236

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPT+GSV LA ++LKMGGYG +RF LP+FP+AS   AP++ +LS IA++YASL
Sbjct: 237 LPDAHVQAPTSGSVILAAVLLKMGGYGFLRFSLPMFPVASDMLAPLMLWLSAIAVVYASL 296

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ+D+KKLIAYSS+AHMG+VT+G+F+  + GV+GA+FQM+SHG +S+ALF  VGVIY
Sbjct: 297 VALVQSDMKKLIAYSSVAHMGFVTMGMFALNRQGVDGAIFQMISHGFISAALFLLVGVIY 356

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I A+GGL++ MP Y  + ++FTMAN+GLPGTSGF+GEFL ++  +Q +  VA+
Sbjct: 357 DRMHTREISAFGGLLNRMPAYGALFLLFTMANIGLPGTSGFVGEFLTLLGTYQANTWVAL 416

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A  G++ SA Y LWL+R+V+ G    + ++ ++D++ RE  +  P+ V+T+  G+YP  
Sbjct: 417 VAGTGIIFSAGYGLWLFRRVIMGPILHKPLEAIQDITPREAAIFVPLVVMTILLGVYPSL 476

Query: 472 IRDTFSVPLSSIIENYTLKTGYSD 495
           + D     +  ++++   +   ++
Sbjct: 477 VTDITGPSVQRLVDHVAAELAAAN 500


>gi|114569917|ref|YP_756597.1| NADH dehydrogenase subunit M [Maricaulis maris MCS10]
 gi|114340379|gb|ABI65659.1| NADH dehydrogenase subunit M [Maricaulis maris MCS10]
          Length = 504

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/490 (51%), Positives = 345/490 (70%), Gaps = 9/490 (1%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGR------RSFFGVALGISTINFIFSLFVWSVFDKG 58
           FLSI+TF+P LG  VI    +           R+   VA   + +    S+ + + FD  
Sbjct: 8   FLSILTFVPALGALVIAIFRFTARSEDQSLIDRNSRWVAWLATMVTLGMSVLLLANFDAE 67

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            + FQ +    W++     Y +GVDG+SIL VVLT FL P CI++S  +I+    +YMIA
Sbjct: 68  ATGFQFVHEVTWLEQIGLGYRMGVDGLSILFVVLTAFLMPICIMAS-GAIKTRVADYMIA 126

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE+MVIG F +LD++LFYIFFE  LIPMF+IIGVWGG  R+YAA+KFFLYT  GS+ 
Sbjct: 127 FLLLETMVIGVFCALDLVLFYIFFEGGLIPMFIIIGVWGGQNRVYAAFKFFLYTLLGSVL 186

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A++VM  +  T+ +  L   ++F  + Q WMW+AFF SFA+K+PM+P HTWLP+AHV
Sbjct: 187 MLVAMIVMFLQAGTTDVTVLLE-TEFARNAQMWMWLAFFASFAVKMPMWPVHTWLPDAHV 245

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           QAPTAGSV LAG++LK+GGYG +RF LP+FP AS YFAP++F LS+IAIIY SLV+  QT
Sbjct: 246 QAPTAGSVILAGVLLKLGGYGFLRFSLPMFPEASDYFAPMVFVLSIIAIIYTSLVAFRQT 305

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIKKLIAYSS+AHMG+VT+G+F+  ++GV+GA+FQM+SHG++S ALF CVGVIYDR+HTR
Sbjct: 306 DIKKLIAYSSVAHMGFVTMGLFAMNETGVQGAIFQMISHGVISGALFLCVGVIYDRMHTR 365

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGGLVH MP +A +  +F MAN+GLPGTSGF+GE + ++  FQ S  +A  A+ GV
Sbjct: 366 EIAFYGGLVHRMPVFAAIFGLFAMANVGLPGTSGFVGEIMTMVGAFQVSWWIATGAAVGV 425

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA+Y L +YR VVFG     K++ + DL+  E  +  P+ + T+  G++   I D  +
Sbjct: 426 ILSAMYMLTVYRDVVFGEITNPKLETITDLNRMEWLIFIPLIIGTLLLGVFSTLITDVTA 485

Query: 478 VPLSSIIENY 487
             +  ++ NY
Sbjct: 486 TAVDHLLSNY 495


>gi|114797733|ref|YP_760461.1| NADH-quinone oxidoreductase subunit M [Hyphomonas neptunium ATCC
           15444]
 gi|114737907|gb|ABI76032.1| NADH-quinone oxidoreductase, M subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 500

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 252/478 (52%), Positives = 342/478 (71%), Gaps = 16/478 (3%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYL----------GCGRRSFFGVALGISTINFIFSLFVWS 53
           P L+ +TFLP +G  +I+               G   R+    +L IS   F+ S+  + 
Sbjct: 5   PILTAMTFLPLIGALLIVLVRAATAGSRAAADDGRQNRAILMASLIISAATFVLSVAAFL 64

Query: 54  VFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFRE 113
            FD G+  +Q++E + W     SY LG+DG+S+ L++LTTFLTP C+L+SW SI +   E
Sbjct: 65  SFDPGQMGYQLVEQHAWYGP-ISYKLGIDGLSMSLILLTTFLTPICLLASWNSIDKRVTE 123

Query: 114 YMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFF 173
           Y++AFLVLE+ +IG F +LD++LFYIFFEA LIPMF+IIG+WGG +RIYA++KFFLYT  
Sbjct: 124 YVVAFLVLETFMIGVFTALDLVLFYIFFEAGLIPMFLIIGIWGGKDRIYASFKFFLYTLI 183

Query: 174 GSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTW 231
           GS+ +L A + M    + +   D   + +F F   +Q W+W+AF  SFA+K+PM+P HTW
Sbjct: 184 GSLLLLVAAIYMI---QVAGSADFEVLEQFAFDPGVQTWLWLAFLASFAVKLPMWPVHTW 240

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHVQAPTAGSV LAG++LKMGGYG +RF LP+FP AS YF P++F L++IAIIY SL
Sbjct: 241 LPDAHVQAPTAGSVVLAGVLLKMGGYGMLRFSLPMFPDASAYFQPMMFALAVIAIIYTSL 300

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+  QTD+KKLIAYSS+AHMG+VT+GIF+  ++G++GA+FQMLSHGL+S ALF  VGV+Y
Sbjct: 301 VAWRQTDMKKLIAYSSVAHMGFVTLGIFAFNETGIQGAIFQMLSHGLISGALFLIVGVVY 360

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+HTR+I AYGGLV  MP YA   M+FTMAN+GLPGTSGF+GE L ++  FQ +   A 
Sbjct: 361 DRMHTREIAAYGGLVGRMPIYAGFFMLFTMANVGLPGTSGFVGEILTMIGGFQAATWAAF 420

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
            A+FGV+ SA+Y L LYR+ VFG      ++ +KD++  E   + P+AVLTV FG+ P
Sbjct: 421 GAAFGVIFSAVYMLTLYRRTVFGEITNPLLEDIKDMNRIEWVCIAPLAVLTVLFGVAP 478


>gi|114327954|ref|YP_745111.1| NADH-quinone oxidoreductase chain M [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316128|gb|ABI62188.1| NADH-quinone oxidoreductase chain M [Granulibacter bethesdensis
           CGDNIH1]
          Length = 506

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 331/452 (73%), Gaps = 2/452 (0%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           AL  S + F FSL +W  FD  +   Q +E   W+  F   Y +GVDGIS+L V+L+TFL
Sbjct: 41  ALWTSLVVFAFSLVLWVRFDPAQPGMQFVESVQWLPEFGVRYSVGVDGISVLFVLLSTFL 100

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
           TP CIL+SW +I    RE+MIAFLVLE+M++G F + D LLFYIFFEA LIPM++IIG+W
Sbjct: 101 TPICILASWDAIHTRVREFMIAFLVLETMMVGMFSATDFLLFYIFFEAVLIPMYLIIGIW 160

Query: 156 GGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAF 215
           G + R+YAA KFFLYT  GS+ ML A++ M W    ++ I     ++FP  +Q+W+++AF
Sbjct: 161 GHARRVYAALKFFLYTLAGSVLMLLALLTM-WHYAGTTDIPTLLHTRFPVHMQFWLFLAF 219

Query: 216 FCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFA 275
             SFA+K+PM+P HTWLP+AHV+APTAGSV LAG++LKMGGYG +RF +P+ P A +YFA
Sbjct: 220 LASFAVKVPMWPVHTWLPDAHVEAPTAGSVILAGVLLKMGGYGFLRFSVPMLPDAVEYFA 279

Query: 276 PVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLS 335
           P++F LS++A+IY S+V+  Q ++KKLIAYSSIAHMG VTIGIF+  + G+ GA+FQMLS
Sbjct: 280 PLMFALSVMAVIYTSIVAFAQENMKKLIAYSSIAHMGVVTIGIFTVNQQGLSGALFQMLS 339

Query: 336 HGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGE 395
           HG+VS+ALF CVGV+YDRLHT +I  YGGLV  MP YA V +VFTMA +GLPGT GF+GE
Sbjct: 340 HGVVSAALFLCVGVVYDRLHTLEINRYGGLVERMPAYAAVFLVFTMATIGLPGTGGFVGE 399

Query: 396 FLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMV 455
            LV++  F+ S  +A+L S G++L A+YSLWLYR+V+ G     +++ + DL+ RE  + 
Sbjct: 400 ILVLIGAFKVSIWIALLGSTGMILGAVYSLWLYRRVILGRMTLGELRSMFDLNTREIVVF 459

Query: 456 YPIAVLTVFFGIYPVPIRDTFSVPLSSIIENY 487
            P+ +LT++ G+YP      F   ++ +++ +
Sbjct: 460 VPLVLLTLWMGVYPSSFTHFFDATVNDLVQQH 491


>gi|330813994|ref|YP_004358233.1| NADH-ubiquinone oxidoreductase chain M [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487089|gb|AEA81494.1| NADH-ubiquinone oxidoreductase chain M [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 500

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 270/492 (54%), Positives = 364/492 (73%), Gaps = 4/492 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFS--SYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           MNLP L+I+TFLP +GVF ILF+       G+ SF  V+L  S + F+ SLF+W  FDK 
Sbjct: 1   MNLPILTIITFLPLIGVFFILFNKGEEERVGKISFH-VSLLTSLLVFVLSLFLWFSFDKT 59

Query: 59  RSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
            SSFQ +E   WI  F  Y +GVDGISIL VVLT F+TP CI++++ S++   +++ IA 
Sbjct: 60  ISSFQFVEEKKWIIDFVKYKVGVDGISILFVVLTAFITPICIVATYNSVKFRKKDFFIAL 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           LV+E+M+IG F SLD+ LFY+FFEA LIPMF+IIG+WGG  R+YAA+KFFLYT  GS+FM
Sbjct: 120 LVMETMMIGVFCSLDLFLFYLFFEAGLIPMFLIIGIWGGIRRVYAAFKFFLYTLLGSVFM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L AI+ +  +  T+ +  L A+   P   QY +W+ FF SFA+K PM+P HTWLP+AHV+
Sbjct: 180 LIAIIFIYMQTGTTDVEALLALD-IPVQYQYLLWLGFFASFAVKTPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT+GSV LA I+LKM GYG IRF L LFP+AS +F+P++F LS+IAI+Y SLV++VQ D
Sbjct: 239 APTSGSVILAAILLKMAGYGFIRFSLGLFPVASDFFSPLVFSLSIIAIVYTSLVALVQKD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKLIAYSS+AHMG+VTIGIF+    G+EG++FQM+SHG+VS+ALF CVGV+YDR+HTR 
Sbjct: 299 MKKLIAYSSVAHMGFVTIGIFAFNSQGIEGSIFQMISHGIVSAALFLCVGVVYDRMHTRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+ + MP YA+V MVF +A++GLPGTSGF+GE LV++ +F+ +  VA  A+ GVV
Sbjct: 359 ISDYGGVSNVMPNYAIVFMVFILASVGLPGTSGFVGEILVLIGIFKTNYLVAFFAATGVV 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           LSA YSL LYR+V FG    +KV+ LKD++  E   + P+ +L +  G+YP  I DT S 
Sbjct: 419 LSACYSLSLYRRVCFGEIINDKVKVLKDMNYSEYITLIPLLILVILLGVYPNIILDTIST 478

Query: 479 PLSSIIENYTLK 490
            + +++  Y +K
Sbjct: 479 SVENLVSVYNVK 490


>gi|329850716|ref|ZP_08265561.1| NADH-quinone oxidoreductase subunit M [Asticcacaulis biprosthecum
           C19]
 gi|328841031|gb|EGF90602.1| NADH-quinone oxidoreductase subunit M [Asticcacaulis biprosthecum
           C19]
          Length = 504

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 251/496 (50%), Positives = 346/496 (69%), Gaps = 10/496 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGR------RSFFGVALGISTINFIFSLFVWSVFDKGR 59
           LSIVTF P  G  VI+    L          R+   ++L  + +    S+ +   F+   
Sbjct: 9   LSIVTFAPLFGAAVIMILRALSRRDDEAVIARNAKWISLWTTLVTLALSVVMLLQFNGAS 68

Query: 60  SSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            ++Q  E+Y W     SYH+GVDGISIL V LT FL P CI +SW SI +   EYM+AFL
Sbjct: 69  PAYQFEEHYTWFGP-VSYHMGVDGISILFVALTAFLMPICIAASWTSITQRVTEYMVAFL 127

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE++VIG F SLD+ LFYIFFE  L+PMF+IIG+WGG +R+YAAYKFFLYT  GS+ ML
Sbjct: 128 LLETLVIGVFTSLDIFLFYIFFEGGLVPMFLIIGIWGGKDRVYAAYKFFLYTLLGSVLML 187

Query: 180 FAIVVMCWEKKTSSIIDLYAM---SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            A++ M  +  T++I ++  +   + FP  +Q ++W AFF SFA+K+PM+P HTWLP+AH
Sbjct: 188 AAMLYMVNKLGTANIPEMTRLLTETPFPVDVQGFLWFAFFASFAVKMPMWPVHTWLPDAH 247

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           VQAPTAGSV LAGI+LK+GGYG IRF LP+FP AS+ FAP++  LS+IA++Y SLV+  Q
Sbjct: 248 VQAPTAGSVMLAGILLKLGGYGFIRFNLPMFPQASEMFAPLVMILSVIAVVYTSLVAFRQ 307

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           TDIKKLIAYSS+AHMG+VT+GIF+G + GVEGA+FQM+SHGL+S ALF CVGV+YDR HT
Sbjct: 308 TDIKKLIAYSSVAHMGFVTMGIFAGNQLGVEGAIFQMISHGLISGALFLCVGVVYDRWHT 367

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGGL   MP +A + ++FTMAN+GLPGTSGFIGE   +   +     VA++++ G
Sbjct: 368 REIAFYGGLTKLMPHFAFIFLLFTMANVGLPGTSGFIGEIATMTGAYDWGTWVALVSASG 427

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           V+ SA+Y+L LY++V+FGV   +++++  D+  RE  +  P+ + T+  GIYP  + D  
Sbjct: 428 VIFSAVYALNLYKRVMFGVVTNDELKKYPDVDAREIAIFTPLIIGTLVLGIYPAFVFDFT 487

Query: 477 SVPLSSIIENYTLKTG 492
           +  +  +++ Y    G
Sbjct: 488 TASVDGLVKAYQAAIG 503


>gi|254418138|ref|ZP_05031862.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Brevundimonas sp. BAL3]
 gi|196184315|gb|EDX79291.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Brevundimonas sp. BAL3]
          Length = 494

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 254/491 (51%), Positives = 344/491 (70%), Gaps = 6/491 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFG----VALGISTINFIFSLFVWSVFDKGRSS 61
           LS+VTFLP  G   I  +      + +       +AL  + +    S+ + + FD     
Sbjct: 5   LSLVTFLPLAGALAIFLARLASKSQDAAAPAARWIALITTLVVLAVSVVLVAGFDPSNPG 64

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           +Q +E   W     SYHLGVDGISIL V+LT FL P CIL+SWKS++    EYMIAFLVL
Sbjct: 65  YQFVEMVPWFAG-ASYHLGVDGISILFVLLTAFLMPICILASWKSVETRVVEYMIAFLVL 123

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E++VIG F +LD+ LFYIFFE +L+PMF+IIG+WGG+ RIYAAYKFFLYT  GS+ ML A
Sbjct: 124 ETLVIGVFTALDLYLFYIFFEGTLVPMFLIIGIWGGANRIYAAYKFFLYTLLGSVLMLLA 183

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ M     T+SI +L   +  P ++Q  +W+AFF SFA+K+PM+P HTWLP+AHVQAPT
Sbjct: 184 MLWMSHTAGTTSIPELKQYAFDP-AVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAGI+LK+GGYG I F +P+FP+AS+ F P++F LS+IAI+Y SLV+  QTD+KK
Sbjct: 243 AGSVILAGILLKLGGYGFILFNVPMFPVASEMFRPLVFTLSVIAIVYTSLVAWRQTDMKK 302

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSSIAHMG+VT+GIFSG   G++GA+FQM+SHGL+S ALF CVGV+YDR+HTR+I  
Sbjct: 303 LIAYSSIAHMGFVTLGIFSGNYQGMQGAVFQMISHGLISGALFLCVGVVYDRMHTREIAF 362

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGL   MP +A + ++FTMAN+GLPGTSGFIGE L +   +Q S   A++A+ GV+ SA
Sbjct: 363 YGGLTSRMPWFAAIFLMFTMANVGLPGTSGFIGEVLTMTGAYQASTWAALVAASGVIFSA 422

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
           +Y+L LYR V+FG     K+  + D+  RE  +  P+ + T++ G++P  + D     + 
Sbjct: 423 VYALTLYRAVMFGEITNPKLMTIADIDKRELLLFVPLILGTLWLGVHPAAVLDYTGPAVE 482

Query: 482 SIIENYTLKTG 492
           ++   Y +  G
Sbjct: 483 ALTNAYRVAIG 493


>gi|85708740|ref|ZP_01039806.1| NADH dehydrogenase subunit M [Erythrobacter sp. NAP1]
 gi|85690274|gb|EAQ30277.1| NADH dehydrogenase subunit M [Erythrobacter sp. NAP1]
          Length = 513

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 250/484 (51%), Positives = 339/484 (70%), Gaps = 12/484 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+ P L+ +  +P  G    LF+   G   R    +ALG + + F   + +W+ ++ G +
Sbjct: 1   MDFPILTTMMLVPLAGAIACLFA---GNASRV---IALGATLVTFGLGVMLWANYEIGGA 54

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            +Q  E Y  +  F SY LG+DGI+++L++L+ FL P CIL+SW+ I +   EYM AFL 
Sbjct: 55  QWQFQESYELVAGF-SYALGIDGIALMLIMLSVFLMPICILASWEGITKRVGEYMAAFLF 113

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++IG F + D+ LFYI FEA LIPM++IIGVWGG  RIYA+YKFFLYT  GS+ ML 
Sbjct: 114 MEVLMIGTFAAQDIFLFYIMFEAGLIPMYLIIGVWGGDNRIYASYKFFLYTLLGSVLMLV 173

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A+  M  E  TS I  L     FP   Q W+W+AFF SFA+K+PM+PFHTWLP+AHVQAP
Sbjct: 174 AMFWMVAEAGTSYIPALMEY-PFPGGAQTWLWLAFFASFAVKVPMWPFHTWLPDAHVQAP 232

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF LP+FP AS  FA  +F LS+IA++Y SLV++VQ D+K
Sbjct: 233 TAGSVILAGVLLKLGGYGFIRFSLPMFPEASADFAWFVFILSMIAVVYTSLVALVQADMK 292

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM  VT+G+F+    G+EGAM  MLSHGLVS ALF CVGVIYDRLHTR+I 
Sbjct: 293 KLIAYSSVAHMAIVTVGLFAFNVQGLEGAMIVMLSHGLVSGALFLCVGVIYDRLHTREIE 352

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL  NMP YA+  ++FTMA++GLPGTSGF+GEFL +  ++Q S+ VA++ + G++L 
Sbjct: 353 RYGGLSINMPYYAIFFLLFTMASIGLPGTSGFVGEFLSLAGIYQTSSLVALICTTGIILG 412

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y L+LYR+V FG  K      + D+++RE  M+ PIA + ++ G+YP    ++F  P+
Sbjct: 413 AAYMLYLYRRVAFGGQKNPDAAAMSDITVREWAMMAPIAAVVLWMGVYP----ESFLAPM 468

Query: 481 SSII 484
            + I
Sbjct: 469 RADI 472


>gi|307293258|ref|ZP_07573104.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingobium chlorophenolicum L-1]
 gi|306881324|gb|EFN12540.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingobium chlorophenolicum L-1]
          Length = 523

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 342/484 (70%), Gaps = 13/484 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK--GRSS 61
           P LS++  +P  G    LF+     G      +AL  +  + +  + +W  FD+  G + 
Sbjct: 5   PILSLMMAVPMAGAIACLFA-----GANQARWIALLATLADLVLGIILWMNFDQSGGAAQ 59

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           +Q  EY      F ++ LG+DGI++LL+ LT FL P CI +SW SI++  +EYM AFL +
Sbjct: 60  WQFQEYAPIFGRF-AWALGIDGIALLLIALTVFLMPICIGASWLSIEKRVQEYMAAFLFM 118

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E ++IG F + D+ LFYI FEA LIPM++IIG+WGG +RIYA+YKFFLYT  GS+ ML A
Sbjct: 119 EVLMIGVFTAQDLYLFYIMFEAGLIPMYLIIGIWGGVDRIYASYKFFLYTLLGSVLMLIA 178

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ M  E  T+ I  L A +  P  IQ W+W+AFF SFA+K+PM+P HTWLP+AHVQAPT
Sbjct: 179 MMWMVHEAGTTDIPTLMAYNFDP-HIQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPT 237

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAG++LKMGGYG IRF LP+FP AS   AP+++ LS++A++Y SLV++VQ+D+KK
Sbjct: 238 AGSVILAGVLLKMGGYGFIRFSLPMFPEASAQLAPLVWGLSMVAVVYTSLVALVQSDMKK 297

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHM  VTIG+F+  ++G+EGAM  ML HGLVS ALF CVGVIYDRLHTR+I  
Sbjct: 298 LIAYSSVAHMAIVTIGLFAFNQAGLEGAMMVMLGHGLVSGALFLCVGVIYDRLHTREIAR 357

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGL  NMP+YAV+ M+FTMA++GLPGTS F+GEFL +M ++Q S+ VA++A+ G++L A
Sbjct: 358 YGGLSINMPKYAVLFMLFTMASVGLPGTSNFVGEFLSLMGIYQASSWVALVATTGIILGA 417

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y L+LYR++ +G  K      + DLS+RE  ++ PIA   ++ G+YP    ++F  P+ 
Sbjct: 418 AYMLYLYRRICYGEQKNADAAAMPDLSMREMWLLAPIAAAVLWMGVYP----ESFLAPMR 473

Query: 482 SIIE 485
             I 
Sbjct: 474 PDIR 477


>gi|326387449|ref|ZP_08209058.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208105|gb|EGD58913.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 516

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/481 (51%), Positives = 345/481 (71%), Gaps = 11/481 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++  +P +G  + L S     GR +   VAL  + I+F   + +W+ FD G + +Q
Sbjct: 5   PILSLMLLVPLVGAVLCLKS-----GRETARVVALIATLIDFALGVVLWTHFDIGGAQWQ 59

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
             E+      F  + LG+DGI++LL+VLT FL P CI +SW SI++   EY  AFL+ E+
Sbjct: 60  FQEHAALFSGF-DWKLGIDGIALLLIVLTVFLMPICIGASWNSIEKRAGEYYAAFLLTET 118

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F++ D+ LFYI FEA LIPM++IIG+WGG+ERIYA+YKFFLYT  GS+ ML A+ 
Sbjct: 119 LLLGVFVAQDLFLFYIMFEAGLIPMYLIIGIWGGAERIYASYKFFLYTLLGSVLMLIAMF 178

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M  E  T+ I  L A + FP + Q W+++AFF SFA+K+PM+PFHTWLP+AHVQAPT G
Sbjct: 179 WMVNEAGTTDIPTLMAYN-FPPAAQTWLFLAFFASFAVKMPMWPFHTWLPDAHVQAPTGG 237

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAG++LKMGGYG IRF LP+FP+AS +FAP+I+ LS+ A++  SL+++VQ D+KKLI
Sbjct: 238 SVILAGVLLKMGGYGFIRFSLPMFPVASAHFAPLIWGLSMAAVVITSLIALVQNDMKKLI 297

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VT+G+F+  + G+EG+M  MLSHG+VS ALF  VGVIYDRLHTR+I  YG
Sbjct: 298 AYSSVAHMAIVTVGLFAFNRQGLEGSMIVMLSHGIVSGALFLGVGVIYDRLHTREITRYG 357

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL  NMP YA+  M+FTMA++GLPGTSGF+GEFL ++ V+Q S+ VA++A+ G++L A Y
Sbjct: 358 GLAVNMPYYALFFMLFTMASIGLPGTSGFVGEFLSLLGVYQESSWVALIATTGIILGAAY 417

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
            L+LYR+V+FG        +L DL  RE  M+ P+A + ++ G+YP    ++F  P+   
Sbjct: 418 MLYLYRRVIFGEQANADAAKLPDLDFREWAMMIPLAAVVLWMGVYP----ESFLAPMRKD 473

Query: 484 I 484
           I
Sbjct: 474 I 474


>gi|304321904|ref|YP_003855547.1| NADH dehydrogenase subunit M [Parvularcula bermudensis HTCC2503]
 gi|303300806|gb|ADM10405.1| NADH dehydrogenase subunit M [Parvularcula bermudensis HTCC2503]
          Length = 553

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 255/522 (48%), Positives = 352/522 (67%), Gaps = 41/522 (7%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYL-------GCGRRSFFGVALGISTINFIFSLFVWSV 54
           ++P L+I+TFLP +GV  I+            G  R + + VAL  +   F FS +V+  
Sbjct: 8   DMPLLTILTFLPLVGVAFIMLRQATSRPDERDGAARAAKW-VALATTLFTFAFSGYVYLQ 66

Query: 55  FDKGRSSFQMIEYYHW---------------IDYFC-----SYHLGVDGISILLVVLTTF 94
           FD+    +Q++E   W               +D  C     +Y +GVDGISIL V+LTTF
Sbjct: 67  FDQSAQGYQLVEQTAWLTGCAEASSAGVDQAVDETCLPQGITYKMGVDGISILFVLLTTF 126

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           + P  IL+ W+SI     EYM+AFLVLE+++IG F +LD+LLFY+FFEASLIPMF+IIG+
Sbjct: 127 IMPIAILAGWRSISSRVAEYMVAFLVLETLIIGVFCALDLLLFYVFFEASLIPMFLIIGI 186

Query: 155 WGG-----------SERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKF 203
           WG              RIYAA+KFFLYT FGS+ +L A++ M  +  T+ ++ L  +S F
Sbjct: 187 WGSKGERSIFGLTVQNRIYAAFKFFLYTLFGSLLLLLALIYMYLQTGTTDVVALQQVS-F 245

Query: 204 PFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFL 263
               Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGS+ LA I+LKMGGYG +RF 
Sbjct: 246 GDGAQKWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSIVLAAILLKMGGYGFLRFS 305

Query: 264 LPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMK 323
           LP+FP AS YFAP++F LS+IAI+Y SLV+  Q D+KKLIAYSS+AHMG+VT+GIF+   
Sbjct: 306 LPMFPDASLYFAPLVFTLSVIAILYTSLVAFAQEDMKKLIAYSSVAHMGFVTMGIFTMTD 365

Query: 324 SGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMAN 383
            G+EGA+FQMLSHG +S ALF CVG++YDRLHTR+I AYGGLV +M  +A   ++F+MAN
Sbjct: 366 QGLEGALFQMLSHGFISGALFLCVGIVYDRLHTREISAYGGLVGHMKWFAFFFLLFSMAN 425

Query: 384 MGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQ 443
           +GLPG SGF+GE L ++  FQ +  VA L++ G+VL+A Y L LYR+V FG     +V+ 
Sbjct: 426 VGLPGLSGFVGEILTMVGAFQVNTWVAALSALGMVLAASYGLRLYREVAFGTVTNPEVKT 485

Query: 444 LKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIE 485
           + DL  RE  ++  +A + ++ G++P P    F  P + +++
Sbjct: 486 MPDLDRRELSLLTVLAAMALYLGVHPSPTLAVFR-PATELVQ 526


>gi|332185891|ref|ZP_08387638.1| proton-translocating NADH-quinone oxidoreductase, chain M family
           protein [Sphingomonas sp. S17]
 gi|332014249|gb|EGI56307.1| proton-translocating NADH-quinone oxidoreductase, chain M family
           protein [Sphingomonas sp. S17]
          Length = 516

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 340/484 (70%), Gaps = 10/484 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++  +P +     LF +  G        +AL  + I+F   + +W+ FD G + +Q
Sbjct: 5   PILSVMLAVPAVAAIACLFLNANGARM-----LALAATLIDFALGIVLWTQFDVGGAQWQ 59

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            +E+   I     + LG+DG ++LL++L+ FL P CI +SW++I +   EYM  FL  E 
Sbjct: 60  FVEHAPGIFGPFGWSLGIDGFALLLIMLSVFLMPICIGASWRAIDKRVPEYMGLFLFTEV 119

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F + D+ LFY+FFEA LIPM++IIG+WGG+ RIYA+YKFFLYT  GS+ M  A++
Sbjct: 120 LMIGTFAAQDLFLFYVFFEAGLIPMYLIIGIWGGANRIYASYKFFLYTLLGSLLMFVAML 179

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M     T+SI  L A   FP S+Q W+WIAFF SFA+K+PM+P HTWLP+AHVQAPTAG
Sbjct: 180 YMARTAGTTSIPALLAY-DFPASVQTWLWIAFFASFAVKMPMWPVHTWLPDAHVQAPTAG 238

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAG++LK+GGYG +RFLLP+FP AS     +IF LS +A+IYASLV++VQ+D+KKLI
Sbjct: 239 SVILAGVLLKLGGYGFLRFLLPMFPEASGQLTWLIFALSAVAVIYASLVALVQSDMKKLI 298

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+++  + G+EGAM  MLSHGLVS ALF CVGVIYDRLHTR+I  YG
Sbjct: 299 AYSSVAHMAIVTIGLYAFNQQGIEGAMIMMLSHGLVSGALFLCVGVIYDRLHTREIARYG 358

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL  NMP+YAV+ + FTMA++GLPGTSGF+ EFL +M  +Q S   A+L + G++L A Y
Sbjct: 359 GLSINMPKYAVLFLFFTMASIGLPGTSGFVAEFLSLMGTYQVSTWTALLCTTGIILGAAY 418

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP----VPIRDTFSVP 479
            L+LYR+V +G  K ++V  + DLS RE  ++ PIA +T++ G+YP     P+R   ++ 
Sbjct: 419 MLYLYRRVAYGEIKSDEVAAMPDLSARELWLLAPIAAVTLWMGVYPESFLAPMRKDVTIL 478

Query: 480 LSSI 483
           L  I
Sbjct: 479 LQRI 482


>gi|114771831|ref|ZP_01449224.1| NADH dehydrogenase subunit M [alpha proteobacterium HTCC2255]
 gi|114547647|gb|EAU50538.1| NADH dehydrogenase subunit M [alpha proteobacterium HTCC2255]
          Length = 513

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 251/504 (49%), Positives = 349/504 (69%), Gaps = 21/504 (4%)

Query: 5   FLSIVTFLPFLGVFV--ILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
            LSIV FLP L   +  ++        +R+   +AL  +   F+ SL + + FD   +SF
Sbjct: 4   LLSIVIFLPSLAALILAVILRGEDELSQRNAKILALVATLATFVISLPLLTQFDPTNTSF 63

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q +E Y+W+     Y +G+DGISIL V+LTTFL P  I + W ++    +EYMI FL+LE
Sbjct: 64  QFVEEYNWLAGL-KYKVGLDGISILFVMLTTFLMPIVIGACW-TVSSRVKEYMIMFLLLE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +M++  F SLD++LFY+ FEA LIPMF+I+G+WGG +RIYAA+K FLYT  GS+ ML AI
Sbjct: 122 TMMLAVFSSLDIILFYVVFEAGLIPMFLIVGIWGGKDRIYAAFKLFLYTLLGSVLMLIAI 181

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFS--------------IQYWMWIAFFCSFAIKIPMFPF 228
           + M +E  T+   D+  + +  FS              IQ  +++ FF SFA+K+PM+P 
Sbjct: 182 IYMWFEAGTT---DIPTLMQHQFSSENMIIFGITIIGGIQTLLFLGFFASFAVKMPMWPV 238

Query: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288
           HTWLP+AHVQAPTAGSV LA I+LKMGGYG +RF LP+FP+ S   A  +  LS+IAIIY
Sbjct: 239 HTWLPDAHVQAPTAGSVVLAAILLKMGGYGFLRFSLPMFPVGSDVMATFVMTLSVIAIIY 298

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
            SLV++VQ D+KKLIAYSS+AHMG+VT+GIF+  K G++GA+FQMLSHG +S+ALF  VG
Sbjct: 299 TSLVALVQEDMKKLIAYSSVAHMGFVTMGIFALNKQGLDGAIFQMLSHGFISAALFLGVG 358

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           VIYDR+HTRDI AYGGLV  MP +A++ M+FTMAN+GLPGTSGF+GEFL + + F+ +  
Sbjct: 359 VIYDRMHTRDIDAYGGLVIRMPVFALIFMLFTMANVGLPGTSGFVGEFLTLTAAFKANTW 418

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           +A  A+ GV+LSA Y+LWLYR+VVFG    E ++ + D+ +RE+ ++ P+ ++T+  GIY
Sbjct: 419 IAFGATTGVILSAGYALWLYRRVVFGDLVKESLKGISDMDVREKLLMTPLIIMTILLGIY 478

Query: 469 PVPIRDTFSVPLSSIIENYTLKTG 492
           P  I D     +++++E      G
Sbjct: 479 PALILDLIGPSVNALLEQVHAAQG 502


>gi|254294090|ref|YP_003060113.1| proton-translocating NADH-quinone oxidoreductase, chain M [Hirschia
           baltica ATCC 49814]
 gi|254042621|gb|ACT59416.1| proton-translocating NADH-quinone oxidoreductase, chain M [Hirschia
           baltica ATCC 49814]
          Length = 493

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 257/479 (53%), Positives = 347/479 (72%), Gaps = 9/479 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGV---ALGISTINFIFSLFVWSVFDKG 58
           + P LS++TFLP +G  +IL +     G +S   V   AL ++   F+ SL+  S F+  
Sbjct: 3   SFPILSMITFLPLVGALIILLTRA-AVGEQSRETVRLAALVVTLATFVLSLWAMSEFNPS 61

Query: 59  RSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
              +Q+IE   W     SY LGVDG+S+LL++LTTFL P C+L+SW +I+  F EYMIAF
Sbjct: 62  APGYQLIEDVSWFGQ-ISYKLGVDGMSMLLILLTTFLMPICVLASWNNIKIRFAEYMIAF 120

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           LVLE++++G F ++D++LFYIFFE  LIPMF+IIG+WGG+ R+YAA+KFFLYT  GS+ +
Sbjct: 121 LVLETLMLGVFCAMDLVLFYIFFEGGLIPMFIIIGIWGGANRLYAAFKFFLYTLLGSLAL 180

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +     T+ I  L   +  P  +Q W+W+AFF SFA+K+PMFP HTWLP+AHVQ
Sbjct: 181 LAALIYIYVTVGTTDIPTLQQHAFAP-EVQTWLWLAFFASFAVKLPMFPVHTWLPDAHVQ 239

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LAG++LKMGGYG +RF LP+FP AS  F P++F LS+IA+IYASLV+  QTD
Sbjct: 240 APTAGSVILAGVLLKMGGYGMLRFSLPMFPDASVLFQPLVFTLSVIAVIYASLVAFRQTD 299

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKLIAYSS+AHMG VT+GIF+  + G++GA+FQM SHGL+SSALF CVGV+YDRLHTRD
Sbjct: 300 MKKLIAYSSVAHMGLVTLGIFAFNEEGIQGAIFQMFSHGLISSALFLCVGVVYDRLHTRD 359

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I AYGGLVH MP YA + M FTMAN+GLPGTSGFIGE + ++  F+ +   A  A+ G++
Sbjct: 360 IAAYGGLVHRMPIYAALFMFFTMANVGLPGTSGFIGEIVSMVGGFKANPWAAAGAAIGMI 419

Query: 419 LSALYSLWLYRKVVFGVSK---CEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           LSA+Y L L+R  VFGV K    EK +   D++  E  ++  +A+ T+  G++P  + D
Sbjct: 420 LSAVYMLTLFRATVFGVIKNPELEKPEIAYDVTFIEGAILAILAIGTLLLGVFPSLVFD 478


>gi|296536144|ref|ZP_06898272.1| NADH-quinone oxidoreductase subunit M [Roseomonas cervicalis ATCC
           49957]
 gi|296263515|gb|EFH10012.1| NADH-quinone oxidoreductase subunit M [Roseomonas cervicalis ATCC
           49957]
          Length = 503

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 332/452 (73%), Gaps = 2/452 (0%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           AL  S I F  SL +W  FDK  + FQ +E   W+  F   YH+GVDGIS+L V+L+T L
Sbjct: 41  ALWTSLITFGLSLILWFRFDKSTADFQFVEQLSWMPEFGLGYHMGVDGISVLFVLLSTAL 100

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P CIL+SW+++Q   REYM+AFLVLE+M++G F +LDM+LFYIFFE  LIPMF+IIGVW
Sbjct: 101 VPLCILASWEAVQNRVREYMVAFLVLETMMVGMFSTLDMVLFYIFFEGVLIPMFLIIGVW 160

Query: 156 GGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAF 215
           GG+ R+YAAYK FLYT  GS+ ML A++++ ++  TS I  L+ + + P  +Q W+++AF
Sbjct: 161 GGARRVYAAYKLFLYTLLGSLLMLLAMLLLWYQAGTSYIPALFEL-RIPEHVQTWLFLAF 219

Query: 216 FCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFA 275
             SFA+K+PM+P HTWLP+AHV+APTAGSV LAG++LKMG YG +RF LPL P A+++FA
Sbjct: 220 LASFAVKVPMWPVHTWLPDAHVEAPTAGSVILAGVLLKMGAYGFLRFSLPLLPQATEFFA 279

Query: 276 PVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLS 335
           P+IF LS+IA++Y SLV++ Q D+KKLIAYSS+AHMG VTIGIF+    G+ GA+FQMLS
Sbjct: 280 PLIFALSVIAVVYTSLVALAQEDMKKLIAYSSVAHMGIVTIGIFTLNHQGISGAIFQMLS 339

Query: 336 HGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGE 395
           HG+VS ALF CVGV+YDR+H+RDI  YGG+   MP YA+V M+FTM ++ LPGT+GF GE
Sbjct: 340 HGVVSGALFLCVGVLYDRVHSRDILRYGGVAKVMPSYAMVFMLFTMGSVALPGTAGFPGE 399

Query: 396 FLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMV 455
           FLVI+  +  +  VA+ A  G++L A Y L+LYR+VVF     E ++ L DLS RE    
Sbjct: 400 FLVIVGAWNANPWVALGAGLGMILGAGYMLYLYRRVVFSKITREDLKALLDLSPREYVTF 459

Query: 456 YPIAVLTVFFGIYPVPIRDTFSVPLSSIIENY 487
            P+ +LT++ GIYP      F   +++++  +
Sbjct: 460 APLILLTLWMGIYPSSFLSFFEASVAALVTRH 491


>gi|209964538|ref|YP_002297453.1| NADH-quinone oxidoreductase chain M [Rhodospirillum centenum SW]
 gi|209958004|gb|ACI98640.1| NADH-quinone oxidoreductase chain M [Rhodospirillum centenum SW]
          Length = 516

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 245/490 (50%), Positives = 339/490 (69%), Gaps = 7/490 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P L+I TFLP +G   IL          R+   VAL  S I F+ SLF+ + FD    
Sbjct: 3   DWPILTITTFLPLVGALSILMIRGEQELVDRNAKAVALWTSLITFVISLFILANFDPSNP 62

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQM+E Y WI  F  +Y  GVDGISI  V+ +TFLTP C+L+SW +I +  +E+MIA L
Sbjct: 63  GFQMMEEYRWIPSFNIAYIKGVDGISIWFVLASTFLTPICVLASWTTIDKRVKEFMIALL 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           VLE+M++G F +LD +LFY+FFE  L+PMF+IIGVWGG  RIYAAYKFFLYTF GS+ ML
Sbjct: 123 VLETMMVGMFTALDFVLFYLFFEGVLLPMFLIIGVWGGPGRIYAAYKFFLYTFIGSVLML 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPF--SIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            AI+ M     T   +D+  M   PF  ++Q W+W+ FF +FA+K P++P HTWLP AHV
Sbjct: 183 LAILAMYLVAGT---MDMRVMVDHPFASTLQLWLWVGFFIAFAVKTPIWPLHTWLPFAHV 239

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG+MLKMGGYG IR  + + P A+ +F   +F LS++AIIY SLV++ QT
Sbjct: 240 EAPTAGSVMLAGVMLKMGGYGLIRVNVQMLPEATFFFTDFVFVLSVVAIIYTSLVALAQT 299

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KK+IAYSS+AHMGYVT+GIF+  + G++GA+FQMLSH +VS+ALF C+G  Y +LHTR
Sbjct: 300 DMKKMIAYSSVAHMGYVTMGIFTMTQQGLDGAIFQMLSHTIVSAALFLCIGFAYAQLHTR 359

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGG+  N+PRYA V MVF +A++GLPGTSGF+GEFL ++  FQ +  VA+ A+ G+
Sbjct: 360 EIVKYGGMAQNLPRYAFVFMVFMLASVGLPGTSGFVGEFLTMLGAFQVNTWVAMFAATGL 419

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           VL A Y L LYR++ FG    + V+ ++DL   +     P+  + +  G++P   +D ++
Sbjct: 420 VLGAAYMLLLYRRLFFGKLDKDGVKAMRDLRWTDTAYFAPLVAIVLIMGVFPASFKDVYA 479

Query: 478 VPLSSIIENY 487
             +  ++ ++
Sbjct: 480 PTVEKVLLDH 489


>gi|23013095|ref|ZP_00053040.1| COG1008: NADH:ubiquinone oxidoreductase subunit 4 (chain M)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 420

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 313/415 (75%), Gaps = 3/415 (0%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+ TFLP  G +F++          R+   VAL  S   F+ SLF+ + F+    
Sbjct: 3   DWPLLSLTTFLPLAGALFILTIRGETEVVARNARNVALLTSIATFVVSLFILAKFNGASP 62

Query: 61  SFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ+ E   W      +Y +GVDGIS+  V+L+TFLTP CIL+++ S+++  +EYM+AF+
Sbjct: 63  DFQLKETALWFPGTTVTYSMGVDGISMWFVLLSTFLTPICILAAYGSVEKRVKEYMVAFM 122

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +LE+M+IG F +LD++LFYIFFEA LIPMF+IIGVWGG  R+YAA+KFFLYT  GS+ ML
Sbjct: 123 ILETMMIGMFCALDLVLFYIFFEAVLIPMFIIIGVWGGQRRVYAAFKFFLYTLLGSVLML 182

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++VM ++  T+ I  L A S FPF +Q W+W+AFF SFA+K+PM+P HTWLP+AHV+A
Sbjct: 183 IAMLVMYFDAHTTDIPSLMAHS-FPFKMQLWLWLAFFASFAVKVPMWPVHTWLPDAHVEA 241

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LAG++LKMG YG IRF +P+ P AS YF P+I+ LS++A+IY SLV++VQ D+
Sbjct: 242 PTGGSVILAGVLLKMGAYGFIRFSIPMLPDASVYFTPLIYTLSIVAVIYTSLVALVQDDM 301

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSS+AHMGYVTIGIFS    GVEGA+FQMLSHG+V+SALF CVGVIYDR+HTR+I
Sbjct: 302 KKLIAYSSVAHMGYVTIGIFSMTTQGVEGAVFQMLSHGIVASALFLCVGVIYDRMHTREI 361

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLAS 414
             YGGL   MP YAVV MVFTMA++GLPGT+GF+GEFLV+M VFQ    VA  A+
Sbjct: 362 ARYGGLASRMPIYAVVFMVFTMASVGLPGTAGFVGEFLVLMGVFQVHTWVAFFAA 416


>gi|11466552|ref|NP_044801.1| NADH dehydrogenase subunit 4 [Reclinomonas americana]
 gi|2258382|gb|AAD11916.1| NADH dehydrogenase subunit 4 [Reclinomonas americana]
          Length = 493

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 244/483 (50%), Positives = 335/483 (69%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           L  +   P LGVF++      G        V+L  S + FI SLF+W  FDK  S FQ +
Sbjct: 11  LPTIILTPILGVFILFLIP--GWKTSLIKQVSLYASLLTFILSLFLWIFFDKSTSKFQFV 68

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
              +WI+     + LG+DGIS+ LV+LTTFL P CIL+ W+SI+ N +EYMI FL+L+++
Sbjct: 69  YEVNWIETLNIHFSLGIDGISLFLVILTTFLIPLCILTGWESIKHNIKEYMICFLLLDAL 128

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD++LFYIFFE+ LIPMF++IGVWG  ER + AAY  FLYTFFGS+ ML AI+
Sbjct: 129 LIMIFCVLDLVLFYIFFESVLIPMFIVIGVWGSRERKVRAAYMLFLYTFFGSLLMLIAIM 188

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           V+ ++  T+  I +   ++F    Q  +W+AFF SFAIKIPM PFH WLP AHV+APTAG
Sbjct: 189 VIYFDAGTTD-IQVLLTTEFSQERQKLLWLAFFISFAIKIPMVPFHVWLPEAHVEAPTAG 247

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAG++LK+GGYG +RF +P+FP A+ YF P+++ +S+IAIIY SL ++ Q D+K++I
Sbjct: 248 SVLLAGVLLKLGGYGILRFSIPMFPEATVYFTPLVYTMSIIAIIYTSLTTLRQIDLKRII 307

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM +VTIG+FS    G+EG++  MLSHG+VSSALF C+GV+YDR  TR +  Y 
Sbjct: 308 AYSSVAHMNFVTIGMFSLNMQGLEGSILLMLSHGIVSSALFLCIGVLYDRHKTRLLKYYS 367

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V  MP +A + M+FTMAN+ LPGTS F+GEFLV++  F ++ TVA  A+ G++L A Y
Sbjct: 368 GVVQTMPIFATLFMLFTMANISLPGTSSFVGEFLVLIGAFNSNTTVAFFATTGIILGAAY 427

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +V FG  K E +Q   D++ RE  +  P+ +L    GIYP    D   V + ++
Sbjct: 428 SLWLYNRVAFGNLKIEYIQFFYDVTRREMLVFTPLVILVFVMGIYPEIFLDAMHVSVGNL 487

Query: 484 IEN 486
           IE+
Sbjct: 488 IEH 490


>gi|103486783|ref|YP_616344.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingopyxis alaskensis RB2256]
 gi|98976860|gb|ABF53011.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingopyxis alaskensis RB2256]
          Length = 517

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/487 (47%), Positives = 343/487 (70%), Gaps = 11/487 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++  +P +   + L++     G R+   +AL  + I+F   + +W+ FD G + +Q
Sbjct: 5   PILSLMLAVPLIAAILCLYA-----GDRNARVIALAATLIDFALGIVLWASFDIGGAQWQ 59

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
             E       F  + LG+DG++++L++L+ FL P CIL+SW++I+     YM  FL++E 
Sbjct: 60  FTERADLFGRF-QWALGIDGMALMLIMLSVFLMPLCILASWEAIKSRVGLYMAMFLIMEV 118

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F++ D+LLFYIFFEA LIPM+ IIG+WGG+ R YAA+KFFLYT  GS+ ML A++
Sbjct: 119 VMIGVFMAQDLLLFYIFFEAGLIPMYFIIGIWGGANRKYAAFKFFLYTLLGSVLMLIAMI 178

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M  E  T+ I  L     FP  +Q W+W+AFF S A+K+PM+P HTWLP+AHVQAPTAG
Sbjct: 179 AMIAEAGTTDIPTLLNYD-FPVEMQTWLWLAFFASLAVKMPMWPVHTWLPDAHVQAPTAG 237

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           S+ LAG++LK+G YG +RF++P+FP AS     ++F LS++A++Y SLV++VQ D+KKLI
Sbjct: 238 SMILAGVLLKLGAYGFLRFMMPMFPDASAQLMWLVFGLSMVAVVYTSLVALVQNDMKKLI 297

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VT G+F+  + G+EGA+  MLSHG+VS+ALFFCVGVIYDRLHTR+I  YG
Sbjct: 298 AYSSVAHMAIVTAGLFAFNQQGIEGALIIMLSHGVVSAALFFCVGVIYDRLHTREIDRYG 357

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL  NMP YA+  M+FTMA++GLPGTSGF+GEFL ++ +++ S+ VA + + G++L A Y
Sbjct: 358 GLAVNMPAYALFFMLFTMASIGLPGTSGFVGEFLSLLGIYEASSVVAFVCTTGIILGAAY 417

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
            L+LYR+VVFG    + V+ + DL++RE  ++ P+A + ++ G+YP    ++F  P+   
Sbjct: 418 MLYLYRRVVFGELTKDDVKAMPDLNVREWAIMAPLAAVALWMGVYP----ESFLAPMRGD 473

Query: 484 IENYTLK 490
           +     +
Sbjct: 474 VTTVVAR 480


>gi|294011321|ref|YP_003544781.1| NADH dehydrogenase I chain M [Sphingobium japonicum UT26S]
 gi|292674651|dbj|BAI96169.1| NADH dehydrogenase I chain M [Sphingobium japonicum UT26S]
          Length = 523

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 246/484 (50%), Positives = 339/484 (70%), Gaps = 13/484 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK--GRSS 61
           P LS++  +P  G    LF+     G      +AL  +  +    + +W  FD+    + 
Sbjct: 5   PILSLMMAVPMAGAIACLFA-----GANQARWIALLATLADLALGVILWMNFDQSGAAAQ 59

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           +Q  EY      F ++ LG+DGI++LL+ LT FL P CI +SW +I++   EYM AFL +
Sbjct: 60  WQFQEYAPIFGRF-AWALGIDGIALLLIALTVFLMPICIGASWIAIEKRVPEYMAAFLFM 118

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E ++IG F + D+ LFYI FEA LIPM++IIG+WGG++RIYA+YKFFLYT  GS+ ML A
Sbjct: 119 EVLMIGVFTAQDLYLFYIMFEAGLIPMYLIIGIWGGADRIYASYKFFLYTLLGSVLMLIA 178

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ M  E  T+ I  L A +  P  IQ W+W+AFF SFA+K+PM+P HTWLP+AHVQAPT
Sbjct: 179 MMWMVHEAGTTDIPTLMAYNFDP-HIQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPT 237

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAG++LKMGGYG IRF LP+FP AS   AP+++ LS++A++Y SLV++VQ+D+KK
Sbjct: 238 AGSVILAGVLLKMGGYGFIRFSLPMFPEASAQLAPLVWGLSMVAVVYTSLVALVQSDMKK 297

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHM  VTIG+F+  ++G+EGAM  ML HGLVS ALF CVGVIYDRLHTR+I  
Sbjct: 298 LIAYSSVAHMAIVTIGLFAFNQAGLEGAMMVMLGHGLVSGALFLCVGVIYDRLHTREISR 357

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGL  NMP+YAV+ M+FTMA++GLPGTS F+GEFL +M ++Q S+ VA++A+ G++L A
Sbjct: 358 YGGLSINMPKYAVLFMLFTMASVGLPGTSNFVGEFLSLMGIYQASSWVALVATTGIILGA 417

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y L+LYR++ +G  K      + DLS RE  ++ PIA   ++ G+YP    ++F  P+ 
Sbjct: 418 AYMLYLYRRICYGEQKNADAAAMPDLSAREIWLLAPIAAAVLWMGVYP----ESFLAPMR 473

Query: 482 SIIE 485
             I 
Sbjct: 474 PDIR 477


>gi|85374148|ref|YP_458210.1| NADH-quinone oxidoreductase chain M [Erythrobacter litoralis
           HTCC2594]
 gi|84787231|gb|ABC63413.1| NADH-quinone oxidoreductase chain M [Erythrobacter litoralis
           HTCC2594]
          Length = 515

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 242/451 (53%), Positives = 319/451 (70%), Gaps = 10/451 (2%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFC--SYHLGVDGISILLVVLTT 93
           VAL  + IN    + +W+ F+ G   +Q  E     D F    Y LGVDGI++LL++L+ 
Sbjct: 32  VALVATMINLALGIALWAGFEIGGPQWQFTER---ADLFAGFDYALGVDGIAMLLIMLSV 88

Query: 94  FLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIG 153
           FL P C+L+SW++IQ+   EYM A L+ E ++IG F + D+ LFYIFFEA LIPM+++IG
Sbjct: 89  FLMPICVLASWEAIQKRVGEYMAALLLTEMLMIGVFAAQDLFLFYIFFEAGLIPMYLLIG 148

Query: 154 VWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           +WGG++RIYAA+KFFLYT  GS+ ML A+  M  E  TS I  L      P   Q W+W+
Sbjct: 149 IWGGADRIYAAFKFFLYTLIGSVLMLVAMFWMVNEAGTSDIPTLMQYDFAP-EAQTWLWL 207

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PMFPFHTWLP AHVQAPTAGSV LAG++LK+GGYG IRF LP+FP AS  
Sbjct: 208 AFFASFAVKVPMFPFHTWLPAAHVQAPTAGSVILAGVLLKLGGYGFIRFSLPMFPEASAQ 267

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F  ++F LS+IA+IY SLV++VQ D+KKLIAYSS+AHM  VT  +F+    G+EGAM  M
Sbjct: 268 FTWLVFALSMIAVIYTSLVALVQEDMKKLIAYSSVAHMAIVTAALFAFNVQGLEGAMIVM 327

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVS ALF CVG+IYDRLHTR+I  YGGL  NMP+YA+  ++FTMA++GLPGTSGF+
Sbjct: 328 LSHGLVSGALFLCVGIIYDRLHTREIGRYGGLAINMPKYALFFLLFTMASIGLPGTSGFV 387

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
            EFL +   +Q S++V +  + G++L A Y L+LYR+VVFG    E    +KDL+LRE  
Sbjct: 388 AEFLSLAGTYQVSSSVTLFLTTGIILGAGYMLYLYRRVVFGTQVNEDAAAMKDLNLREWA 447

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           M+ PIA   ++ G+YP    ++F  P+   I
Sbjct: 448 MLGPIAAAVLWMGVYP----ESFLAPMRQDI 474


>gi|296283852|ref|ZP_06861850.1| NADH-quinone oxidoreductase chain M [Citromicrobium bathyomarinum
           JL354]
          Length = 532

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 240/479 (50%), Positives = 333/479 (69%), Gaps = 11/479 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++  +P +G  + +F         +   VAL  + I+ +  + +W  FD G + +Q
Sbjct: 5   PILSLMLLVPLVGAVLCMF-----VNASTARWVALIATLIDLVLGIMLWLNFDIGGAQWQ 59

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
             E  +    F  Y LG+DGI+++L++L+ FL P CIL+SW S+ +   EYM AFL++E 
Sbjct: 60  FTERANLFAGF-EYALGIDGIALMLIMLSVFLMPICILASWTSVTKRVGEYMAAFLIMEL 118

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F + D+LLFYIFFEA LIPM++IIG+WGG +RIYA++KFFLYT  GS+ ML A++
Sbjct: 119 LMIGVFAAQDILLFYIFFEAGLIPMYLIIGIWGGDDRIYASFKFFLYTLLGSVVMLIAML 178

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M  E  TS +I +     FP   Q W+W+AFF SFA+K+PM+P HTWLP AHVQAPTAG
Sbjct: 179 WMIQEAGTS-LIPVLLQYDFPPEAQTWLWLAFFASFAVKMPMWPVHTWLPAAHVQAPTAG 237

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAG++LK+GGYG IRF LP+FP AS  F  ++F LS+IA++  SL+++VQ D+KKLI
Sbjct: 238 SVILAGVLLKLGGYGFIRFSLPMFPEASAQFVWLVFGLSMIAVVVTSLIALVQHDMKKLI 297

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VT G+F+    G+EGAM  MLSHGLVS ALF CVGVIYDRLHTR+I  YG
Sbjct: 298 AYSSVAHMAIVTAGLFAFNSQGIEGAMVMMLSHGLVSGALFLCVGVIYDRLHTREIARYG 357

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL  NMPRYA+  ++FTMA++GLPGTSGF+ EF+ +  ++Q S+T   + + G++L A Y
Sbjct: 358 GLATNMPRYALFFLLFTMASIGLPGTSGFVAEFISLAGIYQMSSTTTFVLTTGIILGAGY 417

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
            L+LYR+VVFG  K      + D++ RE  M+ P+A   ++ G+YP    ++F  P+ S
Sbjct: 418 MLYLYRRVVFGEQKNADAAAMPDMNAREWLMLAPVAAAVLWMGVYP----ESFLAPMRS 472


>gi|148555904|ref|YP_001263486.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingomonas wittichii RW1]
 gi|148501094|gb|ABQ69348.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingomonas wittichii RW1]
          Length = 508

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/487 (47%), Positives = 343/487 (70%), Gaps = 11/487 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M  P L+++  LP +     LF+     G ++   +AL  +  N    + +W  ++ G +
Sbjct: 1   MGFPILTVMIALPLVAALACLFA-----GAKAARWIALAATLANLGLGILLWHCYEIGGA 55

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            +Q  E+      F ++ LG+DGI++LL+VL+ FL P CI +SW++I++   EYM AFL+
Sbjct: 56  QWQFTEHVALFGRF-AWALGIDGIALLLIVLSVFLMPICIAASWEAIEKRVPEYMAAFLL 114

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E++++G F + D+ LFYIFFEA LIPM++IIG+WGG++RIYA+YKFFLYT  GS+ ML 
Sbjct: 115 METLMVGVFAAQDLFLFYIFFEAGLIPMYLIIGIWGGADRIYASYKFFLYTLLGSVLMLI 174

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M  E  T+ I  L A   FP   Q W+++AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 175 AMLWMVSEAGTTFIPALMAY-DFPPEAQTWLFLAFFASFAVKMPMWPVHTWLPDAHVQAP 233

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LKMGGYG +RF LP+FP+AS     ++  LS++AI+  SL+++VQ D+K
Sbjct: 234 TAGSVILAGVLLKMGGYGFVRFSLPMFPVASAELMWLVMGLSMVAIVVTSLIALVQEDMK 293

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM +VTIG+F+  + G+EGA+  ML HGLVS ALF CVGVIYDR+HTR+I 
Sbjct: 294 KLIAYSSVAHMAFVTIGLFAFNRQGIEGALMVMLGHGLVSGALFLCVGVIYDRMHTREIV 353

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL +NMP+YA++ ++FTMA++GLPGTS F+GEFL ++  +Q S+ VA +A+ G++  
Sbjct: 354 RYGGLSNNMPKYAMLFLLFTMASVGLPGTSNFVGEFLSLVGAYQISSWVAFVATTGIITG 413

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP----VPIRDTF 476
           A Y L+LY ++ +G ++  +   + DLS RE  ++ PIA+  ++ G+YP     P+R+  
Sbjct: 414 AAYMLYLYARIAYGAARTPEAAAMPDLSARELAILAPIALAVLWMGVYPESFLAPMRNDV 473

Query: 477 SVPLSSI 483
              L+ +
Sbjct: 474 GAVLARL 480


>gi|149184623|ref|ZP_01862941.1| NADH-quinone oxidoreductase chain M [Erythrobacter sp. SD-21]
 gi|148831943|gb|EDL50376.1| NADH-quinone oxidoreductase chain M [Erythrobacter sp. SD-21]
          Length = 514

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 245/494 (49%), Positives = 329/494 (66%), Gaps = 14/494 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M  P LS++  +P +     LF +       S   VAL  + IN    + +W  +D G +
Sbjct: 1   MEFPILSLMLAVPLVAAIACLFLT-----ASSARMVALFATLINLALGVILWLNYDIGGA 55

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            +Q  E       F  Y LG+DGI+++L++L+ FL P CIL+SW  I +   EYM AFL+
Sbjct: 56  QWQFTERAQLFAGF-EYALGIDGIALMLIMLSVFLMPICILASWDGITKRVGEYMAAFLL 114

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++IG F + D+ LFYIFFEA LIPM++IIGVWGG  RIYA+YKFFLYT  GS+ ML 
Sbjct: 115 MEVLMIGVFAAQDLFLFYIFFEAGLIPMYLIIGVWGGDNRIYASYKFFLYTLLGSVLMLI 174

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M  E  TS I  L     FP   Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAP
Sbjct: 175 AMLWMVNEAGTSDIPTLM-QYDFPVGAQLWLWLAFFASFAVKMPMWPVHTWLPDAHVQAP 233

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LAG++LK+GGYG IRF LP+FP AS   A ++F LS++A+IY SLV++VQ D+K
Sbjct: 234 TAGSVILAGVLLKLGGYGFIRFSLPMFPDASADLAWLVFALSMVAVIYTSLVALVQHDMK 293

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+AHM  V +G+F+    G+EGAM  ML HGLVS ALF CVGVIYDRLHTR+I 
Sbjct: 294 KLIAYSSVAHMAIVMVGLFAFNVQGLEGAMMVMLGHGLVSGALFLCVGVIYDRLHTREIA 353

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGGL  NMP+YA+  ++FTMA++GLPGTS F+GEFL +  +++ S  V ++ + G++L 
Sbjct: 354 RYGGLSINMPKYALFFLLFTMASVGLPGTSNFVGEFLALAGIYKVSTFVTLVCTTGIILG 413

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP----VPIRD-- 474
           A Y L+LYR+V FG  +      + DL+ RE  M+ PIA   ++ G+YP     P+R   
Sbjct: 414 AAYMLYLYRRVAFGEQRNADAAAMTDLNAREWAMLAPIAAAVLWMGVYPESFLAPMRQDI 473

Query: 475 -TFSVPLSSIIENY 487
                 L+S+   Y
Sbjct: 474 AALETRLASVAPQY 487


>gi|87200302|ref|YP_497559.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135983|gb|ABD26725.1| NADH dehydrogenase subunit M [Novosphingobium aromaticivorans DSM
           12444]
          Length = 516

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 332/487 (68%), Gaps = 11/487 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++  +P       L        R     VAL  + ++ +    +W+ +D G + +Q
Sbjct: 10  PILSLMLLVPLAAAVACLV-----VPREQARTVALVATLVDLVLGAVLWANYDVGGAQWQ 64

Query: 64  MIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
             E       F ++ LG+DGI++LL+ LT FL P CI +SW SI +   EY  AFL++E+
Sbjct: 65  FTENAPLFAGF-AWKLGIDGIALLLIALTVFLMPICIGASWVSIDKRQGEYYAAFLLMET 123

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F + D+ LFYI FEA LIPM++IIGVWGG++RIYA+YKFFLYT  GS+ ML A+ 
Sbjct: 124 LMIGVFAAQDLFLFYIMFEAGLIPMYLIIGVWGGADRIYASYKFFLYTLLGSVLMLIAMF 183

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            M  E  T+ I  L  +  FP   Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAG
Sbjct: 184 WMVNEAGTTDIPTLM-VYNFPVKAQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAG 242

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAG++LKMGGYG IRF LP+FP AS  FAP++F LS+ A++  SL+++VQ D+KKLI
Sbjct: 243 SVILAGVLLKMGGYGFIRFSLPMFPEASAQFAPLVFGLSMAAVVITSLIALVQHDMKKLI 302

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VT+G+F+  + G+EG+M  MLSHGLVS ALF  VGVIYDRLHTR+I  YG
Sbjct: 303 AYSSVAHMAIVTVGLFAFNRQGLEGSMIVMLSHGLVSGALFLSVGVIYDRLHTREIDRYG 362

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GL  NMP YAV  ++FTMA++GLPGTSGF+GEFL ++ ++Q S+ VA++ + G++L A Y
Sbjct: 363 GLSINMPYYAVFFLLFTMASIGLPGTSGFVGEFLSLIGIYQLSSWVALVCTTGIILGAAY 422

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
            L+LYR+V +G  K      + DL  RE  M+ P+A + ++ G+YP    ++F  P+   
Sbjct: 423 MLYLYRRVAYGEQKNADAAAMPDLDKREWAMMVPLAAVVLWMGVYP----ESFIAPMRKD 478

Query: 484 IENYTLK 490
           I +   +
Sbjct: 479 IASLDAR 485


>gi|148266242|ref|YP_001232948.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter uraniireducens Rf4]
 gi|146399742|gb|ABQ28375.1| NADH dehydrogenase subunit M [Geobacter uraniireducens Rf4]
          Length = 525

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/491 (48%), Positives = 347/491 (70%), Gaps = 10/491 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LSI+TFLP LGVF++ F +          G+ALGIS I FI SL + + F +  + FQ +
Sbjct: 8   LSIITFLPLLGVFLLFFVNKNSHAVSR--GIALGISLIAFIVSLPLVTGF-QNNAEFQFV 64

Query: 66  EYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           E   WI    +  +YH+G+DGIS+ LV+LTTF+ P  ILS+W +++E  +EYMI  L+LE
Sbjct: 65  EMIPWIAAGPFQMNYHIGIDGISLWLVILTTFIMPIAILSTWTAVEEKVKEYMICLLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
             ++GAF+SLD+ LFYIF+E  LIPM+ IIG+WGG  +IYAA KFF+YT  GS+ ML A+
Sbjct: 125 VGMLGAFISLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIYAAVKFFIYTMVGSLLMLVAL 184

Query: 183 VVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           + + ++      +++  Y +S  P + Q WM++AF  +FAIK+PMFP HTWLP+AH +AP
Sbjct: 185 ITLYFKAGGGDFNLLKFYQLSLDP-ATQTWMFLAFALAFAIKVPMFPLHTWLPDAHTEAP 243

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA ++LKMG YG +RF +PLFP+A+  F P+I  LS+I IIYA+LV+MVQ D+K
Sbjct: 244 TAGSVILAAVLLKMGTYGFVRFAIPLFPIATAQFTPLIATLSVIGIIYAALVAMVQEDVK 303

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KL+AYSS+AH+G+V +G+F+  + G+ G M QML+HG+ + ALF  VG IY+R HTR I 
Sbjct: 304 KLVAYSSVAHLGFVMLGVFALNQQGIAGGMLQMLNHGVSTGALFLIVGFIYERRHTRLIT 363

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVLASFGVVL 419
            +GGL   MP +A + M+ T++++GLPGT+GF+GEFLV++  F++S    +++AS GV+L
Sbjct: 364 DFGGLSKQMPVFATIFMIVTLSSIGLPGTNGFVGEFLVLIGSFESSIRWYSIIASSGVIL 423

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
           SA+Y LW++++V+FG     K Q LKDL+ RE  ++ P+ VL  F G+YP P  D  +  
Sbjct: 424 SAVYMLWMFQRVMFGELNNPKNQVLKDLNAREIVIMLPLLVLIFFMGVYPKPFLDKMTPS 483

Query: 480 LSSIIENYTLK 490
           + ++I++   K
Sbjct: 484 IDNLIQHVKTK 494


>gi|218670800|ref|ZP_03520471.1| NADH dehydrogenase subunit M [Rhizobium etli GR56]
          Length = 349

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/337 (64%), Positives = 279/337 (82%), Gaps = 1/337 (0%)

Query: 139 IFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLY 198
           +FFEA LIPMF+IIGVWGG +R+YA+YKFFLYT  GS+ ML AI+ M W+  T+ I  L 
Sbjct: 1   VFFEAGLIPMFLIIGVWGGKDRVYASYKFFLYTLLGSVLMLLAIMAMYWQAGTTDITALL 60

Query: 199 AMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYG 258
           A  KFP ++Q W+W+AFF SFA+K+PM+P HTWLP+AHVQAPTAGSV LAG++LK+GGYG
Sbjct: 61  AY-KFPPALQTWLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGVLLKLGGYG 119

Query: 259 CIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGI 318
            IRF L +FP+AS YFAP++F LS+IAIIY SLV+M+Q DIKKLIAYSS+AHMGYVT+GI
Sbjct: 120 LIRFSLGMFPVASDYFAPLVFALSVIAIIYTSLVAMMQDDIKKLIAYSSVAHMGYVTMGI 179

Query: 319 FSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMV 378
           F+    GV+G++FQMLSHG+VS ALF CVGV+YDR HTR+I AYGGLV+NMP+YAV MMV
Sbjct: 180 FAANMQGVQGSIFQMLSHGIVSGALFLCVGVVYDRTHTREINAYGGLVNNMPKYAVAMMV 239

Query: 379 FTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKC 438
           FTMAN+GLPGTSGF+GEFL ++ VF+ +  VA+ A+ GV+LSA Y+LWLYR+V+FG  + 
Sbjct: 240 FTMANVGLPGTSGFVGEFLTLIGVFRVNTWVALFAATGVILSAAYALWLYRRVIFGALEK 299

Query: 439 EKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           EK++ L DLS RE+ ++YP+  LT+ FG+YP P+ D 
Sbjct: 300 EKLKALLDLSPREQLILYPLVALTILFGVYPAPVFDA 336


>gi|94496468|ref|ZP_01303045.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingomonas sp. SKA58]
 gi|94424214|gb|EAT09238.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphingomonas sp. SKA58]
          Length = 517

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/484 (50%), Positives = 344/484 (71%), Gaps = 13/484 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS-- 61
           P LS++  +P  G    LF+     G  S   +AL  + ++ +  + +W+ FD+  ++  
Sbjct: 5   PILSLMMAVPMAGAIACLFA-----GANSARWIALIATLVDLVLGIALWANFDQAGTAAQ 59

Query: 62  FQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           +Q  EY      F ++ LG+DGI+++L+VLT FL P CI +SW++IQ+   EYM AFL +
Sbjct: 60  WQFQEYAPIFGRF-AWALGIDGIALMLIVLTVFLMPICIGASWQAIQKRVGEYMAAFLFM 118

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E ++IG F + D+ LFY+ FEA LIPM++IIG+WGG++RIYA+YKFFLYT  GS+ ML A
Sbjct: 119 EVLMIGVFTAQDIYLFYVMFEAGLIPMYLIIGIWGGADRIYASYKFFLYTLLGSVLMLIA 178

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ M  E  T+ I  L A +  P   Q W+++AFF SFA+K+PM+P HTWLP+AHVQAPT
Sbjct: 179 MMWMVHEAGTTEIPALMAYNFAP-EAQTWLFLAFFASFAVKMPMWPVHTWLPDAHVQAPT 237

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAG++LKMGGYG IRF LP+FP AS   A +I+ LS++A++Y SLV++VQ+D+KK
Sbjct: 238 AGSVILAGVLLKMGGYGFIRFSLPMFPEASAQLAWLIWGLSMVAVVYTSLVALVQSDMKK 297

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHM  VT+G+F+  ++G+EGAM  ML HGLVS ALF CVGVIYDRLHTR+I  
Sbjct: 298 LIAYSSVAHMAIVTVGLFAFNQAGIEGAMMVMLGHGLVSGALFLCVGVIYDRLHTREINR 357

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGL  NMP+YAV+ ++FTMA++GLPGTS F+GEFL +M ++Q S+ VA++ + G++L A
Sbjct: 358 YGGLSINMPKYAVLFLLFTMASVGLPGTSNFVGEFLSLMGIYQASSWVALVCTTGIILGA 417

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y L+LYR++ +G         + DLS+RE  ++ PIA   ++ G+YP    ++F  P+ 
Sbjct: 418 AYMLYLYRRIAYGEQVNADAAVMPDLSVREIALLAPIAAAVLWMGVYP----ESFLAPMR 473

Query: 482 SIIE 485
           S I 
Sbjct: 474 SDIR 477


>gi|328775173|gb|AEB39981.1| NADH dehydrogenase subunit 4 [Funaria hygrometrica]
          Length = 495

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/458 (50%), Positives = 321/458 (70%), Gaps = 3/458 (0%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLV 89
           R    + L  S I F++SL  W  FD   + FQ +E   W+ Y   ++++G+DGIS+  V
Sbjct: 35  RLIRSIGLCTSLITFLYSLLFWIQFDNSTAKFQFVETIRWLPYSNINFYIGIDGISLFFV 94

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           VLTTFL P CIL  W SI+   +EYMIAFL+ ES +I  F  LD+LLFY+FFE+ LIPMF
Sbjct: 95  VLTTFLIPICILVGWSSIKSYKKEYMIAFLICESFMIAVFCMLDLLLFYVFFESVLIPMF 154

Query: 150 VIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           +IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+ +  +   ++F    Q
Sbjct: 155 IIIGVWGSRQRKIQAAYQFFLYTLLGSVFMLLAILFIFFQTGTTDL-QILLTTEFSERRQ 213

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
             +WIAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP
Sbjct: 214 ILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFP 273

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
            A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG
Sbjct: 274 EATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSLNIQGIEG 333

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           ++  MLSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ + + FT+ANM LPG
Sbjct: 334 SILLMLSHGLVSSALFLCVGVLYDRHKTRLVKYYGGLVSTMPMFSTIFLFFTLANMSLPG 393

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS FIGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +V+FG  K + +Q+  DL+
Sbjct: 394 TSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVIFGNFKPKFLQKFSDLN 453

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            RE  + +P  V  ++ G+YP    +     +S+++++
Sbjct: 454 RREVLIFFPFIVGVIWMGVYPEVFLECMHTSVSNLVQH 491


>gi|15604625|ref|NP_221143.1| NADH dehydrogenase subunit M [Rickettsia prowazekii str. Madrid E]
 gi|6647692|sp|Q9ZCG0|NUOM_RICPR RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|3861320|emb|CAA15219.1| NADH DEHYDROGENASE I CHAIN M (nuoM) [Rickettsia prowazekii]
          Length = 491

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 237/494 (47%), Positives = 343/494 (69%), Gaps = 9/494 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVIL--FSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           + LP +SI  FLP + V  IL  F+      + S + VA+  S + FI ++++   FD  
Sbjct: 2   LELPIISITIFLPLISVLYILLFFNQNKKADKLSIY-VAMLSSVLTFISTIYILIEFDVS 60

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            +++Q +E Y W+D     +H+GVDGI+I  VVLT+FLT  CI+ S  +I++  +EY++ 
Sbjct: 61  NNTYQFVERYTWLDKIGLEFHVGVDGIAIFFVVLTSFLTLICIIGSLFTIKKYIKEYLVC 120

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL++ES+ IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+F
Sbjct: 121 FLLMESLCIGAFTSINLLLFYLFFEAILVPMYIIIGVWGGDNRIYAALKFFLYTFFGSVF 180

Query: 178 MLFAIVVMCWEKKTSSIIDLYAM-SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            L A++ +  +  +  + ++  +    P   Q  +W A F +FAIK PM PFHTWLP+AH
Sbjct: 181 FLLALIYIYSKIHSFDLTNILELIGNIPLFAQKILWWAIFIAFAIKTPMIPFHTWLPDAH 240

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           VQAPT GSV LAGI+LK+GGYG +R LLPLFP ASQ FA  + +LS+IAIIYASLV++ Q
Sbjct: 241 VQAPTTGSVILAGILLKLGGYGFLRVLLPLFPNASQEFAIYVIYLSVIAIIYASLVALAQ 300

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            DIK++IAYSSIAHMGYVTIGIFS  + G+ GA+FQMLSHG++SS+LF  VG +Y+RLHT
Sbjct: 301 KDIKQMIAYSSIAHMGYVTIGIFSFTEIGISGAIFQMLSHGIISSSLFLIVGTLYERLHT 360

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           ++I  YGG+ + MP  A   M+  ++++GLP TSGFIGEFL ++ +++ +   A +A+ G
Sbjct: 361 KEIAKYGGVANKMPILATFFMIAMLSSIGLPSTSGFIGEFLSLLGIYKVNVVTAFIAALG 420

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A+Y L LY++V+ G     +++  +DL   E   + P+ +L ++FG+ P  I + F
Sbjct: 421 IILGAVYMLKLYKEVMLGEITNTEIKHFRDLYKYEIISIAPLILLIIYFGLMPNSILNVF 480

Query: 477 SVPLSSIIENYTLK 490
            +     +EN  +K
Sbjct: 481 HLS----VENLLIK 490


>gi|328775235|gb|AEB40013.1| NADH dehydrogenase subunit 4 [Funaria hygrometrica]
          Length = 495

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/458 (50%), Positives = 320/458 (69%), Gaps = 3/458 (0%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLV 89
           R    + L  S I F++SL  W  FD   + FQ +E   W+ Y   ++++G+DGIS+  V
Sbjct: 35  RLIRSIGLCTSLITFLYSLLFWIQFDNSTAKFQFVETIRWLPYSNINFYIGIDGISLFFV 94

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           VLTTFL P CIL  W SI+   +EYMIAFL+ ES +I  F  LD+LLFY+FFE+ LIPMF
Sbjct: 95  VLTTFLIPICILVGWSSIKSYKKEYMIAFLICESFMIAVFCMLDLLLFYVFFESVLIPMF 154

Query: 150 VIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           +IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+ +  +   ++F    Q
Sbjct: 155 IIIGVWGSRQRKIQAAYQFFLYTLLGSVFMLLAILFIFFQTGTTDL-QILLTTEFSERRQ 213

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
             +WIAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP
Sbjct: 214 ILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFP 273

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
            A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG
Sbjct: 274 EATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSLNIQGIEG 333

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           ++  MLSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ + + FT ANM LPG
Sbjct: 334 SILLMLSHGLVSSALFLCVGVLYDRHKTRLVKYYGGLVSTMPMFSTIFLFFTSANMSLPG 393

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS FIGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +V+FG  K + +Q+  DL+
Sbjct: 394 TSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVIFGNFKPKFLQKFSDLN 453

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            RE  + +P  V  ++ G+YP    +     +S+++++
Sbjct: 454 RREVLIFFPFIVGVIWMGVYPEVFLECMHTSVSNLVQH 491


>gi|292572442|gb|ADE30357.1| NADH dehydrogenase I chain M [Rickettsia prowazekii Rp22]
          Length = 491

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/494 (47%), Positives = 342/494 (69%), Gaps = 9/494 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVIL--FSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           +  P +SI  FLP + V  IL  F+      + S + VA+  S + FI ++++   FD  
Sbjct: 2   LEFPIISITIFLPLISVLYILLFFNQNKKADKLSIY-VAMLSSVLTFISTIYILIEFDVS 60

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            +++Q +E Y W+D     +H+GVDGI+I  VVLT+FLT  CI+ S  +I++  +EY++ 
Sbjct: 61  NNTYQFVERYTWLDKIGLEFHVGVDGIAIFFVVLTSFLTLICIIGSLFTIKKYIKEYLVC 120

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL++ES+ IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+F
Sbjct: 121 FLLMESLCIGAFTSINLLLFYLFFEAILVPMYIIIGVWGGDNRIYAALKFFLYTFFGSVF 180

Query: 178 MLFAIVVMCWEKKTSSIIDLYAM-SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            L A++ +  +  +  + ++  +    P   Q  +W A F +FAIK PM PFHTWLP+AH
Sbjct: 181 FLLALIYIYSKIHSFDLTNILELIGNIPLFAQKILWWAIFIAFAIKTPMIPFHTWLPDAH 240

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           VQAPT GSV LAGI+LK+GGYG +R LLPLFP ASQ FA  + +LS+IAIIYASLV++ Q
Sbjct: 241 VQAPTTGSVILAGILLKLGGYGFLRVLLPLFPNASQEFAIYVIYLSVIAIIYASLVALAQ 300

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            DIK++IAYSSIAHMGYVTIGIFS  + G+ GA+FQMLSHG++SS+LF  VG +Y+RLHT
Sbjct: 301 KDIKQMIAYSSIAHMGYVTIGIFSFTEIGISGAIFQMLSHGIISSSLFLIVGTLYERLHT 360

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           ++I  YGG+ + MP  A   M+  ++++GLP TSGFIGEFL ++ +++ +   A +A+ G
Sbjct: 361 KEIAKYGGVANKMPILATFFMIAMLSSIGLPSTSGFIGEFLSLLGIYKVNVVTAFIAALG 420

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A+Y L LY++V+ G     +++  +DL   E   + P+ +L ++FG+ P  I + F
Sbjct: 421 IILGAVYMLKLYKEVMLGEITNTEIKHFRDLYKYEIISIAPLILLIIYFGLMPNSILNVF 480

Query: 477 SVPLSSIIENYTLK 490
            +     +EN  +K
Sbjct: 481 HLS----VENLLIK 490


>gi|91208857|ref|YP_539018.1| NADH dehydrogenase subunit 4 [Physcomitrella patens]
 gi|90991397|dbj|BAE93089.1| NADH dehydrogenase subunit 4 [Physcomitrella patens]
          Length = 495

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/458 (50%), Positives = 320/458 (69%), Gaps = 3/458 (0%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLV 89
           R    + L  S I F++SL  W  FD   + FQ +E   W+ Y   ++++G+DGIS   V
Sbjct: 35  RLIRSIGLCTSLITFLYSLLFWIQFDNSTAKFQFVETIRWLPYSNINFYIGIDGISSFFV 94

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           VLTTFL P CIL  W SI+   +EYMIAFL+LES +I  F  LD+LLFY+FFE+ LIPMF
Sbjct: 95  VLTTFLIPICILVGWSSIKSYKKEYMIAFLILESFMIAVFCMLDLLLFYVFFESVLIPMF 154

Query: 150 VIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           +IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+ +  +   ++F    Q
Sbjct: 155 IIIGVWGSRQRKIQAAYQFFLYTLLGSVFMLLAILFIFFQTGTTDL-QILLTTEFSERRQ 213

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
             +WIAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP
Sbjct: 214 ILLWIAFFASFSVKVPMIPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFP 273

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
            A+  F P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG
Sbjct: 274 EATLXFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSLNIQGIEG 333

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           ++  MLSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ + + FT+ANM LPG
Sbjct: 334 SILLMLSHGLVSSALFLCVGVLYDRHKTRLVKYYGGLVSTMPMFSTIFLFFTLANMSLPG 393

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS FIGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +V+FG  K + +Q+  DL+
Sbjct: 394 TSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVIFGNFKPKFLQKFSDLN 453

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            RE  + +P  V  ++ G+YP    +     +S+++++
Sbjct: 454 RREVLIFFPFIVGVIWMGVYPEVFLECMHTSVSNLVQH 491


>gi|38638282|ref|NP_943685.1| NADH dehydrogenase subunit 4 [Chara vulgaris]
 gi|32966596|gb|AAP92179.1| NADH dehydrogenase subunit 4 [Chara vulgaris]
          Length = 496

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 236/476 (49%), Positives = 324/476 (68%), Gaps = 5/476 (1%)

Query: 13  PFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID 72
           P LG  ++L         R    +A   S I F++SL  W  F+   + FQ +E   W+ 
Sbjct: 19  PLLGALIVLLIP--NSKIRLIRSIAFCTSLITFLYSLLFWIQFENSTAKFQFVETIRWLP 76

Query: 73  Y-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLS 131
           Y   ++++G+DGIS+  VVLTTFL P C+L  W SIQ   +EYMIAFLVLE+ +I  F  
Sbjct: 77  YSNINFYIGLDGISLFFVVLTTFLIPICMLVGWSSIQNYKKEYMIAFLVLEAFMIAVFCM 136

Query: 132 LDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKK 190
           LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+++ ++  
Sbjct: 137 LDLLLFYVFFESVLIPMFIIIGVWGSRQRKIRAAYQFFLYTLLGSVFMLLAILLILFQTG 196

Query: 191 TSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGI 250
           T+ +  +   ++F    Q  +WIAFF SFA+K+PM P H WLP AHV+APTAGSV LAGI
Sbjct: 197 TTDL-QILLTTEFSERRQILLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGI 255

Query: 251 MLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAH 310
           +LK+G YG +RF +P+FP A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AH
Sbjct: 256 LLKLGTYGFLRFSIPMFPEATLYFTPFIYTLSVIAIIYTSLTTLRQIDLKKIIAYSSVAH 315

Query: 311 MGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMP 370
           M +VTIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV  MP
Sbjct: 316 MNFVTIGMFSLNIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRLVKYYGGLVSTMP 375

Query: 371 RYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRK 430
            ++ + + FT+AN+ LPGTS FIGEFL+++  FQ +  VA LA+ G++L A YS+WLY +
Sbjct: 376 IFSTIFLFFTLANISLPGTSSFIGEFLILVGAFQAAPNVATLAAIGMILGAAYSIWLYNR 435

Query: 431 VVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           VVFG  K   + +  DL+ RE  M  P  +  V+ G+YP    +     +S+++++
Sbjct: 436 VVFGNLKPYFIHKFSDLNRREFFMFLPFVIGVVWMGVYPEVFLECMHTSVSNLVQH 491


>gi|110225643|ref|YP_665649.1| NADH dehydrogenase subunit 4 [Nephroselmis olivacea]
 gi|6066158|gb|AAF03176.1|AF110138_8 NADH dehydrogenase subunit 4 [Nephroselmis olivacea]
          Length = 500

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/453 (51%), Positives = 316/453 (69%), Gaps = 5/453 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYH--LGVDGISILLVVLTTF 94
           AL +S INFI SLF+W  FD     FQ +    W+    + H  +G+DGIS+  V+L+TF
Sbjct: 46  ALSVSLINFIASLFLWIQFDHSTPQFQFVTKITWLP-ISNLHIYMGIDGISLFFVILSTF 104

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CIL  W SIQ   REY+IAFL+LES +I  F  LD+LLFY+FFE+ LIPMF+IIG+
Sbjct: 105 LVPICILVGWVSIQTYVREYVIAFLILESCMIAVFCMLDLLLFYVFFESVLIPMFLIIGI 164

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  ER I AAY+FFLYT FGS+ ML AI+++ ++  T+ +  LY  S F    Q  +W+
Sbjct: 165 WGSRERKIRAAYQFFLYTLFGSVLMLLAIILIYFQTGTTDLQVLYTTS-FSEKRQILLWL 223

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APT+GSV LAG++LK+G YG +RF +P+FP AS Y
Sbjct: 224 AFFASFAVKVPMVPVHIWLPEAHVEAPTSGSVILAGVLLKLGTYGFLRFSIPMFPEASLY 283

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P+I+ +S+IA+IYASL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG++  M
Sbjct: 284 FTPLIYTMSIIAVIYASLTTIRQIDLKKVIAYSSVAHMAFVTIGLFSLNVQGIEGSILLM 343

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVG +YDR  TR I  YG  VH MP ++V+ + FT+ N+ LPGTS F+
Sbjct: 344 LSHGLVSSALFLCVGCLYDRHKTRLIPYYGACVHTMPIFSVIFLFFTLGNLSLPGTSSFV 403

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQN+  +  LA+ G+VL A YSLWLY +VVFG  K   +    D + RE  
Sbjct: 404 GEFLILVGAFQNNTLITTLAATGMVLGAAYSLWLYNRVVFGNFKPNFINVYSDCNRREVF 463

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           M  P+ +  ++ GIYP    D     ++++I++
Sbjct: 464 MFLPLIIAVLWMGIYPEVFLDPMHCSVANVIQH 496


>gi|261856538|ref|YP_003263821.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Halothiobacillus neapolitanus c2]
 gi|261837007|gb|ACX96774.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Halothiobacillus neapolitanus c2]
          Length = 507

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 239/502 (47%), Positives = 345/502 (68%), Gaps = 26/502 (5%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFG-VALGISTINFIFSLFVWSVFDKGRSS 61
           P LS++ +LP + G+FV+ F    G GR  F    AL  S + F+ SL +   FD    +
Sbjct: 7   PMLSLIVWLPIIAGIFVMWF----GAGRARFARWFALASSVVVFLLSLALLPGFDTHTYA 62

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI  F   YHLGVDGIS+ L++LTTF T   I+S+W+ IQE   +Y+ AFL+
Sbjct: 63  MQFVERVAWIPQFGIHYHLGVDGISLPLLILTTFTTVIVIVSAWEVIQEKAHQYLAAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E M+ G F +LD ++FY FFE  LIPMFVIIG+WGG  R+YA  KFFLYTF GS+FML 
Sbjct: 123 MEGMMNGTFAALDAIVFYFFFEGMLIPMFVIIGIWGGPRRVYATIKFFLYTFLGSVFMLI 182

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ M ++  + SI+    M + P ++  Q  +++AFF +FA+KIPM+P HTWLP+AHV+
Sbjct: 183 ALIYMYFKGGSFSILH---MQQLPLTLTEQVLIFLAFFIAFAVKIPMWPVHTWLPDAHVE 239

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+GGYG +RF LP+ P AS     +I   SLIAI+Y   V++VQ+D
Sbjct: 240 APTGGSVILAAIMLKIGGYGFLRFSLPITPDASALLDSMIIAFSLIAIVYIGFVALVQSD 299

Query: 299 IKKLIAYSSIAHMGYVTIGIF--------------SGMKSGVEGAMFQMLSHGLVSSALF 344
           +KKL+AYSSI+HMG+VT+G+F              SG++  +EGAM QM+SHGL+S+A+F
Sbjct: 300 MKKLVAYSSISHMGFVTLGMFVIFMIAANPLNVSGSGVRLALEGAMVQMISHGLISAAMF 359

Query: 345 FCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQ 404
             +GV+YDRLH+R+I AYGG+V+ MP +A +++VF MAN+GLPGTSGF+GEF+VI++ F+
Sbjct: 360 LSIGVLYDRLHSREISAYGGVVNTMPWFAAMVVVFAMANVGLPGTSGFVGEFMVILASFK 419

Query: 405 NSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVF 464
            +  +A+LA+  +++ A Y+LW+ ++V+FG  + E V +LKD++ RE  M+  + VL + 
Sbjct: 420 ANFWIALLAALTLIIGASYTLWMVKRVIFGDVQNEGVAKLKDVNKREAWMLGSLVVLIIL 479

Query: 465 FGIYPVPIRDTFSVPLSSIIEN 486
            GI+P P+ D     +  + + 
Sbjct: 480 VGIWPNPLLDLMHATIEHLAQQ 501


>gi|171316315|ref|ZP_02905536.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ambifaria MEX-5]
 gi|171098541|gb|EDT43342.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ambifaria MEX-5]
          Length = 496

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 335/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGTARW--VALIGSLLGLAVTIPLITGFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEKSTWIERFDISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YTQTHSFDLATWQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P ASQ+ APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASQFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTMLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|157827772|ref|YP_001496836.1| NADH dehydrogenase subunit M [Rickettsia bellii OSU 85-389]
 gi|157803076|gb|ABV79799.1| NADH dehydrogenase I chain M [Rickettsia bellii OSU 85-389]
          Length = 494

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/492 (47%), Positives = 340/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +      VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISITIFLPLISVLYILLFISQSKKPDKQIHTMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+G+DGISI  V LT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPTYQFVERYSWLDKIGLEFHVGIDGISIFFVSLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFE  L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSINLLLFYLFFEVILVPMYIIIGVWGGENRIYAAVKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYA-MSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +I+ +  +  +  + ++    + FP  +Q  +W A F +FAIKIPM PFHTWLP+A
Sbjct: 182 FFLLSIIYIYSKIHSFDLSNIGEFTNNFPLHVQQILWWAIFIAFAIKIPMIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P ASQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLLPNASQEFAIYVIWLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS   SGV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTDSGVSGALFQMLSHGIISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     LA+ 
Sbjct: 362 TKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVIATFLAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L A+Y L LY++V+ G    +++   +DL + E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIILGAIYMLKLYKEVMLGEITNKEIINFRDLYIYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           F + + +++  +
Sbjct: 482 FHLSVENLLVKF 493


>gi|83719938|ref|YP_441626.1| NADH dehydrogenase subunit M [Burkholderia thailandensis E264]
 gi|167580435|ref|ZP_02373309.1| NADH dehydrogenase subunit M [Burkholderia thailandensis TXDOH]
 gi|167618544|ref|ZP_02387175.1| NADH dehydrogenase subunit M [Burkholderia thailandensis Bt4]
 gi|257139678|ref|ZP_05587940.1| NADH dehydrogenase subunit M [Burkholderia thailandensis E264]
 gi|83653763|gb|ABC37826.1| NADH dehydrogenase I, M subunit [Burkholderia thailandensis E264]
          Length = 496

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 332/490 (67%), Gaps = 11/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDK 57
           + P LS   +LP +   V+L       G     G A  I+ I  +  L V     + FD 
Sbjct: 3   SFPILSTAIWLPIVFGLVVL-----AVGSDKNPGAARWIALIGSLAGLAVTIPLITGFDS 57

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
             ++ Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   +++ W+ I EN  +Y+ 
Sbjct: 58  STAALQFVEQTTWIERFNISYHLGVDGISMWFVVLTALITVIVVIAGWEVITENVSQYLA 117

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 118 AFLILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSL 177

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML A++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AH
Sbjct: 178 LMLVALIYL-YTQTHSFDLATWQNAKIAMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAH 236

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS +FAPV+  LSL A+IY  LV+MVQ
Sbjct: 237 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFFAPVVIALSLTAVIYIGLVAMVQ 296

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+
Sbjct: 297 ADMKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHS 356

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F 
Sbjct: 357 RQIADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFT 416

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A Y+LW+Y++V FG    +KV +L D+S RE  M+  +A  T+  G+YP P  D  
Sbjct: 417 LILGAAYTLWMYKRVYFGAVTSDKVAKLSDISRREFTMLAVLAAFTLLMGLYPKPFTDVM 476

Query: 477 SVPLSSIIEN 486
            V + +++ +
Sbjct: 477 HVSVENLLSH 486


>gi|78485174|ref|YP_391099.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thiomicrospira crunogena XCL-2]
 gi|78363460|gb|ABB41425.1| NADH dehydrogenase I chain M [Thiomicrospira crunogena XCL-2]
          Length = 504

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/499 (47%), Positives = 338/499 (67%), Gaps = 18/499 (3%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG-VALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS + +LP +G  +ILF   LG  R +F    AL +S + F+ S+ +W+ FD   S+ 
Sbjct: 6   PILSTLIWLPIIGGLLILF---LGRDRDTFTKWFALSVSVVTFLVSIPLWTQFDTSTSAM 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI  F   Y+LGVDG+S+ LV+LTTF     I S+W  I+E   +YM AF+++
Sbjct: 63  QFVEKASWISQFNIQYYLGVDGLSMPLVLLTTFTQILVIASAWDVIKERVEQYMGAFMIM 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           + ++IG F++LD +LFY+F+EA LIPMF++IG WGG +R+YA  KFFLYTFFGS+FML A
Sbjct: 123 QGLMIGVFVALDGILFYVFWEALLIPMFIVIGKWGGQDRVYATIKFFLYTFFGSVFMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
            + M ++  + SI+D +AM     + Q  +++AF  +FA+K+PMFP HTWLP+AHVQAPT
Sbjct: 183 FLYMYFQSGSFSILDFHAM-HLGSTAQILIFLAFLIAFAVKVPMFPVHTWLPDAHVQAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LA IMLKMGGYG +RF LP+ P AS     ++  LSLIAI Y  LV+MVQ D+KK
Sbjct: 242 AGSVVLAAIMLKMGGYGFVRFSLPITPDASMELDWLVIALSLIAIFYIGLVAMVQKDMKK 301

Query: 302 LIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           L+AYSSI+HMG+VTIG+F             G   G+EGAM QM+SHG +S A+F  +GV
Sbjct: 302 LVAYSSISHMGFVTIGMFLVYDIVQNTGSIQGSMIGMEGAMIQMISHGFISGAMFLMIGV 361

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDR+HTR+I AYGG+V+ MP +    ++F MAN GLPGTSGF+GEF+VI++ F+ +   
Sbjct: 362 LYDRMHTREISAYGGVVNTMPWFGFFAVLFAMANAGLPGTSGFVGEFMVILASFKANVWY 421

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
            ++A+  +++ A Y+LW+ ++V FG    + V  LKDL+ RE  ++  +A   V  GIYP
Sbjct: 422 GIVAASTLIIGAAYTLWMVKRVFFGAVANDNVGSLKDLNKREFAIMATLAFAVVLLGIYP 481

Query: 470 VPIRDTFSVPLSSIIENYT 488
            P+ +     +++++   T
Sbjct: 482 APLIEVMHSSVANLLIQAT 500


>gi|172061197|ref|YP_001808849.1| NADH dehydrogenase subunit M [Burkholderia ambifaria MC40-6]
 gi|171993714|gb|ACB64633.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ambifaria MC40-6]
          Length = 496

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 334/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGTARW--VALIGSLLGLAVTIPLITDFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEKSTWIERFDISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YTQTHSFDLATWQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRLHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLKDIGRREFVMLAVLAAFTMLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|53718859|ref|YP_107845.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei K96243]
 gi|53725803|ref|YP_103422.1| NADH dehydrogenase subunit M [Burkholderia mallei ATCC 23344]
 gi|67642180|ref|ZP_00440940.1| NADH-quinone oxidoreductase chain m (nadh dehydrogenasei, chain m)
           (ndh-1, chain m) [Burkholderia mallei GB8 horse 4]
 gi|76812146|ref|YP_332857.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 1710b]
 gi|121600753|ref|YP_992481.1| NADH dehydrogenase subunit M [Burkholderia mallei SAVP1]
 gi|124386385|ref|YP_001026716.1| NADH dehydrogenase subunit M [Burkholderia mallei NCTC 10229]
 gi|126439650|ref|YP_001058350.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 668]
 gi|126448901|ref|YP_001079999.1| NADH dehydrogenase subunit M [Burkholderia mallei NCTC 10247]
 gi|126451700|ref|YP_001065589.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 1106a]
 gi|134283893|ref|ZP_01770589.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 305]
 gi|167000356|ref|ZP_02266174.1| NADH dehydrogenase I, M subunit [Burkholderia mallei PRL-20]
 gi|167718858|ref|ZP_02402094.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei DM98]
 gi|167737866|ref|ZP_02410640.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 14]
 gi|167815049|ref|ZP_02446729.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 91]
 gi|167823465|ref|ZP_02454936.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 9]
 gi|167845017|ref|ZP_02470525.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei B7210]
 gi|167893558|ref|ZP_02480960.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 7894]
 gi|167902004|ref|ZP_02489209.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei NCTC 13177]
 gi|167910240|ref|ZP_02497331.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei 112]
 gi|167918273|ref|ZP_02505364.1| NADH dehydrogenase subunit M [Burkholderia pseudomallei BCC215]
 gi|217419996|ref|ZP_03451502.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 576]
 gi|226195338|ref|ZP_03790927.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|237811594|ref|YP_002896045.1| NADH-quinone oxidoreductase, m subunit [Burkholderia pseudomallei
           MSHR346]
 gi|242317262|ref|ZP_04816278.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 1106b]
 gi|254175572|ref|ZP_04882232.1| NADH dehydrogenase I, M subunit [Burkholderia mallei ATCC 10399]
 gi|254181175|ref|ZP_04887772.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           1655]
 gi|254190538|ref|ZP_04897045.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254195205|ref|ZP_04901634.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           S13]
 gi|254202098|ref|ZP_04908461.1| NADH dehydrogenase I, M subunit [Burkholderia mallei FMH]
 gi|254207428|ref|ZP_04913778.1| NADH dehydrogenase I, M subunit [Burkholderia mallei JHU]
 gi|254261203|ref|ZP_04952257.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           1710a]
 gi|254298545|ref|ZP_04965997.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           406e]
 gi|254359850|ref|ZP_04976120.1| NADH dehydrogenase I, M subunit [Burkholderia mallei 2002721280]
 gi|52209273|emb|CAH35218.1| NADH dehydrogenase I chain M [Burkholderia pseudomallei K96243]
 gi|52429226|gb|AAU49819.1| NADH dehydrogenase I, M subunit [Burkholderia mallei ATCC 23344]
 gi|76581599|gb|ABA51074.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 1710b]
 gi|121229563|gb|ABM52081.1| NADH dehydrogenase I, M subunit [Burkholderia mallei SAVP1]
 gi|124294405|gb|ABN03674.1| NADH dehydrogenase I, M subunit [Burkholderia mallei NCTC 10229]
 gi|126219143|gb|ABN82649.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           668]
 gi|126225342|gb|ABN88882.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 1106a]
 gi|126241771|gb|ABO04864.1| NADH dehydrogenase I, M subunit [Burkholderia mallei NCTC 10247]
 gi|134244682|gb|EBA44780.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 305]
 gi|147746345|gb|EDK53422.1| NADH dehydrogenase I, M subunit [Burkholderia mallei FMH]
 gi|147751322|gb|EDK58389.1| NADH dehydrogenase I, M subunit [Burkholderia mallei JHU]
 gi|148029090|gb|EDK86995.1| NADH dehydrogenase I, M subunit [Burkholderia mallei 2002721280]
 gi|157808386|gb|EDO85556.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           406e]
 gi|157938213|gb|EDO93883.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696616|gb|EDP86586.1| NADH dehydrogenase I, M subunit [Burkholderia mallei ATCC 10399]
 gi|169651953|gb|EDS84646.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           S13]
 gi|184211713|gb|EDU08756.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           1655]
 gi|217397300|gb|EEC37316.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 576]
 gi|225932540|gb|EEH28538.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei Pakistan
           9]
 gi|237504615|gb|ACQ96933.1| NADH-quinone oxidoreductase, m subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238523276|gb|EEP86715.1| NADH-quinone oxidoreductase chain m (nadh dehydrogenasei, chain m)
           (ndh-1, chain m) [Burkholderia mallei GB8 horse 4]
 gi|242140501|gb|EES26903.1| NADH dehydrogenase I, M subunit [Burkholderia pseudomallei 1106b]
 gi|243063690|gb|EES45876.1| NADH dehydrogenase I, M subunit [Burkholderia mallei PRL-20]
 gi|254219892|gb|EET09276.1| NADH-quinone oxidoreductase, M subunit [Burkholderia pseudomallei
           1710a]
          Length = 496

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 332/490 (67%), Gaps = 11/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDK 57
           + P LS   +LP +   V+L       G     G A  I+ I  +  L V     + FD 
Sbjct: 3   SFPILSTAIWLPIVFGLVVL-----AVGSDKHPGAARWIALIGSLAGLAVTIPLITGFDS 57

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
             ++ Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   +++ W+ I EN  +Y+ 
Sbjct: 58  STAALQFVEQSTWIERFNISYHLGVDGISMWFVVLTALITVIVVIAGWEVITENVSQYLA 117

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 118 AFLILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSL 177

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML A++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AH
Sbjct: 178 LMLVALIYL-YTQTHSFDLATWQNAKIAMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAH 236

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS +FAPV+  LSLIA+IY  LV+MVQ
Sbjct: 237 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFFAPVVISLSLIAVIYIGLVAMVQ 296

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+
Sbjct: 297 ADMKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHS 356

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F 
Sbjct: 357 RQIADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQFNFWIAFGAAFT 416

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D  
Sbjct: 417 LILGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFTMLAVLAAFTLLMGLYPKPFTDVM 476

Query: 477 SVPLSSIIEN 486
            V + +++ +
Sbjct: 477 HVSVENLLSH 486


>gi|322421838|ref|YP_004201061.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Geobacter sp. M18]
 gi|320128225|gb|ADW15785.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter sp. M18]
          Length = 545

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/494 (47%), Positives = 338/494 (68%), Gaps = 12/494 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            LP LSI+TF P +G  V+LF +    G      VA+ ++ + F+ SL + + ++   S 
Sbjct: 3   QLPLLSILTFTPLIGAIVLLFVNKNSHG--VLRTVAMAVTVVTFVLSLPLITGYNAPGSD 60

Query: 62  ---FQMIEYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYM 115
              FQ +E   WI    +  SYHLG+DGIS+ LV+LTTF+ P  ILS++ +++E  +EYM
Sbjct: 61  IGGFQYLENIPWIAAGPFQMSYHLGIDGISLWLVILTTFIMPIAILSTYTAVEEKVKEYM 120

Query: 116 IAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGS 175
           I  L+LE  +IG F+SLD+ LFYIF+E  LIPM+ +IG+WGG  RIYAA KFF+YT  GS
Sbjct: 121 ICLLLLEVGMIGTFISLDLFLFYIFWEIMLIPMYFMIGIWGGKNRIYAAVKFFIYTAVGS 180

Query: 176 IFMLFAIVVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLP 233
           + ML A++ + ++      S++  Y +   P + Q WM++AF  +FAIK+PMFP HTWLP
Sbjct: 181 LLMLVALIALYFKAGGGDFSVLRFYQLHLDP-ATQVWMFLAFALAFAIKVPMFPLHTWLP 239

Query: 234 NAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVS 293
           +AH +APTAGSV LA +MLK G YG +RF +PLFP AS  F P+I  LS+I IIYASLV+
Sbjct: 240 DAHTEAPTAGSVILAAVMLKCGTYGYVRFAMPLFPDASAQFTPLIATLSVIGIIYASLVA 299

Query: 294 MVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDR 353
           MVQ D+KKL+AYSS+AH+G+V +G+++  + G+ G M QML+HG+ + ALF  VG IY+R
Sbjct: 300 MVQQDVKKLVAYSSVAHLGFVMLGVYALNQQGITGGMLQMLNHGVSTGALFLIVGFIYER 359

Query: 354 LHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVL 412
            HTR I  +GGL   MP +A + M+ T +++GLPGT+GF+GEFLV++  F++     A++
Sbjct: 360 RHTRLISDFGGLAKQMPVFATMFMIVTFSSIGLPGTNGFVGEFLVLLGSFESELRWYAII 419

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA+Y LW++++V+FG  K  K Q LKDL+ RE  ++ P+  L  F GIYP PI
Sbjct: 420 ATSGVILSAVYMLWMFQRVMFGELKNPKNQTLKDLNTREVVIMLPLIFLIFFLGIYPRPI 479

Query: 473 RDTFSVPLSSIIEN 486
            D+ +  +  +I  
Sbjct: 480 IDSMTPSIDRLIAQ 493


>gi|170698121|ref|ZP_02889201.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ambifaria IOP40-10]
 gi|170136979|gb|EDT05227.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ambifaria IOP40-10]
          Length = 496

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/488 (48%), Positives = 333/488 (68%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  ++ I  +F L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGTARWVALIGSLFGLAVTIPLITGFDSST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEKSTWIERFDISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYL-YTQTHSFDLATWQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQAD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTMLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|325524290|gb|EGD02403.1| NADH:ubiquinone oxidoreductase subunit M [Burkholderia sp. TJI49]
          Length = 496

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 335/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGTARW--VALIGSLLGLAVTIPLITGFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E+  WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEHSTWIERFDISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YTQTHSFDLATWQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRVHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|157964941|ref|YP_001499765.1| NADH dehydrogenase subunit M [Rickettsia massiliae MTU5]
 gi|157844717|gb|ABV85218.1| NADH dehydrogenase I chain M [Rickettsia massiliae MTU5]
          Length = 493

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/492 (47%), Positives = 342/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q IE Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFIERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGENRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  ++ ++   P   Q  +W A F +FA+KIPM PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIFIAFAVKIPMIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  ++GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTEAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+V  MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVVSKMPVLAAFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVENLLVKF 493


>gi|222053582|ref|YP_002535944.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter sp. FRC-32]
 gi|221562871|gb|ACM18843.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter sp. FRC-32]
          Length = 528

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/467 (47%), Positives = 333/467 (71%), Gaps = 8/467 (1%)

Query: 35  GVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID---YFCSYHLGVDGISILLVVL 91
           G+ALG+S I F+ S+ + + F +  + FQ +E   WI    +  SYH+G+DGIS+ LV+L
Sbjct: 35  GIALGVSLIVFLVSIPLITGF-QNTAEFQFVEKVPWISAGPFQMSYHIGIDGISLWLVIL 93

Query: 92  TTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVI 151
           TTF+ P  ILS+W +++E  +EYMI  L+LE  ++GAF+++D+ LFYIF+E  LIPM+ I
Sbjct: 94  TTFIMPIAILSTWTAVEEKVKEYMICLLLLEVGMLGAFIAIDLFLFYIFWEVMLIPMYFI 153

Query: 152 IGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTS--SIIDLYAMSKFPFSIQY 209
           IG+WGG  +IYAA KFF+YT  GS+ ML A++ + ++      +++  Y +S  P + Q 
Sbjct: 154 IGIWGGKNKIYAAVKFFIYTMVGSLLMLVALIALYFKAGGGDFNLLKFYQLSLDPVT-QT 212

Query: 210 WMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPL 269
           WM++AF  +FAIK+PMFP HTWLP+AH +APTAGSV LA ++LKMG YG +RF +PLFPL
Sbjct: 213 WMFLAFALAFAIKVPMFPLHTWLPDAHTEAPTAGSVILAAVLLKMGTYGFVRFAIPLFPL 272

Query: 270 ASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGA 329
           A+  F P+I  LS+I IIYA+LV+MVQ D+KKL+AYSS+AH+G+V +G+F+  + G+ G 
Sbjct: 273 ATDQFTPLIATLSVIGIIYAALVAMVQEDVKKLVAYSSVAHLGFVMLGVFALNEQGIAGG 332

Query: 330 MFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGT 389
           M QML+HG+ + ALF  VG IY+R HTR I  +GGL   MP +A + M+ T++++GLPGT
Sbjct: 333 MLQMLNHGVSTGALFLIVGFIYERRHTRLITDFGGLSKQMPVFATIFMIVTLSSIGLPGT 392

Query: 390 SGFIGEFLVIMSVFQNS-NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           +GF+GEFLV++  F++S    +V+A+ GV+LSA+Y LW++++V+FG     K Q LKDL+
Sbjct: 393 NGFVGEFLVLIGSFESSIRWYSVIATSGVILSAVYMLWMFQRVMFGELNNPKNQVLKDLN 452

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSD 495
            RE  ++ P+ VL  F G+YP P  D  S  + +++++   K   ++
Sbjct: 453 AREIAIMLPLLVLIFFMGVYPRPFLDKMSPSIVNLVQHVKTKQAAAN 499


>gi|15893150|ref|NP_360864.1| NADH dehydrogenase subunit M [Rickettsia conorii str. Malish 7]
 gi|20139031|sp|Q92G96|NUOM_RICCN RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|15620359|gb|AAL03765.1| NADH dehydrogenase I chain M [Rickettsia conorii str. Malish 7]
          Length = 493

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/492 (47%), Positives = 342/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISIL VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISILFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGKNRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  ++ ++   P   Q  +W A F +FA+KIP+ PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIFIAFAVKIPIIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  K+GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLAAFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVENLLVKF 493


>gi|115352326|ref|YP_774165.1| NADH dehydrogenase subunit M [Burkholderia ambifaria AMMD]
 gi|115282314|gb|ABI87831.1| NADH dehydrogenase subunit M [Burkholderia ambifaria AMMD]
          Length = 496

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 334/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGTARW--VALIGSLLGLAVTIPLITGFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEKSTWIERFDIAYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YTQTHSFDLATWQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRLHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTMLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|91204903|ref|YP_537258.1| NADH dehydrogenase subunit M [Rickettsia bellii RML369-C]
 gi|122426095|sp|Q1RKE5|NUOM_RICBR RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|91068447|gb|ABE04169.1| NADH dehydrogenase I chain M [Rickettsia bellii RML369-C]
          Length = 494

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/492 (47%), Positives = 339/492 (68%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +      VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISITIFLPLISVLYILLFISQSKKPDKQIHTMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+G+DGISI  V LT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPTYQFVERYSWLDKIGLEFHVGIDGISIFFVSLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++L+FY+FFE  L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSINLLVFYLFFEVILVPMYIIIGVWGGENRIYAAVKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYA-MSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +I+ +  +  +  + ++    + FP  +Q  +W A F +FAIKIPM PFHTWLP+A
Sbjct: 182 FFLLSIIYIYSKIHSFDLSNIGEFTNNFPLHVQQILWWAIFIAFAIKIPMIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P ASQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLLPNASQEFAIYVIWLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSI HMGYVTIGIFS   SGV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSITHMGYVTIGIFSFTDSGVSGALFQMLSHGIISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     LA+ 
Sbjct: 362 TKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVIATFLAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L A+Y L LY++V+ G    +++   +DL + E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIILGAIYMLKLYKEVMLGEITNKEIINFRDLYIYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           F + + +++  +
Sbjct: 482 FHLSVENLLVKF 493


>gi|113170508|ref|YP_717299.1| nad4 [Ostreococcus tauri]
 gi|112806915|emb|CAL36421.1| unnamed protein product [Ostreococcus tauri]
          Length = 489

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 333/477 (69%), Gaps = 5/477 (1%)

Query: 12  LPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWI 71
           LP LG   +LF       +   F  AL IS + F+ SL +W  FD   + FQ +++  W+
Sbjct: 13  LPVLGAVGLLFFPKTAVRQMKLF--ALNISLVTFVCSLNLWIFFDNSTAKFQFVQHMDWL 70

Query: 72  DYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFL 130
                ++++G+DGIS+  ++LTTFL P C+L SW+S++   RE+++AFL+LES ++  F 
Sbjct: 71  SVLNMNFYVGIDGISLFFMILTTFLVPVCLLISWQSVKHLVREFLVAFLLLESFMLAVFC 130

Query: 131 SLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            LD+LLFY+FFE+ LIPMF+IIGVWG  ER I AAY+FFLYT  GS+FML AI+++ ++ 
Sbjct: 131 MLDLLLFYVFFESVLIPMFLIIGVWGSRERKIRAAYQFFLYTLIGSLFMLLAILLIYFQV 190

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            T+ +  L+ + +F    Q ++W+AFF SFA+K+PM PFH WLP AHV+APT+GSV LAG
Sbjct: 191 GTTDLQVLHTV-EFSERRQLFLWVAFFLSFAVKVPMIPFHIWLPEAHVEAPTSGSVILAG 249

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I+LK+G YG +RF +PLFP A+ YF P+I+ +S+I IIYAS  ++ Q D+KK+IAYSS+A
Sbjct: 250 ILLKLGTYGFLRFSIPLFPEATIYFTPLIYTMSVIGIIYASFTTLRQIDLKKIIAYSSVA 309

Query: 310 HMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNM 369
           HMG+VT+G+FS    GVEGA+  MLSHG V+SALF C+G++YDR HTR I  YGGLV  M
Sbjct: 310 HMGFVTLGLFSLNMQGVEGAVLLMLSHGFVASALFLCIGILYDRTHTRLIKYYGGLVQTM 369

Query: 370 PRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYR 429
           P +A    +FT+ N+ LPGTS F+GEFL+++ VFQ +  +A LA+ G++L   YS+WLY 
Sbjct: 370 PLFAFFFFIFTLGNLSLPGTSSFVGEFLILVGVFQTNTFIATLAATGMILGGAYSIWLYN 429

Query: 430 KVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +VVFG  K   + Q  D++ RE  ++ P  V   + GIYP    ++    +++++++
Sbjct: 430 RVVFGNLKPVYINQFADINRREFFILLPFVVCIFWMGIYPSIFLESLHYSVATVLQS 486


>gi|78067034|ref|YP_369803.1| NADH dehydrogenase subunit M [Burkholderia sp. 383]
 gi|77967779|gb|ABB09159.1| NADH dehydrogenase subunit M [Burkholderia sp. 383]
          Length = 496

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/488 (48%), Positives = 332/488 (68%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  I+ I  +  L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGTARWIALIGSLLGLAVTIPLITGFDSST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEKSTWIERFDIAYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ+D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQSD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTMLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|167836062|ref|ZP_02462945.1| NADH dehydrogenase subunit M [Burkholderia thailandensis MSMB43]
          Length = 496

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/490 (47%), Positives = 333/490 (67%), Gaps = 11/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDK 57
           + P LS   +LP +   V+L       G     G A  I+ I  + SL V     + FD 
Sbjct: 3   SFPILSTAIWLPIVFGLVVL-----AVGSDKNPGAARWIALIGSLASLAVTIPLITGFDS 57

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
             ++ Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   +++ W+ I E+  +Y+ 
Sbjct: 58  STAALQFVEQSTWIERFNITYHLGVDGISMWFVVLTALITVIVVIAGWEVITEHVSQYLA 117

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  +++G F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 118 AFLILSGIMVGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSL 177

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            ML A++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AH
Sbjct: 178 LMLVALIYL-YTQTHSFDLATWQNAKIAMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAH 236

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS +FAP +  LSLIA+IY  LV+MVQ
Sbjct: 237 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFFAPAVIALSLIAVIYIGLVAMVQ 296

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+
Sbjct: 297 ADMKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHS 356

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F 
Sbjct: 357 RQIADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILASVQYNFWIAFGAAFT 416

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A Y+LW+Y++V FG    +KV +L D+S RE  M+  +A  T+  G+YP P  D  
Sbjct: 417 LILGAAYTLWMYKRVYFGAVTSDKVAKLSDISRREFTMLAVLAAFTLLMGLYPKPFTDVM 476

Query: 477 SVPLSSIIEN 486
            V + +++ +
Sbjct: 477 HVSVENLLSH 486


>gi|167562190|ref|ZP_02355106.1| NADH dehydrogenase subunit M [Burkholderia oklahomensis EO147]
 gi|167569435|ref|ZP_02362309.1| NADH dehydrogenase subunit M [Burkholderia oklahomensis C6786]
          Length = 496

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/487 (47%), Positives = 335/487 (68%), Gaps = 5/487 (1%)

Query: 2   NLPFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS   +LP + G+ V+   S    G   +  +AL  S      ++ + + FD   +
Sbjct: 3   SFPILSTAIWLPIVFGLIVLAVGSDKNPGAARW--IALIGSLAGLAVTIPLITGFDSSTA 60

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           + Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   +++ W+ I E+  +Y+ AFL
Sbjct: 61  ALQFVEQTTWIERFNITYHLGVDGISMWFVVLTALITVIVVIAGWEVITEHVSQYLAAFL 120

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML
Sbjct: 121 ILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLML 180

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+A
Sbjct: 181 VALIYL-YTQTHSFDLATWQNAKIEMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAHVEA 239

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA IMLK+G YG +RF LP+ P AS +FAPV+  LSLIA+IY  LV+MVQ D+
Sbjct: 240 PTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFFAPVVIALSLIAVIYIGLVAMVQADM 299

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R I
Sbjct: 300 KKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHSRQI 359

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L
Sbjct: 360 ADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQFNFWIAFGAAFTLIL 419

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+LW+Y++V FG    + V +LKD+S RE  M+  +A  T+  G+YP P  D   V 
Sbjct: 420 GAAYTLWMYKRVYFGAVANDHVAKLKDISRREFVMLAVLAAFTMLMGLYPKPFTDVMHVS 479

Query: 480 LSSIIEN 486
           + +++ +
Sbjct: 480 VENLLSH 486


>gi|254247669|ref|ZP_04940990.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia cenocepacia PC184]
 gi|124872445|gb|EAY64161.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia cenocepacia PC184]
          Length = 496

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/488 (48%), Positives = 331/488 (67%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  I+ I  +  L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGTARWIALIGALLGLAVTIPLITGFDSST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEKSTWIERFDIAYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQAD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|221199668|ref|ZP_03572712.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD2M]
 gi|221205432|ref|ZP_03578447.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD2]
 gi|221174270|gb|EEE06702.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD2]
 gi|221180953|gb|EEE13356.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD2M]
          Length = 496

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/488 (48%), Positives = 331/488 (67%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  I+ I  +  L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGPARWIALIGSLLGLAVTIPLITGFDAST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEQSTWIERFKISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQAD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|107023176|ref|YP_621503.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia AU 1054]
 gi|116690258|ref|YP_835881.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia HI2424]
 gi|170733597|ref|YP_001765544.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia MC0-3]
 gi|206560691|ref|YP_002231456.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia J2315]
 gi|105893365|gb|ABF76530.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia AU 1054]
 gi|116648347|gb|ABK08988.1| NADH dehydrogenase subunit M [Burkholderia cenocepacia HI2424]
 gi|169816839|gb|ACA91422.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia cenocepacia MC0-3]
 gi|198036733|emb|CAR52633.1| NADH dehydrogenase I chain M [Burkholderia cenocepacia J2315]
          Length = 496

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/488 (47%), Positives = 331/488 (67%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  ++ I  +  L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGTARWVALIGALLGLAVTIPLITGFDSST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEKSTWIERFDIAYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQAD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIIQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|254251873|ref|ZP_04945191.1| NADH dehydrogenase subunit M [Burkholderia dolosa AUO158]
 gi|124894482|gb|EAY68362.1| NADH dehydrogenase subunit M [Burkholderia dolosa AUO158]
          Length = 496

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 333/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGAARW--VALIGSLLGLAVTIPLITGFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E+  WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEHSTWIERFDISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRVHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +L D+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLTDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|161524216|ref|YP_001579228.1| NADH dehydrogenase subunit M [Burkholderia multivorans ATCC 17616]
 gi|189351027|ref|YP_001946655.1| NADH dehydrogenase subunit M [Burkholderia multivorans ATCC 17616]
 gi|221211747|ref|ZP_03584726.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD1]
 gi|160341645|gb|ABX14731.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia multivorans ATCC 17616]
 gi|189335049|dbj|BAG44119.1| NADH dehydrogenase I chain M [Burkholderia multivorans ATCC 17616]
 gi|221169108|gb|EEE01576.1| NADH dehydrogenase I, M subunit [Burkholderia multivorans CGD1]
          Length = 496

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 236/488 (48%), Positives = 331/488 (67%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGR 59
           P LS   +LP   VF +L    L  G     G A  I+ I  +  L V     + FD   
Sbjct: 5   PILSTAIWLPI--VFGLLV---LAVGNDKNPGPARWIALIGSLLGLAVTIPLITGFDAST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AF
Sbjct: 60  AALQFVEQSTWIERFQISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ M
Sbjct: 120 LILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLM 179

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 180 LVALIYLYTETHSFDLAT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQAD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRVHSRQ 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++
Sbjct: 359 IADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    + V +LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFLMLAVLAAFTLLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|11467100|ref|NP_054401.1| NADH dehydrogenase subunit 4 [Marchantia polymorpha]
 gi|464242|sp|P26848|NU4M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
 gi|786185|gb|AAC09398.1| nad4 [Marchantia polymorpha]
          Length = 495

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 319/454 (70%), Gaps = 3/454 (0%)

Query: 35  GVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTT 93
           G+ +  S I F++SLF W  F+   + FQ +E   W+ Y   ++++G+DGIS+  V+LTT
Sbjct: 39  GITIWTSLITFLYSLFFWIRFENDTAKFQFVETIRWLPYSNINFYIGIDGISLFFVILTT 98

Query: 94  FLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIG 153
           FLTP CIL  + S++   +EYMIAF + ES +I  F SLD+L+FY+FFE+ LIPMF+IIG
Sbjct: 99  FLTPICILVGFYSVKSYKKEYMIAFFICESFLIAVFCSLDLLIFYVFFESVLIPMFIIIG 158

Query: 154 VWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMW 212
           VWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+  + +   ++F    Q  +W
Sbjct: 159 VWGSRQRKIKAAYQFFLYTLMGSLFMLLAILFIFFQTGTTD-LQILLTTEFSERRQILLW 217

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           IAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+ 
Sbjct: 218 IAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATL 277

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG++  
Sbjct: 278 YFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSLNIQGIEGSILL 337

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
           MLSHGLVSSALF CVG +YDR  TR +  YGGLV  MP ++ + + FT+ANM LPGTS F
Sbjct: 338 MLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLVSTMPIFSTIFLFFTLANMSLPGTSSF 397

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRER 452
           IGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VVFG  K   + +  DL+ RE 
Sbjct: 398 IGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVFGNFKPNFILKFSDLNRREV 457

Query: 453 CMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            +  P  V  ++ G+YP    +     +S+++++
Sbjct: 458 LIFLPFIVGVIWMGVYPEVFLECMHTSVSNLVQH 491


>gi|11466666|ref|NP_066349.1| NADH dehydrogenase subunit 4 [Malawimonas jakobiformis]
 gi|10178704|gb|AAG13716.1|AF295546_42 NADH dehydrogenase subunit 4 [Malawimonas jakobiformis]
          Length = 486

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/466 (47%), Positives = 322/466 (69%), Gaps = 7/466 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           L I    P +G+ ++LF + +   R+    + L  + I FI S+ +W +FD   S +Q +
Sbjct: 7   LLITLIFPLIGIILLLFVNDISAIRK----ITLNTTIITFILSIVLWILFDNTTSKYQFL 62

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
                I +   +Y++G+DGISI  ++LTTFL P CIL+SW SI+   REYMI FL+LE++
Sbjct: 63  LKIELIPFLNLNYYIGIDGISIFFLILTTFLVPICILASWNSIRHYVREYMILFLLLETL 122

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           ++  F  +D++LFYIFFE+ LIPMF+IIG+WG  ER I+AA++FFLYT  GS+FMLFAI+
Sbjct: 123 MMNVFCVIDIILFYIFFESVLIPMFLIIGIWGARERKIHAAFQFFLYTLLGSLFMLFAIL 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++ +   T+    +  +++F  + Q  +W+AFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 183 IIYFNTGTTDF-KVLLVTEFSRNRQLLLWLAFFISFAVKVPMVPVHIWLPEAHVEAPTAG 241

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF L LFP A+ Y+ P+++ + +IAIIY SL ++ Q D+KK+I
Sbjct: 242 SVILAGILLKLGTYGLLRFSLTLFPDANIYYIPLVYTMGVIAIIYTSLTTLRQIDLKKII 301

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM +V +G+FS     +EG++  MLSHG VSSALF C+GV+YDR HTR +  Y 
Sbjct: 302 AYSSVAHMNFVILGLFSLNIEAIEGSILLMLSHGFVSSALFLCIGVLYDRHHTRIVRYYS 361

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+   MP ++ + + FT+AN+ LP TS FIGEFL++++VFQN+ ++ +LAS G++L A Y
Sbjct: 362 GITLTMPIFSTLFLFFTLANISLPTTSSFIGEFLILLAVFQNNTSICILASTGIILGAAY 421

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           ++WLY +V FG      +    DL LRE  +  P  VL +  GIYP
Sbjct: 422 AIWLYNRVAFGNININYINPFNDLYLREFAIFIPFVVLILLMGIYP 467


>gi|254524823|ref|ZP_05136878.1| NADH-ubiquinone oxidoreductase Nqo13 subunit [Stenotrophomonas sp.
           SKA14]
 gi|219722414|gb|EED40939.1| NADH-ubiquinone oxidoreductase Nqo13 subunit [Stenotrophomonas sp.
           SKA14]
          Length = 502

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/488 (47%), Positives = 331/488 (67%), Gaps = 22/488 (4%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP LG  +IL        R +    +LG++ + F+ SL + S ++ G   
Sbjct: 3   NWPLLSVLIWLPILGGALILAIRDAQTARWA----SLGVAVLTFVASLSLLSGYNAGIDG 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ L++LTT ++   ++ +W +I +   +Y+ AFL+
Sbjct: 59  LQFVETHAWIPAYKIGYNLGVDGIAVALILLTTLVSVLALIGAWSAIDKRVNQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTVGIFSATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAALKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ +  +  +  + DLYA+   P S   Q W++ AF  +FA+K+PMFP HTWLP+AHV+
Sbjct: 179 ALIYLYLKGGSFQLADLYAL---PLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVE 235

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA I LK+GGYG +RF LP+ P ASQ +A ++  LSLIA+IY  LV++VQ D
Sbjct: 236 APTAGSVILAAIALKIGGYGFLRFNLPIVPDASQEWAWLVIALSLIAVIYVGLVALVQDD 295

Query: 299 IKKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFC 346
           +KKLIAYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C
Sbjct: 296 MKKLIAYSSIAHMGFVTLGTFIALWLVREAGNADAARLGLQGAMVQMISHGFVSGAMFSC 355

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGV+YDR+H+R I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI+S FQ +
Sbjct: 356 VGVLYDRMHSRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILSAFQRN 415

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             +A+ A+  +++ A Y+LWLY+++ FG      V +LKD++ RE  ++   A+  +  G
Sbjct: 416 PWIALGAATTLIIGAAYTLWLYKRIFFGEVANSHVAELKDINGREWLVLGVFAIGVLALG 475

Query: 467 IYPVPIRD 474
           IYP P+ D
Sbjct: 476 IYPKPLTD 483


>gi|78224533|ref|YP_386280.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter metallireducens GS-15]
 gi|78195788|gb|ABB33555.1| NADH dehydrogenase subunit M [Geobacter metallireducens GS-15]
          Length = 519

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/493 (46%), Positives = 336/493 (68%), Gaps = 10/493 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P +S++TFLP LGV ++ F        +   G+AL ++   F+ SL + + F +  + FQ
Sbjct: 5   PLISVMTFLPLLGVVLLFFVPKQSHSAQR--GLALLVALATFVVSLPLVTGF-QSNAEFQ 61

Query: 64  MIEYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            +E   WI    Y  +YH+ +DGIS+ LV+LTTF+ P  ILS+W +++   +EYMI  L+
Sbjct: 62  FVEKVPWIAAGPYQMNYHVAIDGISLWLVILTTFIVPIAILSTWTAVENKVKEYMICLLL 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  ++GAF+SLD+ LFYIF+E  LIPM+ IIG+WGG  +IYAA KFF+YT  GS+ ML 
Sbjct: 122 LEVGMLGAFVSLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIYAALKFFIYTMVGSLLMLI 181

Query: 181 AIVVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A+VV+ ++      S++  Y ++  P + Q WM++AF  +FAIK+PMFP HTWLP+AH +
Sbjct: 182 ALVVLYFKGGAGDFSVLRFYDLALDP-ATQTWMFLAFALAFAIKVPMFPLHTWLPDAHTE 240

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA ++LKMG YG +RF +PLFP A+  F P+   LS+I I+YA+LV+MVQ D
Sbjct: 241 APTAGSVILAAVLLKMGTYGFVRFAMPLFPDATAQFTPLFAVLSVIGIVYAALVAMVQED 300

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AH+GYV +G+F+  + G+ G M QML+HG+ + ALF  VG IY+R HTR 
Sbjct: 301 VKKLVAYSSVAHLGYVMLGVFALNQQGLSGGMIQMLNHGVSTGALFLIVGFIYERRHTRL 360

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVLASFGV 417
           I  +GGL   MP +A + M+ T++++GLPGT+GF+GEFL+++  +++     AV+ + GV
Sbjct: 361 ITDFGGLAKQMPVFATIFMIVTLSSIGLPGTNGFVGEFLILIGAYESELRWYAVIGTSGV 420

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LSA+Y LW++++V+FG     K Q L DL+ RE  ++ P+ VL    G+YP P  D  S
Sbjct: 421 ILSAVYMLWMFQRVMFGELNNPKNQTLTDLNAREVVIMLPLLVLIFVMGVYPTPFIDKMS 480

Query: 478 VPLSSIIENYTLK 490
             L  +I +   K
Sbjct: 481 PSLEKLIVHVKSK 493


>gi|190575266|ref|YP_001973111.1| NADH dehydrogenase subunit M [Stenotrophomonas maltophilia K279a]
 gi|190013188|emb|CAQ46821.1| putative NADH dehydrogenase I chain M [Stenotrophomonas maltophilia
           K279a]
          Length = 502

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/488 (47%), Positives = 331/488 (67%), Gaps = 22/488 (4%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +IL        R +    +LG++ + F+ SL + S ++ G   
Sbjct: 3   NWPLLSVLIWLPIIGGALILAIRDAQTARWA----SLGVAVLTFVASLSLLSGYNAGIDG 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ L++LTT ++   ++ +W +I +   +Y+ AFL+
Sbjct: 59  LQFVETHAWIPAYKIGYNLGVDGIAVALILLTTLVSVLALIGAWSAIDKRVNQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAALKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ +  +  +  + DLYA+   P S   Q W++ AF  +FA+K+PMFP HTWLP+AHV+
Sbjct: 179 ALIYLYMKGGSFQLADLYAL---PLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVE 235

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA I LK+GGYG +RF LP+ P ASQ +A ++  LSLIA+IY  LV++VQ D
Sbjct: 236 APTAGSVILAAIALKIGGYGFLRFNLPIVPDASQEWAWLVIALSLIAVIYVGLVALVQDD 295

Query: 299 IKKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFC 346
           +KKLIAYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C
Sbjct: 296 MKKLIAYSSIAHMGFVTLGTFIALWLVREAGNADAARLGLQGAMVQMISHGFVSGAMFSC 355

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGV+YDR+H+R I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI+S FQ +
Sbjct: 356 VGVLYDRMHSRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILSAFQRN 415

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             +A+ A+  +++ A Y+LWLY+++ FG      V +LKD++ RE  ++   A+  +  G
Sbjct: 416 PWIALGAATTLIIGAAYTLWLYKRIFFGEVANSHVAELKDINGREWLVLGVFAIGVLALG 475

Query: 467 IYPVPIRD 474
           IYP P+ D
Sbjct: 476 IYPKPLTD 483


>gi|229587155|ref|YP_002845656.1| NADH dehydrogenase subunit M [Rickettsia africae ESF-5]
 gi|228022205|gb|ACP53913.1| NADH dehydrogenase I chain M [Rickettsia africae ESF-5]
          Length = 493

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/492 (46%), Positives = 341/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGKNRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  ++ ++   P   Q  +W A F +FA+KIP+ PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIFIAFAVKIPIIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSIIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  K+GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLAAFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVGNLLVKF 493


>gi|157829059|ref|YP_001495301.1| NADH dehydrogenase subunit M [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933785|ref|YP_001650574.1| NADH:ubiquinone oxidoreductase subunit M [Rickettsia rickettsii
           str. Iowa]
 gi|157801540|gb|ABV76793.1| NADH dehydrogenase subunit M [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908872|gb|ABY73168.1| NADH-quinone oxidoreductase chain M [Rickettsia rickettsii str.
           Iowa]
          Length = 493

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/492 (46%), Positives = 340/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFF--GVALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYIMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGKNRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  L+ ++   P   Q  +W A F +FA+KIP+ PFHTWLP+ 
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYLFQLTDNIPLFAQQILWWAIFIAFAVKIPIIPFHTWLPDT 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVLYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  K+GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVENLLVKF 493


>gi|229315902|ref|YP_002860128.1| NADH dehydrogenase subunit 4 [Micromonas sp. RCC299]
 gi|226431187|gb|ACO55592.1| NADH dehydrogenase subunit 4 [Micromonas sp. RCC299]
          Length = 488

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/458 (49%), Positives = 322/458 (70%), Gaps = 3/458 (0%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLV 89
           R+   +AL IS INF+ +  +W VFD   + FQ +E+  W+ +F  + ++G+DGIS+  +
Sbjct: 27  RAIKIIALCISLINFVVASGLWIVFDNSTAKFQFVEHIGWLPFFNMNAYIGIDGISLFFI 86

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           VLTTFL P C+L  W +I ++ +EY +AFL+LE+ ++  F  LD+LLFY+FFE+ L+PMF
Sbjct: 87  VLTTFLVPVCLLVGWVNISKHVKEYCLAFLILETCMLAVFCMLDLLLFYVFFESVLLPMF 146

Query: 150 VIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           +IIGVWG   R I AAY+FFLYT  GS+ ML AI+++ ++  T+  + +  +S+F    Q
Sbjct: 147 LIIGVWGSRARKIRAAYQFFLYTLVGSVLMLLAILLIYFQVGTTD-LQVLLVSEFSERRQ 205

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
             +W+AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +PLFP
Sbjct: 206 LLLWLAFFASFAVKVPMVPLHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPLFP 265

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
            AS YF P+I+ +S+I I+YASL ++ Q D+KK+IAYSS+AHMG+VTIG+FS    GVEG
Sbjct: 266 EASLYFTPLIYTMSIIGIVYASLTTLRQIDLKKIIAYSSVAHMGFVTIGLFSLNVQGVEG 325

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           A+  MLSHG V+SALF CVG +YDR HTR I  YGGLVH MP ++   +VFTM N+ LPG
Sbjct: 326 AILLMLSHGFVASALFLCVGTLYDRTHTRLIQYYGGLVHIMPLFSFFFLVFTMGNLSLPG 385

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS F+GEFL+++  FQ +  +A LA+ G++L   YS+WLY +VVFG  K   +    D++
Sbjct: 386 TSSFVGEFLILVGTFQTNTWIATLAATGMILGGAYSIWLYNRVVFGNLKPLYISMGSDVN 445

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            RE  +  P  +  ++ G YP    D   V +S++I++
Sbjct: 446 RREFWIFVPFVLAILWMGFYPQVFLDPMHVSVSNVIQH 483


>gi|34581180|ref|ZP_00142660.1| NADH dehydrogenase I chain M [Rickettsia sibirica 246]
 gi|28262565|gb|EAA26069.1| NADH dehydrogenase I chain M [Rickettsia sibirica 246]
          Length = 493

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/492 (46%), Positives = 341/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFF--GVALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYLMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTIICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGKNRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  ++ ++   P   Q  +W A F +FAIKIP+ PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIFIAFAIKIPIIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAY+SIAHMGYVTIGIFS  K+GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYASIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLAAFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVGNLLVKF 493


>gi|238650813|ref|YP_002916668.1| NADH dehydrogenase subunit M [Rickettsia peacockii str. Rustic]
 gi|238624911|gb|ACR47617.1| NADH dehydrogenase subunit M [Rickettsia peacockii str. Rustic]
          Length = 493

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/492 (46%), Positives = 341/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES+ IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESLCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGKNRIYAALKFFLYTFFGSL 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  ++ ++   P   Q  +W A F +FA+KIP+ PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKMHSFDLTYIFQLTDNIPLFAQQILWWAIFIAFAVKIPIIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LA I+LK+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILASILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  K+GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLAAFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVVATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++  A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIFGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS+ + +++  +
Sbjct: 482 FSLSVENLLVKF 493


>gi|51473961|ref|YP_067718.1| NADH dehydrogenase subunit M [Rickettsia typhi str. Wilmington]
 gi|81389939|sp|Q68VV6|NUOM_RICTY RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|51460273|gb|AAU04236.1| NADH dehydrogenase (ubiquinone) subunit M [Rickettsia typhi str.
           Wilmington]
          Length = 494

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/496 (46%), Positives = 340/496 (68%), Gaps = 10/496 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILF--SSYLGCGRRSFF--GVALGISTINFIFSLFVWSVFD 56
           + LP +SI  FLP + V  IL   +      + + +   VA+  S + FI ++++   FD
Sbjct: 2   LELPIISITIFLPLISVLYILLFINQSKKANKLNIYVAMVAMLSSVLTFILTIYILIEFD 61

Query: 57  KGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYM 115
               ++Q +E Y W+D     +H+G+DGI+I  VVLT+FLT  CI+ S  +I++  +EY+
Sbjct: 62  ASNHTYQFVERYTWLDKIGLEFHVGIDGIAIFFVVLTSFLTLICIIGSIFTIKKYIKEYL 121

Query: 116 IAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGS 175
           + FL++ES  IGAF ++++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS
Sbjct: 122 VCFLLMESFCIGAFTAVNLLLFYLFFEAILVPMYIIIGVWGGDNRIYAALKFFLYTFFGS 181

Query: 176 IFMLFAIVVMCWEKKTSSIIDLYAMSK-FPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPN 234
           +F L A++ +  +  +  +  + A+++  P   Q  +W   F +FA+KIPM PFHTWLP+
Sbjct: 182 VFFLLALIYIYSKIHSFDLTYILALTENIPLFAQKILWWTIFIAFAVKIPMIPFHTWLPD 241

Query: 235 AHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSM 294
           AHVQAPT+GSV LAGI+LK+G YG +R LLPL P  SQ FA  + +LS+IAIIY+SLV++
Sbjct: 242 AHVQAPTSGSVILAGILLKLGSYGFLRVLLPLLPNVSQEFAIYVIYLSVIAIIYSSLVAL 301

Query: 295 VQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRL 354
            Q DIK++IAYSSIAHMGYVTIGIFS  ++G+ GA+FQMLSHG+VSS+LF  VG +Y+RL
Sbjct: 302 AQKDIKQMIAYSSIAHMGYVTIGIFSFTETGISGAIFQMLSHGVVSSSLFLIVGTLYERL 361

Query: 355 HTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLAS 414
           HT++I  YGG+   MP  A   M+  ++++GLP TSGFIGEFL ++ +++ +   A +A+
Sbjct: 362 HTKEIAKYGGVASKMPVLATFFMITMLSSIGLPSTSGFIGEFLSLLGIYKVNVVAACIAA 421

Query: 415 FGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
            G++L A+Y L LY++V+ G     +++  KDL   E   + P+ ++ ++FG+ P  I +
Sbjct: 422 LGIILGAVYMLKLYKEVMLGEITNTEIKHFKDLYRYEILSIAPLILIIIYFGLMPNSILN 481

Query: 475 TFSVPLSSIIENYTLK 490
            F +     +EN  +K
Sbjct: 482 VFHLS----VENLLIK 493


>gi|288942122|ref|YP_003444362.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Allochromatium vinosum DSM 180]
 gi|288897494|gb|ADC63330.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Allochromatium vinosum DSM 180]
          Length = 524

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 342/501 (68%), Gaps = 19/501 (3%)

Query: 1   MN-LPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG-VALGISTINFIFSLFVWSVFDKG 58
           MN LP L++  +LP +G  V+L S   G   ++     AL  + + F+ SL +W  FD  
Sbjct: 1   MNALPLLTLTIWLPIIGGLVVLAS---GDQEKTLSKWTALAFAVLTFMVSLGLWIGFDST 57

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            +  Q +E   WI  F   Y LGVDG+S+ L+VLTTF++ F I++ W  I+    +YM A
Sbjct: 58  TAEMQFVERAPWIPTFNVEYFLGVDGLSMPLIVLTTFISIFVIIAGWDVIRYKPSQYMAA 117

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL++E +++G F +LD +LFY+F+EA LIPMF+IIGVWGG  R+YA  KFF+YTF GS+F
Sbjct: 118 FLIMEGIMVGVFSALDAVLFYVFWEAMLIPMFIIIGVWGGPNRVYATIKFFIYTFLGSVF 177

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A++ M ++  + SI+D +A+ +   + Q  ++IAFF +FA+K+PMFP HTWLP+AHV
Sbjct: 178 MLVALIYMYFQSGSFSILDFHAL-ELGMTAQTLIFIAFFLAFAVKVPMFPVHTWLPDAHV 236

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA IMLK+GGYG +RF LP+ P AS   A VI  LSLIAI+Y   V++VQ 
Sbjct: 237 EAPTGGSVILAAIMLKIGGYGFLRFSLPITPDASADLAWVIIALSLIAIVYIGFVALVQQ 296

Query: 298 DIKKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFF 345
           D+KKLIAYSSIAHMG+VT+G F             G   G+EG M QM+SHG +S ALF 
Sbjct: 297 DMKKLIAYSSIAHMGFVTLGFFIVFSLALNPSVTGGAVMGIEGGMVQMISHGFISGALFL 356

Query: 346 CVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQN 405
           CVGV+YDR+H+R+I  YGG+++ MP +   M+ F MAN GLPGTSGF+GEF+VI++ F+ 
Sbjct: 357 CVGVLYDRVHSREIADYGGVINTMPWFGAFMVYFAMANAGLPGTSGFVGEFMVILATFKA 416

Query: 406 SNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFF 465
           S   A+LA+  ++L+A ++LW+ ++VVFG  K EKV  L DL LRER  +  +A + + F
Sbjct: 417 SFWWALLAATTLILAAAFTLWMVKRVVFGEVKNEKVAALADLDLRERINLGVLAAVVLLF 476

Query: 466 GIYPVPIRDTFSVPLSSIIEN 486
           G++P P+ +   V + +++E 
Sbjct: 477 GLWPAPLVNVMHVTIENLVEQ 497


>gi|197120275|ref|YP_002140702.1| NADH dehydrogenase I subunit M [Geobacter bemidjiensis Bem]
 gi|197089635|gb|ACH40906.1| NADH dehydrogenase I, M subunit [Geobacter bemidjiensis Bem]
          Length = 535

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 236/498 (47%), Positives = 342/498 (68%), Gaps = 12/498 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            LP LSI+TF P +G  ++LF +    G      VA+ ++ + F+ SL + + ++   + 
Sbjct: 3   QLPLLSILTFTPLIGAILLLFVNKNSHG--VLRTVAMAVTVVTFVLSLPLITGYNAPGTD 60

Query: 62  ---FQMIEYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYM 115
              FQ IE   WI    +  SYHLG+DGIS+ LV+LTTF+ P  ILS++ +++E  +EYM
Sbjct: 61  IGGFQFIENVPWIAAGPFQMSYHLGIDGISLWLVILTTFIMPISILSTYTAVEEKVKEYM 120

Query: 116 IAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGS 175
           I  L+LE  +IG F+SLD+ LFYI++E  LIPM+ +IG+WGG  RIYAA KFF+YT  GS
Sbjct: 121 ICLLLLEVGMIGTFISLDLFLFYIYWEVMLIPMYFMIGIWGGKNRIYAAVKFFIYTAVGS 180

Query: 176 IFMLFAIVVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLP 233
           + ML A++ + ++      SII  + ++  P + Q WM++AF  +FAIK+PMFP HTWLP
Sbjct: 181 LLMLVALISLYFKAGGGDFSIIRFWELNLDP-TTQMWMFLAFALAFAIKVPMFPLHTWLP 239

Query: 234 NAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVS 293
           +AH +APTAGSV LA +MLK G YG +RF +PLFP AS  F P+I  LS+I IIYASLV+
Sbjct: 240 DAHTEAPTAGSVILAAVMLKCGTYGYVRFAMPLFPEASAQFTPLIATLSVIGIIYASLVA 299

Query: 294 MVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDR 353
           MVQ D+KKL+AYSS+AH+G+V +G+++    GV G M QML+HG+ + ALF  VG IY+R
Sbjct: 300 MVQQDVKKLVAYSSVAHLGFVMLGLYALNTQGVTGGMLQMLNHGVSTGALFLIVGFIYER 359

Query: 354 LHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVL 412
            HTR I  +GGL   MP +A + M+ T +++GLPGT+GF+GEFLV++  F++S    A++
Sbjct: 360 RHTRQISDFGGLAKQMPVFATMFMIVTFSSIGLPGTNGFVGEFLVLLGSFESSLRWYAII 419

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ GV+LSA+Y LW++++V+FG  K  K Q LKDL+ RE  ++ P+  L  F G+YP PI
Sbjct: 420 ATSGVILSAVYMLWMFQRVMFGELKNPKNQTLKDLNAREVAIMLPLLFLIFFLGVYPRPI 479

Query: 473 RDTFSVPLSSIIENYTLK 490
            D+ +  +  +I +  ++
Sbjct: 480 IDSMAPSIDKLIAHTKVQ 497


>gi|328953781|ref|YP_004371115.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454105|gb|AEB09934.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Desulfobacca acetoxidans DSM 11109]
          Length = 512

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/484 (46%), Positives = 338/484 (69%), Gaps = 15/484 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFF---GVALGISTINFIFSLFVWSVFDK 57
           MN P LSI+  LP +GV +I+        R + +   G A+  + + FI SL +W  FD 
Sbjct: 1   MNFPILSILILLPMVGVALIMM-----LNRENQWLIKGTAMAFALLEFIISLPLWFGFDG 55

Query: 58  GRSSFQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
           G ++ Q +E Y W   Y  SY++G+DGIS+LLV+LTTF+TP C+L+ W+ IQ   +E+MI
Sbjct: 56  GSAAMQFVERYSWFPAYGISYYIGIDGISLLLVLLTTFITPICVLACWEDIQSKVKEFMI 115

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGG-SERIYAAYKFFLYTFFGS 175
             L L++ +IG F+SLD+ LFYIF+E  LIPM+++IGVWG  + RIYAA KFF++T  GS
Sbjct: 116 CLLFLQTGMIGVFVSLDLFLFYIFWEIMLIPMYLLIGVWGNPARRIYAAVKFFIFTMVGS 175

Query: 176 IFMLFAIVVMC-WEKKTSSI--IDLYAMS--KFPFSIQYWMWIAFFCSFAIKIPMFPFHT 230
           + ML AI+V+  +  K + +   DL  M   + PF +Q+WM++AF  +FAIK+PMFP HT
Sbjct: 176 LLMLVAILVLYFYNYKVTGVYTFDLLKMYGLQIPFMMQFWMFLAFGLAFAIKVPMFPVHT 235

Query: 231 WLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYAS 290
           WLP+AH +APT GSV LA ++LKMG YG +RF +P+FP A+ YF P+   L++I I+Y +
Sbjct: 236 WLPDAHTEAPTVGSVILAAVLLKMGTYGFLRFNMPMFPDAAWYFVPLFSILAVIGIVYGA 295

Query: 291 LVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVI 350
           LVS+VQ D+K+L+A+SS++H+G+V +G+F+   +GV+G + QM++HGL + ALF  VG++
Sbjct: 296 LVSLVQVDLKRLVAFSSVSHLGFVMLGLFTYTMAGVQGGIIQMINHGLSTGALFLIVGMV 355

Query: 351 YDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVA 410
           Y+R HTR I  +GGL   MP YA + MV T++++GLPG +GF+GE+L+++  F+ +   A
Sbjct: 356 YERRHTRMIADFGGLSKVMPVYATIFMVVTLSSIGLPGLNGFVGEYLILLGAFKTNKVFA 415

Query: 411 VLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPV 470
           + A+ GV+ +A Y LW++++V+FG    EK + LKDLS+RE  ++ PI V  V+ G+YP 
Sbjct: 416 IFAASGVIFAAAYMLWMFQRVMFGTITNEKNRNLKDLSMREVVVLLPILVFIVWIGVYPN 475

Query: 471 PIRD 474
              D
Sbjct: 476 TFLD 479


>gi|167585985|ref|ZP_02378373.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia ubonensis Bu]
          Length = 496

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 332/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  VAL  S +    ++ + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGPARW--VALIGSLLGLAVTVPLITDFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F  +YHLGVDGIS+  VVLT  +T   +++ W+ I E+  +Y+ AFL+L
Sbjct: 63  QFVEQSTWIERFNITYHLGVDGISMWFVVLTALITVIVVIAGWEVITEHVSQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  E  +  +   +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYLYTETHSFDLTT-WQNAKIAMTPQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +L D++ RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLTDINRREFVMLAVLAAFTMLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|330817780|ref|YP_004361485.1| NADH dehydrogenase subunit M [Burkholderia gladioli BSR3]
 gi|327370173|gb|AEA61529.1| NADH dehydrogenase subunit M [Burkholderia gladioli BSR3]
          Length = 497

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/488 (48%), Positives = 331/488 (67%), Gaps = 11/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRSS 61
           P LS   +LP +   +IL    +G  R+      VAL  S + F  ++ + + FD   ++
Sbjct: 5   PILSTAIWLPIVFGLLIL---AVGTDRKPGVARWVALIGSLLGFAVTIPLITGFDPSTAA 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   WID F  SYHLGVDGIS+  VVLT  +T   +++ W+ I EN  +Y+ +FL+
Sbjct: 62  LQFEENAIWIDRFNVSYHLGVDGISMWFVVLTALITVIVVVAGWEVITENVSQYLASFLM 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML 
Sbjct: 122 LSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLI 181

Query: 181 AIVVMCWEKKTSSIIDLYAM--SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ +  E  T    DL A   +K   + Q  ++ AFF +FA+K+PM+P HTWLP+AHV+
Sbjct: 182 ALIYLYRETHT---FDLAAWQGAKLAMTPQLLLFGAFFLAFAVKVPMWPVHTWLPDAHVE 238

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P A+ Y APV+  LSLIA+IY  LV+MVQTD
Sbjct: 239 APTGGSVVLAAIMLKLGAYGFLRFSLPVTPDAAHYLAPVVIVLSLIAVIYIGLVAMVQTD 298

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F   + G+EGA+ QM+SHG VS A+F C+GV+YDRLHTR+
Sbjct: 299 MKKLVAYSSIAHMGFVTLGFFIFSQLGIEGAIVQMISHGFVSGAMFLCIGVLYDRLHTRN 358

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MP++A   ++F MAN GLPGTSGF+GEF+VI++  + +  +A  A   ++
Sbjct: 359 IAEYGGVVNVMPKFATFALLFAMANCGLPGTSGFVGEFMVILASVKFNFWIAFGAGLTLI 418

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A Y+LW+Y++V FG    EKV  LKD+  RE  M+  +A  T+  G+YP P  D   V
Sbjct: 419 LGAGYTLWMYKRVYFGKVVNEKVTTLKDIGAREFSMLAVLAAFTLLMGLYPKPFTDVMHV 478

Query: 479 PLSSIIEN 486
            + +++ +
Sbjct: 479 SVENLLSH 486


>gi|262186696|ref|YP_003275955.1| NADH dehydrogenase subunit 4 [Pleurozia purpurea]
 gi|237780693|gb|ACR19339.1| NADH dehydrogenase subunit 4 [Pleurozia purpurea]
          Length = 495

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/454 (50%), Positives = 316/454 (69%), Gaps = 3/454 (0%)

Query: 35  GVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTT 93
           G+ +  S I F++SLF W  F+   + FQ +E   W+ Y   ++++G+DGIS+  V+LTT
Sbjct: 39  GITIWTSLITFLYSLFFWIRFENDTAKFQFVETIRWLPYPNINFYIGIDGISLFFVILTT 98

Query: 94  FLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIG 153
           FLTP CIL  + S++   +EYMIAF V ES  I  F SLD+L+FY+F E+ LIPMF+IIG
Sbjct: 99  FLTPICILVGFYSVKSYKKEYMIAFFVCESFPIAVFCSLDLLIFYVFLESVLIPMFIIIG 158

Query: 154 VWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMW 212
           VWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+  + +   ++F    Q  +W
Sbjct: 159 VWGSRQRKIKAAYQFFLYTLMGSLFMLLAILFIFFQTGTTD-LQILLTTEFSERRQILLW 217

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           IAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+ 
Sbjct: 218 IAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATL 277

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG++  
Sbjct: 278 YFTPFIYVLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSLNIQGIEGSILL 337

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
           MLSHGLVSSALF CVG +YDR  TR +  YGGLV  MP ++ + + FT+ANM LPGTS F
Sbjct: 338 MLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLVSTMPIFSTIFLFFTLANMSLPGTSSF 397

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRER 452
           IGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VVFG  K   + +  DL+ RE 
Sbjct: 398 IGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVFGNFKPNFILKFSDLNRREV 457

Query: 453 CMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            +  P     ++ G+YP    +     +S+++++
Sbjct: 458 LIFLPFIAGVIWMGVYPEVFLECMHTSVSNLVQH 491


>gi|239946835|ref|ZP_04698588.1| NADH-quinone oxidoreductase subunit M [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921111|gb|EER21135.1| NADH-quinone oxidoreductase subunit M [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 493

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/495 (46%), Positives = 340/495 (68%), Gaps = 11/495 (2%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKPIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  V LT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVALTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIG+WGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGIWGGENRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTWL 232
           F L +++ +     +    DL  +S+  ++I    Q  +W A F +FA+KIPM PFHTWL
Sbjct: 182 FFLLSLIYIYSNIHS---FDLTYISELTYNIPLFAQQILWWAIFIAFAVKIPMIPFHTWL 238

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHVQAPT+GSV LAGI+LK+GGYG +R LLPLFP  SQ FA  + +LS+I IIYASLV
Sbjct: 239 PDAHVQAPTSGSVILAGILLKLGGYGFLRVLLPLFPSVSQEFAIYVIYLSVIIIIYASLV 298

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           +  Q D+KK+IAYSSIAHMGYVTIGIFS  ++GV GA+FQMLSHG++SS LF  VG +Y+
Sbjct: 299 AFAQKDMKKMIAYSSIAHMGYVTIGIFSFTEAGVSGAIFQMLSHGVISSCLFLIVGTLYE 358

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           RLHT++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +
Sbjct: 359 RLHTKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVIATFI 418

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+ G++L A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I
Sbjct: 419 AALGIILGAVYMLKLYKEVMLGEIINKEIMHFRDLYKYEIISITPLILLIIYFGLMPSSI 478

Query: 473 RDTFSVPLSSIIENY 487
            + F + + +++  +
Sbjct: 479 LNVFRLSVENLLVKF 493


>gi|67459650|ref|YP_247274.1| NADH dehydrogenase subunit M [Rickettsia felis URRWXCal2]
 gi|75535954|sp|Q4UK26|NUOM_RICFE RecName: Full=NADH-quinone oxidoreductase subunit M; AltName:
           Full=NADH dehydrogenase I subunit M; AltName: Full=NDH-1
           subunit M
 gi|67005183|gb|AAY62109.1| NADH dehydrogenase I chain M [Rickettsia felis URRWXCal2]
          Length = 493

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/492 (46%), Positives = 338/492 (68%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      ++ +   VA+  S + FI ++++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKADKAIYVMYVAVLSSVLTFISTIYILIEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q IE Y W+D     +H+GVDGISI  V LT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFIERYAWLDKIGLEFHVGVDGISIFFVALTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGENRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +     +  +  ++   P   Q  +W A F +FA+KIP+ PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKIHNFDLTYIPELTGNIPLFTQQILWWAIFIAFAVKIPIIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK GGYG +R LLPLF   SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKFGGYGFLRVLLPLFSSVSQEFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS  ++GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTEAGVSGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   MP  A   M+  + ++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVIATFIAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L A+Y L LY++V+ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIILGAVYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           F + + S++  +
Sbjct: 482 FRLSVESLLVKF 493


>gi|289207905|ref|YP_003459971.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thioalkalivibrio sp. K90mix]
 gi|288943536|gb|ADC71235.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thioalkalivibrio sp. K90mix]
          Length = 504

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/498 (45%), Positives = 337/498 (67%), Gaps = 16/498 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           + P LS++ +LP LG F++L +           G+A+ ++T  F+ SL +W  F++G + 
Sbjct: 4   DWPILSLLIWLPILGGFLVLAAGRDAPHVARRLGLAVAVAT--FVASLPLWFAFERGTAE 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   WI  F  +YHLGVDGIS+ L++LTT +T   I+++W+S+++    YM A LV
Sbjct: 62  MQFQELASWIPAFNVNYHLGVDGISMPLILLTTLITVIVIIAAWESVKDRIAYYMSAMLV 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++IG F ++D +LFY+FFEA LIPMF++IG+WGG  R+YA  KFFLYTF GS+FML 
Sbjct: 122 MEGLMIGMFAAMDAVLFYVFFEAMLIPMFLVIGIWGGPRRVYATIKFFLYTFLGSVFMLV 181

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ M  +  +  I D +A+ +   + Q  +++AFF +FA+KIPMFP HTWLP+AHV+AP
Sbjct: 182 ALIWMYIQSGSFLIQDFHAL-QIGMTAQILIFLAFFMAFAVKIPMFPVHTWLPDAHVEAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLK+GGYG +RF LP+ P AS     ++  LSLIAI+Y  LV+++Q+D+K
Sbjct: 241 TGGSVILAAIMLKIGGYGFLRFSLPITPDASAVLDTLMIVLSLIAIVYIGLVALIQSDMK 300

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+G F             G   G+ G M QM+SHG +S+A+F  VG
Sbjct: 301 KLIAYSSIAHMGFVTLGFFLAFYIYRNTGDWEGASLGIAGGMVQMISHGFISAAMFLAVG 360

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRLH+R I  YGG+V+ MP +A   ++F MAN GLPGTSGF+GEF+VI++ F+    
Sbjct: 361 VLYDRLHSRQISDYGGVVNTMPWFAAFFVLFAMANTGLPGTSGFVGEFMVILAAFKADFW 420

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           +A LA+  ++L+A Y+LWL ++V+FG    + V  L D++ RE  ++  +A  T+  G++
Sbjct: 421 IAFLAATTLILAAGYTLWLVKRVIFGAVANDNVAGLSDMNRREFFLMGVLAFFTLLLGVW 480

Query: 469 PVPIRDTFSVPLSSIIEN 486
           P P+ D  +  +  ++ +
Sbjct: 481 PAPLLDVMNATIDHLVAH 498


>gi|21243420|ref|NP_643002.1| NADH dehydrogenase subunit M [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108972|gb|AAM37538.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 500

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 323/486 (66%), Gaps = 19/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LSI+ +LP +G  +IL        R +    +L ++   F  SL +   +D    +
Sbjct: 3   NWPLLSILIWLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDA 57

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q IE + WI  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+
Sbjct: 58  MQFIELHAWIPAYNIGYNLGVDGIAVALIVLTTLVTVLALMGAWRSIDKRVNQYVAAFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 118 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            +V +  +  +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 178 GLVYLYLKGGSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+K
Sbjct: 237 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWLVITLSLIAVIYVGLVALVQDDMK 296

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KL+AYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C+G
Sbjct: 297 KLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIG 356

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 357 VLYDRMHTRRIADYGGVVNVMPWFATFSMLFFMANAGLPGTSGFVGEFMVILASFQKHPL 416

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A+  +V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+Y
Sbjct: 417 VAFAAATTLVITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLY 476

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 477 PKPLTD 482


>gi|58582846|ref|YP_201862.1| NADH dehydrogenase subunit M [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624712|ref|YP_452084.1| NADH dehydrogenase subunit M [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58427440|gb|AAW76477.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84368652|dbj|BAE69810.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
          Length = 500

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 322/486 (66%), Gaps = 19/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LSI+ +LP +G  +IL        R +    +L ++   F  SL +   +D    +
Sbjct: 3   NWPLLSILIWLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDA 57

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q IE + WI  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+
Sbjct: 58  MQFIELHAWIPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 118 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            +V +  +  +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 178 GLVYLYLKGGSFQLADLYAL-QLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+K
Sbjct: 237 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWLVIALSLIAVIYVGLVALVQDDMK 296

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KL+AYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C+G
Sbjct: 297 KLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIG 356

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 357 VLYDRMHTRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILASFQKHPL 416

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+Y
Sbjct: 417 VAFAAGTTLVITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLAMGLY 476

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 477 PKPLTD 482


>gi|134296421|ref|YP_001120156.1| NADH dehydrogenase subunit M [Burkholderia vietnamiensis G4]
 gi|134139578|gb|ABO55321.1| NADH dehydrogenase subunit M [Burkholderia vietnamiensis G4]
          Length = 496

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/485 (47%), Positives = 331/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   +LP + G+ V+   +    G   +  +AL  S +    +L + + FD   ++ 
Sbjct: 5   PILSTAIWLPIVFGLLVLAVGNDKNPGAARW--LALIGSLLGLAVTLPLITGFDSSTAAL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+L
Sbjct: 63  QFVEQSTWIERFNISYHLGVDGISMWFVVLTALITVIVVIAAWEVITENVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  +  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YTQTHSFDLATWQNAKIAMTPQIMLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDRLH+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRLHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A   M+F+MAN GLPGTSGF+GEF+VI++  Q +  +   A+F ++L A
Sbjct: 362 YGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIGFGAAFTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V +L D+  RE  M+  +A  T+  G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVAKLTDIGRREFVMLAVLAAFTLLMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|209518503|ref|ZP_03267324.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. H160]
 gi|209501048|gb|EEA01083.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. H160]
          Length = 496

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 333/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP + G+ V+   +        +  ++L  S ++F+ +L + + FD   +  
Sbjct: 5   PILSIAIWLPIVFGLLVLAIGNDENPAPARW--ISLIGSVLSFLVTLPLITSFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E   WID F  +YHLGVDGIS+  VVLT  +T   ++++W+ I +N  +Y+ AFL+L
Sbjct: 63  QFEEQASWIDRFHITYHLGVDGISMWFVVLTALITVIVVIAAWEVITKNVGQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D LLFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGVMVGVFSAADGLLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  E  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYLYNETGTFDLAT-WQHAQIAMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY   V+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGFVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + G EGA+ QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGAEGAIVQMISHGFVSGAMFLCIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFAMANCGLPGTSGFVGEFMVILASVQYNFWIASGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D+  RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVKSLLDIDRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|194366592|ref|YP_002029202.1| NADH dehydrogenase subunit M [Stenotrophomonas maltophilia R551-3]
 gi|194349396|gb|ACF52519.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Stenotrophomonas maltophilia R551-3]
          Length = 502

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/488 (47%), Positives = 330/488 (67%), Gaps = 22/488 (4%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +IL        R +    +LG++ + F+ SL + S ++ G   
Sbjct: 3   NWPLLSVLIWLPIIGGALILAIRDAQTARWA----SLGVAVLTFVASLSLLSGYNAGVDG 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ L++LTT ++   ++ +W +I +   +Y+ AFL+
Sbjct: 59  MQFVETHAWIPAYKIGYNLGVDGIAVALILLTTLVSVLALIGAWSAIDKRVNQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAALKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ +  +  +  + DLYA+   P S   Q W++ AF  +FA+K+PMFP HTWLP+AHV+
Sbjct: 179 ALIYLYMKGGSFQLADLYAL---PLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVE 235

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA I LK+GGYG +RF LP+ P ASQ +A ++  LSLIA+IY  LV++VQ D
Sbjct: 236 APTAGSVILAAIALKIGGYGFLRFNLPIVPDASQEWAWLVIALSLIAVIYVGLVALVQDD 295

Query: 299 IKKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFC 346
           +KKLIAYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F  
Sbjct: 296 MKKLIAYSSIAHMGFVTLGTFIALWLVREAGNADAARLGLQGAMVQMISHGFVSGAMFSS 355

Query: 347 VGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           VGV+YDR+H+R I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ +
Sbjct: 356 VGVLYDRMHSRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILAAFQRN 415

Query: 407 NTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFG 466
             +A+ A+  +++ A Y+LWLY+++ FG      V +LKD++ RE  ++   A+  +  G
Sbjct: 416 PWIALGAATTLIIGAAYTLWLYKRIFFGEVANSHVAELKDINGREWLVLGVFAIGVLALG 475

Query: 467 IYPVPIRD 474
           IYP P+ D
Sbjct: 476 IYPKPLTD 483


>gi|314908396|gb|ADT62145.1| NADH dehydrogenase subunit 4 [Isoetes engelmannii]
          Length = 495

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/458 (50%), Positives = 314/458 (68%), Gaps = 3/458 (0%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLV 89
           R    + L  S I F++SLF W  FD   + FQ +E   W+ D   ++ +G+DGIS+  V
Sbjct: 35  RLIRSIGLCTSLITFLYSLFFWVRFDNSTAKFQFVETIRWLPDSNINFSIGIDGISLFFV 94

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
           VLTTFL P CIL  W SI+   +EYMIAFL+ ES++I  F  LD+LLFY+FFE+ LIPMF
Sbjct: 95  VLTTFLIPICILVGWSSIESYEKEYMIAFLICESIMIAVFCMLDLLLFYVFFESVLIPMF 154

Query: 150 VIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQ 208
           +IIG+WG  +R I AAY+FFLYT  GS+FML AI+++     T+ +  +   + F    Q
Sbjct: 155 IIIGIWGSRQRKIKAAYQFFLYTLLGSVFMLLAILLIFSGTGTTDV-QILLTTGFSERRQ 213

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
             +WIAFF  F++K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+ P
Sbjct: 214 ILLWIAFFAFFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFNIPMCP 273

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
           +A+ YF P+I+ LS+IAIIY SL ++ Q D+KK IAYSS+AHM + TIG+FS    G+EG
Sbjct: 274 VATLYFTPLIYTLSVIAIIYTSLTTIRQIDLKKNIAYSSVAHMNFGTIGMFSLNVQGIEG 333

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           ++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV  MP ++ + + F +ANM LPG
Sbjct: 334 SILLMLSHGLVSSALFLCVGALYDRHRTRLVKYYGGLVSTMPIFSTIFLFFILANMSLPG 393

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS FIGEFLV++  F+ ++ VAVLA+ G++L A YSLWLY +VVFG  K   +Q+  DL+
Sbjct: 394 TSSFIGEFLVLVGAFERNSLVAVLAALGMILGAAYSLWLYNRVVFGNFKPNSLQKFSDLN 453

Query: 449 LRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            RE  +  P  V  ++ G+YP    +     + +++++
Sbjct: 454 RREVLIFLPFIVGVIWMGVYPEVFLECMHTSVGNLVQH 491


>gi|21231948|ref|NP_637865.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767925|ref|YP_242687.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991041|ref|YP_001903051.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113678|gb|AAM41789.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573257|gb|AAY48667.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167732801|emb|CAP50995.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas
           campestris pv. campestris]
          Length = 500

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/486 (47%), Positives = 324/486 (66%), Gaps = 19/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +IL        R +    +L ++   F+ SL +   +D    +
Sbjct: 3   NWPLLSLLIWLPIIGGALILALRNAETARWA----SLAVAVATFVLSLPLLG-YDTANDA 57

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q IE + WI  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+
Sbjct: 58  MQFIEQHAWIPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 118 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 178 GLIYLYLKGGSFQLADLYAL-QLTAKEQTWIFFAFMIAFAVKVPMFPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  +A ++  LSLIA+IY  LV++VQ D+K
Sbjct: 237 TAGSVILAAIALKIGGYGFLRFNLPILPDASNQWAWLVIALSLIAVIYVGLVALVQDDMK 296

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KL+AYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C+G
Sbjct: 297 KLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIG 356

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 357 VLYDRMHTRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILASFQKHPL 416

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A+  +V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+Y
Sbjct: 417 VAFAAATTLVITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLY 476

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 477 PKPLTD 482


>gi|295676049|ref|YP_003604573.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. CCGE1002]
 gi|295435892|gb|ADG15062.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. CCGE1002]
          Length = 496

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 333/485 (68%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP F G+ V+   +        +  ++L  S ++F+ +L + + FD   +  
Sbjct: 5   PILSIAIWLPIFFGLLVLAIGNDENPAPARW--ISLIGSVLSFLVTLPLITSFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI  F   YHLGVDGIS+  V LT  +T   +++ W+ I +N  +Y+ AFL+L
Sbjct: 63  QFVEQANWIQRFHIMYHLGVDGISMWFVSLTALITVIVVIAGWEVITKNVGQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLAGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + + +  S  I  +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LIYL-YNETGSFDIATWQHAQIAMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APVI  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVIITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + G EGA+ QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGAEGAIVQMISHGFVSGAMFLCIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFAMANCGLPGTSGFVGEFMVILASVQYNFWIASGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D+  RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVKSLVDIDRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVD 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|294788055|ref|ZP_06753299.1| NADH dehydrogenase (ubiquinone), M subunit [Simonsiella muelleri
           ATCC 29453]
 gi|294484348|gb|EFG32031.1| NADH dehydrogenase (ubiquinone), M subunit [Simonsiella muelleri
           ATCC 29453]
          Length = 505

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/480 (46%), Positives = 328/480 (68%), Gaps = 18/480 (3%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSF 62
            LS+  +LP L   ++L +   G   R+     L +  +   F+ +L +++ FD+    +
Sbjct: 6   LLSLAIWLPILSGVLVLAT---GSDSRAPLARILALIGAAAGFLVTLPLFTQFDRSNGGY 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E + WI     +Y LGVDGIS+L ++L  F+T   +LS+W+ IQ    +YM AFL++
Sbjct: 63  QFTELHSWIPTLNLNYALGVDGISVLFIILNAFITLMVVLSAWEVIQNRPAQYMAAFLIM 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++ GAF + D +LFY+FFE  LIP+++IIG+WGG  R+YAA K FLYT  GS+ ML A
Sbjct: 123 SGLINGAFAAQDAILFYVFFEGMLIPLYLIIGMWGGPRRVYAAMKLFLYTLLGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + ++  +  I DL A+ + P  +Q  ++IAFF SFA+K+PMFP HTWLP+AHV+APT
Sbjct: 183 LIYLGYQANSFMISDLQAIKQIPLGVQQLLFIAFFLSFAVKVPMFPVHTWLPDAHVEAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GS+ LA I LK+G YG +RF+LP+ P AS+YFAPV+  LSLIA+IY  +V++VQTD+KK
Sbjct: 243 GGSMVLAAITLKIGAYGFLRFVLPIVPDASRYFAPVVIVLSLIAVIYVGMVALVQTDMKK 302

Query: 302 LIAYSSIAHMGYVTIGI--FSGMKS----------GVEGAMFQMLSHGLVSSALFFCVGV 349
           L+AYSSI+HMG+VT+GI  FSGM S          G++GA+ QM+SHG VS+A+F C+GV
Sbjct: 303 LVAYSSISHMGFVTLGIFLFSGMFSGSLLGELNDWGLKGAIVQMISHGFVSAAMFMCIGV 362

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM     +  +
Sbjct: 363 MYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGAVHVNLWI 422

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
             LA+  ++L A Y+LW+Y++ +FG      V ++KD++ RE  ++  +A+  +  G+YP
Sbjct: 423 GALAAITLILGASYTLWMYKRTIFGEITNPHVAEMKDINKREFAILTILAMAVLGMGLYP 482


>gi|78048397|ref|YP_364572.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036827|emb|CAJ24520.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 500

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 323/486 (66%), Gaps = 19/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LSI+ +LP +G  +IL        R +    +L ++   F  SL +   +D    +
Sbjct: 3   NWPLLSILIWLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDA 57

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q IE + WI  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+
Sbjct: 58  MQFIELHTWIPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 118 LEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            +V +  +  +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 178 GLVYLYLKGGSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+K
Sbjct: 237 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWLVITLSLIAVIYVGLVALVQDDMK 296

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KL+AYSSIAHMG+VT+G F               + G++GAM QM+SHG VS A+F C+G
Sbjct: 297 KLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIG 356

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 357 VLYDRMHTRRIADYGGVVNVMPWFATFSMLFFMANAGLPGTSGFVGEFMVILASFQKHPL 416

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A+  +V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+Y
Sbjct: 417 VAFGAATTLVITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLY 476

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 477 PKPLTD 482


>gi|39995459|ref|NP_951410.1| NADH dehydrogenase I subunit M [Geobacter sulfurreducens PCA]
 gi|39982222|gb|AAR33683.1| NADH dehydrogenase I, M subunit [Geobacter sulfurreducens PCA]
 gi|298504458|gb|ADI83181.1| NADH dehydrogenase I, M subunit [Geobacter sulfurreducens KN400]
          Length = 522

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/493 (46%), Positives = 335/493 (67%), Gaps = 10/493 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P +S++TFLP LGV ++ F             +AL +S + F+ S+ + + F +  + FQ
Sbjct: 5   PLISVMTFLPLLGVVLLFFVPKQSHSVHRM--LALLVSLVTFVVSIPLVTGF-QSNADFQ 61

Query: 64  MIEYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            +E   WI    +  +YH+ +DGIS+ LV+LTTF+ P  ILS+W +++E  +EYMI  L+
Sbjct: 62  FVEKMPWIAAGPFQMNYHVAIDGISLWLVLLTTFIMPIAILSTWTAVEEKVKEYMICLLL 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE  ++GAF+SLD+ LFYIF+E  LIPM+ IIG+WGG  +IYAA KFF+YT  GS+ ML 
Sbjct: 122 LEVGMLGAFVSLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIYAAVKFFIYTMVGSMLMLV 181

Query: 181 AIVVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A+V + ++      +++  Y ++  P + Q WM++AF  +FAIK+PMFP HTWLP+AH +
Sbjct: 182 ALVTLYFKAGAGDFNVLRFYEVTLDP-ATQVWMFLAFALAFAIKVPMFPLHTWLPDAHTE 240

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA ++LKMG YG +RF +PLFP A+  F P+I  LS+I IIYA+LV+MVQ D
Sbjct: 241 APTAGSVILAAVLLKMGTYGFVRFAMPLFPDATDKFTPLIATLSVIGIIYAALVAMVQED 300

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AH+GYV +G+F+    G+ G M QML+HG+ + ALF  VG IY+R HTR 
Sbjct: 301 VKKLVAYSSVAHLGYVMLGVFALNLQGLSGGMLQMLNHGVSTGALFLIVGFIYERRHTRL 360

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVLASFGV 417
           I  +GGL   MP +A + M+ T++++GLPGT+GF+GEFLV++  F++     AV+ + GV
Sbjct: 361 ITDFGGLAKQMPVFATIFMIVTLSSIGLPGTNGFVGEFLVLLGAFESELRWYAVIGTSGV 420

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L+A+Y LW++++V+FG     K Q L DL+ RE  ++ P+ VL    G+YP P  +  S
Sbjct: 421 ILAAVYMLWMFQRVMFGELTNPKNQTLCDLNAREVGIMLPLLVLIFVMGVYPTPFIEKMS 480

Query: 478 VPLSSIIENYTLK 490
             L  +I +   K
Sbjct: 481 PSLEKLIVHVKTK 493


>gi|157804162|ref|YP_001492711.1| NADH dehydrogenase subunit M [Rickettsia canadensis str. McKiel]
 gi|157785425|gb|ABV73926.1| NADH dehydrogenase subunit M [Rickettsia canadensis str. McKiel]
          Length = 493

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/492 (46%), Positives = 340/492 (69%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +  + + + +  S + FI + ++   FD 
Sbjct: 2   LELPIISISIFLPLISVLYILLFISQSKKTDKPIYVMYVVVLSSVLTFISTTYILVEFDS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E+Y W+D     +H+GVDGISI  VVLT+FLT  CI+ S  ++++  +EY++
Sbjct: 62  SNPAYQFVEHYTWLDKIGLEFHVGVDGISIFFVVLTSFLTLICIIGSLFTVKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA+KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSINLLLFYLFFEAILVPMYIIIGVWGGENRIYAAFKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  +  ++   P   Q  +W   F +FA+KIPM PFHTWLP+A
Sbjct: 182 FFLLSLIYIYSKIHSFDLTYIPELTGNIPLFAQKVLWWTIFIAFAVKIPMIPFHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI+LK+GGYG +R LL L P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILLKLGGYGFLRVLLTLLPTTSQAFAIYVIYLSVIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIG+FS  ++G+ GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGMFSFTEAGISGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+V+ MP  A   M+   +++GLPGTSGFIGEFL ++ +++ +     +A+ 
Sbjct: 362 TKEIAKYGGVVNKMPVLATFFMMAIFSSIGLPGTSGFIGEFLSLLGIYKVNIAATFVAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L A Y L LY++V+ G    +++   +DL   E   + P+ +L ++FGI P  I + 
Sbjct: 422 GIILGAGYMLKLYKEVMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGIMPNSILNI 481

Query: 476 FSVPLSSIIENY 487
           F + + +++  +
Sbjct: 482 FRLSIENLLVRF 493


>gi|149927553|ref|ZP_01915807.1| NADH dehydrogenase subunit M [Limnobacter sp. MED105]
 gi|149823826|gb|EDM83052.1| NADH dehydrogenase subunit M [Limnobacter sp. MED105]
          Length = 493

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/489 (44%), Positives = 333/489 (68%), Gaps = 9/489 (1%)

Query: 2   NLPFLSIVTFLPF-LGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           N+P+LS+  +LP   GV ++   +    G     G +L  + I+F+ +L ++  FD   +
Sbjct: 4   NIPYLSLAIWLPIAFGVLIMALGNDKNAGAVR--GASLIAALISFVVTLPLYFGFDTSTA 61

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E   WI+ F  SY LGVDG+S+  V+LT  +T F ++++W+ I E   +YM AFL
Sbjct: 62  QLQFVEKLPWIEAFGASYGLGVDGLSVWFVILTALITVFVVVAAWEVITEKVAQYMAAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L  +++G F + D LLFY+FFEA+LIPM++I+GVWGG  RIYAA+KFFLYT  GS+  L
Sbjct: 122 ILSGLMVGVFTATDGLLFYVFFEATLIPMYIIVGVWGGPNRIYAAFKFFLYTLLGSLLTL 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            AI+ + ++  T    ++ A  K P  +  Q  +++AF  +FA+K+PM+P HTWLP+AHV
Sbjct: 182 VAIIYLQFQSGT---FEIAAWHKLPLDMTEQILIFLAFLMAFAVKVPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA IMLK+G YG +RF +P+ P AS   A  +  LSLIA++Y  +V++VQ 
Sbjct: 239 EAPTGGSVVLAAIMLKLGAYGFLRFSMPIAPDASHELAGFMITLSLIAVVYIGVVALVQK 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSIAHMG+VT+G F      V+GA+ QM+SHG VS A+F C+GV+YDR+H+R
Sbjct: 299 DMKKLVAYSSIAHMGFVTLGFFMFQDLAVQGAIIQMISHGFVSGAMFICIGVLYDRVHSR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I AYGG+V+ MP++A   ++F MAN GLP TSGF+GEF+VI+   + +  + +LA+  +
Sbjct: 359 EIAAYGGVVNTMPKFAAFFLLFAMANAGLPATSGFVGEFMVILGAVKYNFWIGLLAATTL 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +  A YSLW+Y++VVFG    + V++L D++ RE  M+  +A+L +  G+YP P  D   
Sbjct: 419 IFGAAYSLWMYKRVVFGEVANDNVKELTDVNTREFMMLGALAILVMAMGLYPKPFTDVLQ 478

Query: 478 VPLSSIIEN 486
           V + +++++
Sbjct: 479 VSVDALLQH 487


>gi|186476752|ref|YP_001858222.1| NADH dehydrogenase subunit M [Burkholderia phymatum STM815]
 gi|184193211|gb|ACC71176.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia phymatum STM815]
          Length = 497

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/485 (46%), Positives = 341/485 (70%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  ++P + G+ V+   S    G   +  +AL  S ++FI ++ + + FD   ++ 
Sbjct: 6   PILSIAIWMPIIFGLVVLAIGSDRNPGPARW--IALIGSVLSFIVTIPLITDFDTSTAAL 63

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E  +WI+ F  +YHLG+DGI++  VVLT  +T   ++++W+ I +N  +Y+ AFL+L
Sbjct: 64  QFEEKANWIERFNITYHLGIDGIAMWFVVLTALITVIVVIAAWEVITKNVAQYLAAFLIL 123

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML  
Sbjct: 124 SGIMVGVFCAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVG 183

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +A +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 184 LLYLYTQTGTFDLAAWHA-AKLSMTPQVLLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA++Y  LV+MVQ D+KK
Sbjct: 243 GGSVVLAAIMLKLGAYGFLRFSLPIAPDASHFLAPVVITLSLIAVVYIGLVAMVQADMKK 302

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + G EGA+ QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 303 LVAYSSIAHMGFVTLGFFIFNQLGTEGAIVQMISHGFVSGAMFLCIGVLYDRMHSRQIAD 362

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A ++M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 363 YGGVVNTMPKFAALVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAFGAAVTLILGA 422

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D++ RE  M+  +AVLT++ GIYP P  +   V + 
Sbjct: 423 AYTLWMYKRVYFGAVVNDHVKSLIDINRREFFMLGVLAVLTLYMGIYPKPFTEVMHVSVE 482

Query: 482 SIIEN 486
           +++ +
Sbjct: 483 NLLSH 487


>gi|114330937|ref|YP_747159.1| NADH dehydrogenase subunit M [Nitrosomonas eutropha C91]
 gi|114307951|gb|ABI59194.1| NADH dehydrogenase subunit M [Nitrosomonas eutropha C91]
          Length = 493

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 330/486 (67%), Gaps = 7/486 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS++ +LP + G+ V L S       ++   VAL  S   F+ +L ++S FD    S 
Sbjct: 6   PLLSLIIWLPIVSGLIVFLMSDR---NTQAVRWVALAGSVAGFLVTLPLYSGFDTSMGSM 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q IE   W +     Y+LGVDGIS+ L++L +F TP  +++ W+ I+E   +YM AFL++
Sbjct: 63  QFIERNVWFERLNVYYYLGVDGISMPLILLNSFTTPLVVIAGWEVIREKVSQYMGAFLIM 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++ G F SLD +LFY F+EASL+PMF+IIGVWGG  RIYAA KFFLYTF GS+ ML A
Sbjct: 123 SGVLNGVFASLDAILFYSFWEASLVPMFIIIGVWGGPNRIYAALKFFLYTFLGSLLMLVA 182

Query: 182 IVVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           ++ +      S SI+D Y     P + Q  ++I F  +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 183 LIYLYQASGGSFSILD-YHHLPIPMAAQILIFIGFMVAFAVKVPMWPVHTWLPDAHVEAP 241

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I+LK+GGYG +RF LP+ P AS   + ++  LSLIAI+Y  +V+++Q D+K
Sbjct: 242 TGGSVVLAAILLKLGGYGFLRFSLPITPDASHELSWILIALSLIAIVYIGIVALMQRDMK 301

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS++HMG+VT+G F     G+EGAM QM+SHG +S ALF CVGV+YDRLHTR I 
Sbjct: 302 KLIAYSSVSHMGFVTLGFFLFNPIGIEGAMVQMISHGFISGALFLCVGVLYDRLHTRMIA 361

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP +A + M+F MAN GLPGTSGF+GEF+VIM   + +   A  A+  ++L 
Sbjct: 362 DYGGVVNKMPVFAALFMLFAMANSGLPGTSGFVGEFMVIMGSMEVNFWYAFFAALTLILG 421

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YSLWLY+KVVFG      V+ +KD+S RE  ++  +AV  +  GIYP+P+ +   V +
Sbjct: 422 ASYSLWLYKKVVFGAVANPNVEGMKDISAREFLVLAILAVAVLALGIYPLPLTEVMHVTV 481

Query: 481 SSIIEN 486
            +++E+
Sbjct: 482 DNLLEH 487


>gi|197941020|gb|ACH78246.1| NADH dehydrogenase subunit 4 [Arabidopsis thaliana]
          Length = 495

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/483 (48%), Positives = 324/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDSSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++ ++  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILFQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKFGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSPNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGLVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|148244401|ref|YP_001219095.1| NADH dehydrogenase I chain M [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326228|dbj|BAF61371.1| NADH dehydrogenase I chain M [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 501

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/486 (46%), Positives = 334/486 (68%), Gaps = 18/486 (3%)

Query: 14  FLGVFVILFSSYLGCGRRSFFG-VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID 72
           F GV VI    ++G GR +    V+L +S   F+ SL +++ FD      Q +E   WI 
Sbjct: 15  FSGVLVI----FIGNGRANIARWVSLILSIFIFVISLSLYTSFDSSTHLMQFVEKSSWIS 70

Query: 73  YF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLS 131
            F  +YH+GVDGIS+ L++LTTF T   I++ W+ + +    YM AFL++E ++IG F S
Sbjct: 71  QFNINYHIGVDGISVPLIILTTFSTILVIIAGWEVVIKRCSHYMAAFLMMEGLIIGVFSS 130

Query: 132 LDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKT 191
           LD +LFY+F+EASLIPM +IIG+WGG  R+YA+ KFFLYTF GS+FML +++ M  +  +
Sbjct: 131 LDAILFYVFWEASLIPMLLIIGIWGGVNRVYASIKFFLYTFLGSVFMLLSLIYMYNKGGS 190

Query: 192 SSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIM 251
            SIID++ + K  F+ Q +++ AFF +FA+K+PMFP HTWLP+AHVQAPT GSV LA IM
Sbjct: 191 FSIIDMHNL-KLSFTEQSYIFWAFFMAFAVKVPMFPMHTWLPDAHVQAPTGGSVILAAIM 249

Query: 252 LKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHM 311
           LKMGGYG  RF LP+ P AS  F+ ++  LSLIAI+Y   +++VQ DIKKLIAYSSI+HM
Sbjct: 250 LKMGGYGFFRFSLPIIPDASLEFSEIMIILSLIAIVYIGFIALVQRDIKKLIAYSSISHM 309

Query: 312 GYVTIGIFS-----------GMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           G+VT+GIF+           G   G+EGAM QM+SHG +S+A+F  VGV+YDRLH+R+I 
Sbjct: 310 GFVTLGIFTLFLSYKQNIIEGSLLGLEGAMVQMISHGFISAAMFLVVGVLYDRLHSREIS 369

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+++ MP++   +++F MAN+GLPGTSGF+GEF+VI+   Q +    +L++  +++ 
Sbjct: 370 TYGGVINTMPKFTGFVILFAMANVGLPGTSGFVGEFMVILGAIQANIWYGILSASTLIIG 429

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LW+ ++V FGV     V  LKD++ RE  ++  +A++ +  G+YP P+ +   + +
Sbjct: 430 AAYTLWMVKRVFFGVITNPAVSMLKDINAREFSILAILAIVVLVIGLYPQPVIELMHISI 489

Query: 481 SSIIEN 486
             ++  
Sbjct: 490 EHLLHQ 495


>gi|28198183|ref|NP_778497.1| NADH dehydrogenase subunit M [Xylella fastidiosa Temecula1]
 gi|182680817|ref|YP_001828977.1| NADH dehydrogenase subunit M [Xylella fastidiosa M23]
 gi|28056253|gb|AAO28146.1| NADH-ubiquinone oxidoreductase NQO13 subunit [Xylella fastidiosa
           Temecula1]
 gi|182630927|gb|ACB91703.1| proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa M23]
 gi|307579284|gb|ADN63253.1| NADH dehydrogenase subunit M [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 501

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 243/500 (48%), Positives = 332/500 (66%), Gaps = 21/500 (4%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +I+        R +    AL ++ + F FSL +   +D  + +
Sbjct: 3   NWPLLSVLIWLPIIGGLLIMGLRNAHVARWA----ALAVALVTFGFSLHLLGGYDIAKDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI+I LV+LTT +T   ++ SW SIQ+   +Y+ AFL+
Sbjct: 59  LQFVEQHVWIQTYSIGYNLGVDGIAIALVLLTTLVTVLVLIGSWGSIQQRVPQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + IG F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAIKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYAM +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYAM-QLSAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA V+  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLIAVIYVGLVALVQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+GIF               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLIAYSSIAHMGFVTLGIFIAFTLVRDFGNTDAARLGLQGAMVQMISHGFVSGAMFTCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   ++F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 358 VLYDRMHTRRIADYGGVVNVMPWFATFAILFYMANAGLPGTSGFVGEFMVILASFQKHPL 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V  LKD++ RE  ++   A+  +  G+Y
Sbjct: 418 VAFGAGTTLVITAAYTLWLYKRVFFGEVANTHVAALKDINFREASVLVLFAIGVLVLGLY 477

Query: 469 PVPIRDTFSVPLSSIIENYT 488
           P P+ D      SSI++  T
Sbjct: 478 PKPLIDLMD---SSIVKLTT 494


>gi|166712602|ref|ZP_02243809.1| NADH dehydrogenase subunit M [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 491

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 318/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F  SL +   +D    + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLY++ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYSL-QLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPILPDASHEFAWLVIALSLIAVIYVGLVALVQDDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLLREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILASFQKHPLVAFAAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE C++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREACVLGVFAAGVLALGLYPKPLTD 473


>gi|307730328|ref|YP_003907552.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. CCGE1003]
 gi|307584863|gb|ADN58261.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. CCGE1003]
          Length = 496

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 338/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP L G+ V+   S    G   +  +AL  S I+F+ ++ + + FD   +  
Sbjct: 5   PILSIAIWLPILFGLLVLAIGSDRNPGPARW--IALIGSVISFVVTIPLITGFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I +N  +Y+ +FL+L
Sbjct: 63  QFVEKANWIERFNITYHLGVDGISMWFVVLTALITVIVVIAAWEVITKNVGQYLASFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LLYLYIQTGTFDLAS-WQHAQIAMTPQVLLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAGGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D+  RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVKSLLDIGRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|220934174|ref|YP_002513073.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995484|gb|ACL72086.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 504

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/499 (45%), Positives = 339/499 (67%), Gaps = 18/499 (3%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P LS+V + P +G + V++    +  G R    ++L  S + F+ S+ ++  FD+G  
Sbjct: 4   DWPLLSLVIWTPIIGGILVLMAGDKMPDGARR---LSLFFSVLTFLISIPLFVHFDRGTH 60

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E   WI  F  +YHLGVDGIS+ L++LTTF T   ++++W+ IQ+   +YM AFL
Sbjct: 61  EMQFVELLPWISTFNVNYHLGVDGISMPLILLTTFTTVLVVIAAWEVIQKRVSQYMAAFL 120

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++E  + G F +LD +LFY+FFE  LIPMF++IG+WGG  R+YA  KFFLYTF GS+FML
Sbjct: 121 IMEGFMNGVFAALDSVLFYVFFEGMLIPMFLVIGLWGGPNRVYATLKFFLYTFLGSVFML 180

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ M     + +I+D + + +   + Q  +++AF  +FA+KIPM+P HTWLP+AHV+A
Sbjct: 181 VALIYMYTRSGSFAILDFHQL-QLGMTAQVLIFLAFLAAFAVKIPMWPVHTWLPDAHVEA 239

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA IMLK+GGYG +RF LP+ P AS     ++  +SLIA++Y   V++VQ D+
Sbjct: 240 PTGGSVVLAAIMLKIGGYGFLRFSLPITPDASMALDWLLITMSLIAVVYIGFVALVQQDM 299

Query: 300 KKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCV 347
           KKLIAYSSIAHMG+VT+GIF             G   G+EGAM QM+SHG +S+A+F CV
Sbjct: 300 KKLIAYSSIAHMGFVTLGIFIVFMIYNNTGNWQGAALGIEGAMVQMISHGFISAAMFLCV 359

Query: 348 GVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSN 407
           GV+YDRLH+R I  YGG+V+ MP ++   ++F MAN GLPGTSGF+GEF+VI++ F+ + 
Sbjct: 360 GVLYDRLHSRQIADYGGVVNTMPWFSAFFVLFAMANTGLPGTSGFVGEFMVILASFKANF 419

Query: 408 TVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGI 467
            +A LA+  ++L+A Y+LWL ++VVFG    + V +L+DL+ RE  ++  +A + +  G+
Sbjct: 420 WIAFLAATTLILAAGYTLWLVKRVVFGEIANDNVAKLQDLNRREFLVLGILAFVVLLLGV 479

Query: 468 YPVPIRDTFSVPLSSIIEN 486
           +P P+ +     + ++I++
Sbjct: 480 WPAPLLEVMHATVDNLIQH 498


>gi|325983277|ref|YP_004295679.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosomonas sp. AL212]
 gi|325532796|gb|ADZ27517.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosomonas sp. AL212]
          Length = 494

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/485 (46%), Positives = 331/485 (68%), Gaps = 4/485 (0%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS++ +LP L GV V  F++      R    +AL  S + F+ ++ +++ FD    + 
Sbjct: 6   PLLSLIIWLPILFGVAV--FATGGDHNARLARWIALIGSILGFLVAIPLYTNFDSTTGAM 63

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E + W + F  +YH+GVDGIS+ L++L  F+TP  +++ W+ I+E   +Y+ AFLV+
Sbjct: 64  QFLEDHVWFERFNVNYHIGVDGISMPLILLNCFITPLVVVAGWEVIKERVSQYLGAFLVM 123

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +V G F SLD +LFY+F+EASLIPMF+IIG+WGG  R+YAA KFFLYT  GS+ ML A
Sbjct: 124 SGIVNGVFSSLDAVLFYVFWEASLIPMFLIIGIWGGPNRVYAAIKFFLYTLLGSLLMLIA 183

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
            + +    + S  I+ Y     P + Q  ++IAF  +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 184 FIYLYHASEGSFSIEDYHKLAIPMTPQILIFIAFLLAFAVKVPMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA I+LK+GGYG +RF LP+ P AS Y A ++  LSL+A++Y  L++++Q D+KK
Sbjct: 244 GGSVVLAAILLKLGGYGFLRFSLPIAPDASHYLAEMMIVLSLVAVVYIGLIALMQVDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS+AHMG+VT+G F     G+EG M QM+SHG +S A+F CVGV+YDRLH+R I  
Sbjct: 304 LIAYSSVAHMGFVTLGFFLLNAYGIEGGMVQMISHGFISGAMFLCVGVLYDRLHSRQIAD 363

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VIMS  + +   A LA+  ++  A
Sbjct: 364 YGGVVNKMPVFAAFFMLFAMANAGLPGTSGFVGEFMVIMSAVKVNFWYAFLAATTLIFGA 423

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V+FGV     V+ L+D+S RE  ++  +A+  ++ GIYP P+ +     + 
Sbjct: 424 AYTLWMYKRVIFGVVASPAVESLQDISKREFGLLAILAISVLWIGIYPFPLTEVMHATVD 483

Query: 482 SIIEN 486
            ++ +
Sbjct: 484 QLLTH 488


>gi|323525448|ref|YP_004227601.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Burkholderia sp. CCGE1001]
 gi|323382450|gb|ADX54541.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. CCGE1001]
          Length = 496

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 338/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP L G+ V+   S    G   +  +AL  S ++F+ ++ + + FD   +  
Sbjct: 5   PILSIAIWLPILFGLLVLAIGSDRNPGPARW--IALIGSIVSFLVTIPLITGFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I +N  +Y+ +FL+L
Sbjct: 63  QFVEKANWIERFNITYHLGVDGISMWFVVLTALITVIVVIAAWEIITKNVGQYLASFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LLYLYIQTGTFDLAT-WQHAQIAMTPQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAAGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D+  RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVKSLLDIGRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|316996017|dbj|BAD83480.2| NADH dehydrogenase subunit 4 [Nicotiana tabacum]
          Length = 495

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 324/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFI 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+ FLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQLFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++ ++  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILFQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGIVLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGVVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|157826245|ref|YP_001493965.1| NADH dehydrogenase subunit M [Rickettsia akari str. Hartford]
 gi|157800203|gb|ABV75457.1| NADH dehydrogenase subunit M [Rickettsia akari str. Hartford]
          Length = 493

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/492 (46%), Positives = 336/492 (68%), Gaps = 5/492 (1%)

Query: 1   MNLPFLSIVTFLPFLGV-FVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDK 57
           + LP +SI  FLP + V +++LF S      +S +   VA+  S + FI ++++   F+ 
Sbjct: 2   LELPIISISIFLPLISVLYILLFMSQSKKTDKSIYVMYVAVLSSVLTFISTIYILIEFNS 61

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
              ++Q +E Y W+D     +H+GVDGISI  V LT+FLT  CI+ S  +I++  +EY++
Sbjct: 62  SNPAYQFVERYAWLDKIGLEFHVGVDGISIFFVALTSFLTLVCIIGSLFTIKKYIKEYLV 121

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
            FL++ES  IGAF S+++LLFY+FFEA L+PM++IIGVWGG  RIYAA KFFLYTFFGS+
Sbjct: 122 CFLLMESFCIGAFTSVNLLLFYLFFEAILVPMYIIIGVWGGENRIYAALKFFLYTFFGSV 181

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           F L +++ +  +  +  +  +  ++   P   Q  +W A F +FAIKIPM P HTWLP+A
Sbjct: 182 FFLLSLIYIYSKIHSFDLTYIPELTDNIPLFAQQILWWAIFIAFAIKIPMIPVHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HVQAPT+GSV LAGI++K+GGYG +R LLPL P  SQ FA  + +LS+IAIIYASLV++ 
Sbjct: 242 HVQAPTSGSVILAGILIKLGGYGFLRVLLPLLPSVSQEFAIYVIYLSIIAIIYASLVALA 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSSIAHMGYVTIGIFS   +GV GA+FQMLSHG++SS LF  VG +Y+RLH
Sbjct: 302 QKDMKKMIAYSSIAHMGYVTIGIFSFTDAGVNGAIFQMLSHGVISSCLFLIVGTLYERLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           T++I  YGG+   M   A   M+  + ++GLPGTSGFIGEFL ++  ++ +     +A+ 
Sbjct: 362 TKEIAKYGGVASKMHVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGTYKVNVAATCVAAL 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G+++ A+Y L LY++++ G    +++   +DL   E   + P+ +L ++FG+ P  I + 
Sbjct: 422 GIIIGAVYMLKLYKEIMLGEITNKEIMHFRDLYKYEIISIAPLILLIIYFGLMPSSILNV 481

Query: 476 FSVPLSSIIENY 487
           FS  + +++  +
Sbjct: 482 FSFSVKNLLVKF 493


>gi|285017804|ref|YP_003375515.1| NADH-quinone oxidoreductase chain m (nadh dehydrogenaseI chain m)
           (ndh-1, chain m) (nuo13) oxidoreductase [Xanthomonas
           albilineans GPE PC73]
 gi|283473022|emb|CBA15527.1| probable nadh-quinone oxidoreductase chain m (nadh dehydrogenaseI
           chain m) (ndh-1, chain m) (nuo13) oxidoreductase protein
           [Xanthomonas albilineans]
          Length = 500

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 322/485 (66%), Gaps = 17/485 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +IL        R +   VAL    + F  S+ + + FD    +
Sbjct: 3   NWPLLSLLIWLPIVGGALILALRDAHAARWASLLVAL----LTFALSVPLLTGFDYASDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LG DGI++ L+VLTT +T   ++ +W SI +   +Y+ AFL+
Sbjct: 59  LQFVETHAWIPAYNIGYNLGADGIAVALIVLTTLVTVLALIGAWTSIDKRVNQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + +G F + D +LFY+FFEA LIPMF+IIG+WGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTVGIFSATDAMLFYVFFEAMLIPMFLIIGIWGGPRRIYAAVKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLY +S      Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYHLS-LTAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  +A ++  LSLIA++Y  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPILPDASNEWAWLVIALSLIAVVYVGLVALVQDDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF-----------SGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           KLIAYSSIAHMG+VT+G F              + G++GAM QM+SHG VS A+F CVGV
Sbjct: 298 KLIAYSSIAHMGFVTLGAFVAFALVGFGSVDAARLGLQGAMVQMISHGFVSGAMFSCVGV 357

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDR+H+R I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VIM+ FQ    +
Sbjct: 358 LYDRMHSRRIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVIMASFQTHPLL 417

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A  A+  +V++A Y+LWLYR+V FG      V +LKD++ RE  ++   A+  +  G+YP
Sbjct: 418 AFGAATTLVITAAYTLWLYRRVFFGEVANAHVAELKDINGREALVLGVFALGVLALGLYP 477

Query: 470 VPIRD 474
            P+ D
Sbjct: 478 KPLTD 482


>gi|238028131|ref|YP_002912362.1| NADH dehydrogenase subunit M [Burkholderia glumae BGR1]
 gi|237877325|gb|ACR29658.1| NADH dehydrogenase subunit M [Burkholderia glumae BGR1]
          Length = 497

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 238/486 (48%), Positives = 333/486 (68%), Gaps = 7/486 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRS--FFGVALGISTINFIFSLFVWSVFDKGRSS 61
           P LS   +LP +   VIL    +G  R+      VAL  S + F  ++ + + FD   ++
Sbjct: 5   PILSTAIWLPIVFGLVIL---AIGTDRKPGVIRWVALLGSLLGFAVTIPLVTGFDPSTAA 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   WI+ F  SYHLGVDGIS+  VVLT  +T   ++++W+ I EN  +Y+ AFL+
Sbjct: 62  LQFQENVSWIERFNVSYHLGVDGISMWFVVLTALITVIVVVAAWEVITENVSQYLAAFLI 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L  ++IG F + D LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML 
Sbjct: 122 LSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLMLV 181

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +  E  T  +  ++  +K   + Q  ++ AFF +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 182 ALIYLYRETHTFDL-AVWQGAKLAMTPQLLLFAAFFLAFAVKVPMWPVHTWLPDAHVEAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLK+G YG +RF LP+ P AS Y APV+  LSL+A+IY  LV+MVQTD+K
Sbjct: 241 TGGSVVLAAIMLKLGAYGFLRFSLPVTPDASHYLAPVVIALSLVAVIYIGLVAMVQTDMK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KL+AYSSIAHMG+VT+G F     GVEGA+ QM+SHG VS A+F C+GV+YDRLHTR+I 
Sbjct: 301 KLVAYSSIAHMGFVTLGFFIFSPLGVEGAIVQMISHGFVSGAMFLCIGVLYDRLHTRNIA 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP++A   ++F MAN GLPGTSGF+GEF+VI++  + +  +A  A F ++L 
Sbjct: 361 DYGGVVNVMPKFATFALLFAMANCGLPGTSGFVGEFMVILASVKFNFWIAFGAGFTLILG 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LW+Y++V FG    EKV +LKD+  RE  M+  +A  T+  G+YP P  D   V +
Sbjct: 421 AGYTLWMYKRVYFGKVVNEKVTRLKDIGAREFSMLAVLAAFTLLMGLYPKPFTDVMHVSV 480

Query: 481 SSIIEN 486
            +++ +
Sbjct: 481 ENLLSH 486


>gi|325915551|ref|ZP_08177862.1| NADH dehydrogenase subunit M [Xanthomonas vesicatoria ATCC 35937]
 gi|325538267|gb|EGD09952.1| NADH dehydrogenase subunit M [Xanthomonas vesicatoria ATCC 35937]
          Length = 491

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 319/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F+ SL +   +D G  + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFVLSLPLLG-YDTGNDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA++Y  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVITLSLIAVVYVGLVALVQDDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFSMLFFMANAGLPGTSGFVGEFMVILASFQKHPLVAFAAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLYPKPLTD 473


>gi|332285005|ref|YP_004416916.1| putative monovalent cation/H+ antiporter subunit A [Pusillimonas
           sp. T7-7]
 gi|330428958|gb|AEC20292.1| putative monovalent cation/H+ antiporter subunit A [Pusillimonas
           sp. T7-7]
          Length = 495

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/494 (45%), Positives = 329/494 (66%), Gaps = 10/494 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGR 59
            LP+L++  F+P +   ++L    LG   R      L +  S   F+ +L ++  F+   
Sbjct: 5   TLPWLTLSIFVPIVAGLIVLL---LGRDDRPGLTRVLSLLGSVAGFLVTLPLYFGFNPDT 61

Query: 60  SSFQMIEYYHWIDYFC-SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           +  Q +E   WI+ F  +YHLG+DGISI  V+LT F+T   +L+ W+ I     +YM AF
Sbjct: 62  ADMQFVEKASWIETFAVNYHLGIDGISIWFVLLTAFITIIVVLAGWEVITSRVSQYMAAF 121

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F SLD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  
Sbjct: 122 LILSGLMVGVFSSLDGMLFYVFFEATLIPMYLIIGVWGGPNRVYAAFKFFLYTLMGSLLT 181

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           L A + + W     S  D+    + P  +  Q  ++IA F +FA+K+PM+P HTWLP+AH
Sbjct: 182 LIAFIYL-WHAADGSF-DIQTWHELPLGMTAQTLIFIALFAAFAVKVPMWPVHTWLPDAH 239

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ
Sbjct: 240 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAGIVIALSLIAVIYIGLVAIVQ 299

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS+AHMG+VT+G F    +G+EGA+ QM+SHG VS A+F C+GV+YDRLHT
Sbjct: 300 DDMKKLVAYSSVAHMGFVTLGFFIFNTAGMEGAIVQMISHGFVSGAMFLCIGVLYDRLHT 359

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+++ MPR+A   ++F+MAN GLP TSGF+GEF VIM   Q +  + +LA+  
Sbjct: 360 RRIDDYGGVINVMPRFATFFLLFSMANAGLPATSGFVGEFTVIMGAVQYNYWIGLLAATA 419

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A YSLW+Y++V FG    + V+ + DLS RE  ++  +A+  ++ GIYP P  D  
Sbjct: 420 LILGASYSLWMYKRVAFGAIANDNVRGMSDLSSREFFIMGLMAIAVLYMGIYPKPFTDVM 479

Query: 477 SVPLSSIIENYTLK 490
            V + +++++ ++ 
Sbjct: 480 HVSVEALLQHVSIS 493


>gi|297181768|gb|ADI17949.1| NADH:ubiquinone oxidoreductase subunit 4 (chain m) [uncultured
           Desulfobacterales bacterium HF0200_07G10]
          Length = 533

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/489 (44%), Positives = 335/489 (68%), Gaps = 10/489 (2%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           FL+ +TFLPF G   ++F         +    AL ++  +F+ SLF+W+ FD      Q 
Sbjct: 2   FLTFITFLPFFGAVCLIFMP--KENESAIKQTALAVAVTDFLLSLFLWTNFDNTTHKMQF 59

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
                WI+ +  +YH+G+DGIS+LL V+TTFLT  C+++SW  ++++ REYMIA L L +
Sbjct: 60  GFNIPWIEQWGINYHIGLDGISLLLYVMTTFLTMICVIASW-DVKKHIREYMIAMLALST 118

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
            ++G F++LD+ +FY+F+E  L+PM++I+GVWGG  RIYA+ KFFL+T  GS+ ML AI+
Sbjct: 119 GMLGVFIALDLFMFYVFWEFQLVPMYIIVGVWGGPRRIYASIKFFLFTAVGSLLMLVAIL 178

Query: 184 VMCWE-KKTSSIID---LYAMSKFPFSIQ--YWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            + +  +KT+ +     LY       S+    W+W+AFF +FAIK+PMFPFHTWLP+AHV
Sbjct: 179 WIYFHIQKTTGVATADILYITEHLDVSLDTSKWLWMAFFLAFAIKVPMFPFHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMG YG +RF LP FP AS  F P++ +LS+I I+Y +LV+MVQ 
Sbjct: 239 EAPTAGSVILAGVLLKMGTYGFLRFNLPFFPQASYEFVPMVAWLSIIGIVYGALVAMVQE 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSS++H+G++ +GIF+    G++GA+ Q ++HG+ +SALF  VG++YDR HTR
Sbjct: 299 DLKKLVAYSSVSHLGFIMLGIFALNPYGIQGALIQNINHGISTSALFLLVGIVYDRRHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  +GGL   MP+Y V  M+  ++++GLPG +GF+GEFLV++ +FQ +   A  A+ GV
Sbjct: 359 MIAEFGGLAKIMPKYTVCFMIVALSSIGLPGMNGFVGEFLVLLGIFQVNGLWAACATSGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L+A Y LW++++V+F   K  K + +KD++ RE   + P+ +L  + G+YP     TF 
Sbjct: 419 ILAACYILWMFQRVMFLELKNPKNKVMKDMNTREMITIAPLVILIFWIGLYPNTFMKTFD 478

Query: 478 VPLSSIIEN 486
             ++ ++  
Sbjct: 479 SSVNHLVSK 487


>gi|22550342|ref|NP_689375.1| NADH dehydrogenase subunit 4 [Chaetosphaeridium globosum]
 gi|22417008|gb|AAM96607.1|AF494279_12 NADH dehydrogenase subunit 4 [Chaetosphaeridium globosum]
          Length = 485

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/455 (50%), Positives = 321/455 (70%), Gaps = 5/455 (1%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTF 94
           V L IS I F++SL  W  FD   + FQ +E   W+ +   +++ G+DGIS+L ++LTTF
Sbjct: 33  VGLSISLITFVYSLLFWICFDNSCTKFQFVEQIPWLSFSNINFYYGIDGISLLFLILTTF 92

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P C+L  W SI +  REY +AFLVLE+ ++  F  LD+LLF++FFE+ LIPMF+IIGV
Sbjct: 93  LVPSCLLVGWSSISKYQREYFVAFLVLEAFMLAVFCMLDVLLFFVFFESVLIPMFIIIGV 152

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT FGS+FML AI+ + ++  T+ +  LY+ +++    Q  ++I
Sbjct: 153 WGSRQRKIRAAYQFFLYTLFGSVFMLLAILFIYFQTGTTDVQILYS-TEWSTRRQILLFI 211

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+KIPM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+ Y
Sbjct: 212 AFFASFAVKIPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGLLRFSMPMFPEATAY 271

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG++  M
Sbjct: 272 FTPFIYTLSVIAIIYTSLTTLRQIDLKKIIAYSSVAHMNFVTIGMFSLNVQGIEGSILLM 331

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVG +YDR HTR +  YGGL   MP ++++ + FT+ NM LPGTS F+
Sbjct: 332 LSHGLVSSALFLCVGALYDRHHTRLVKYYGGLCSTMPIFSLIFLFFTLGNMSLPGTSSFV 391

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ++ ++A LA+ G+VL A YS+WLY +VVFG    + +    DL+ RE C
Sbjct: 392 GEFLILVGAFQSNTSIATLAAIGMVLGAAYSIWLYNRVVFG--NWKHIHNFTDLNRRELC 449

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYT 488
           ++ P  +  ++ GIYP    D     ++++I   T
Sbjct: 450 LIAPFVIGVLWMGIYPEIFLDCMHSSVNNLISMTT 484


>gi|325267333|ref|ZP_08133995.1| NADH-quinone oxidoreductase subunit M [Kingella denitrificans ATCC
           33394]
 gi|324981270|gb|EGC16920.1| NADH-quinone oxidoreductase subunit M [Kingella denitrificans ATCC
           33394]
          Length = 499

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/475 (46%), Positives = 322/475 (67%), Gaps = 12/475 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSFQ 63
           LS+  +LP L   ++L +   G   R+     L    +  +F  +L +++ FD+    +Q
Sbjct: 7   LSLTIWLPILAGVLVLAT---GSDERAPLARILAFLGAAASFAVTLPLFTHFDRTSGGYQ 63

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E + WI     +Y LGVDGIS+L ++L +F+T   +L+ W+ IQ+   +YM AFL++ 
Sbjct: 64  FQELHAWIPALNLNYALGVDGISVLFIILNSFITLMVVLAGWQVIQKRAAQYMAAFLIMT 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ GAF + D +LFY+FFE  LIP+++IIG+WGG+ R+YAA K FLYT  GS+ ML A+
Sbjct: 124 GLINGAFAARDAILFYVFFEGMLIPLYLIIGMWGGARRMYAAMKLFLYTLAGSLLMLIAL 183

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           + +  + ++  I DL  +   P  +Q  +++AFF SFA+K+PMFP HTWLP+AHV+APT 
Sbjct: 184 IYLGAQAESFMITDLQNLKNIPLGVQQLLFVAFFLSFAVKVPMFPVHTWLPDAHVEAPTG 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GS+ LA I LK+G YG +RF LP+ P AS+YFAP I  LSLIA++Y  LV++VQTD+KKL
Sbjct: 244 GSMVLAAITLKVGAYGFLRFALPILPDASRYFAPAIIVLSLIAVVYIGLVALVQTDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGV------EGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           +AYSSI+HMG+VT+G F  M +G       +GA+ QM+SHG VS+A+FFC+GV+YDRLHT
Sbjct: 304 VAYSSISHMGFVTLGFFMFMANGQPEAWGFKGAIMQMISHGFVSAAMFFCIGVMYDRLHT 363

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM        V  LA+  
Sbjct: 364 RNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGATHYHLGVGALAAVT 423

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           ++L A Y+LW+Y++ +FG      V ++KD++ RE  ++  +AV  +  G+YP P
Sbjct: 424 LILGASYTLWMYKRTIFGDITNPHVAEMKDINCREFAVLTILAVAVLGMGLYPEP 478


>gi|91782624|ref|YP_557830.1| NADH dehydrogenase subunit M [Burkholderia xenovorans LB400]
 gi|296160641|ref|ZP_06843456.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. Ch1-1]
 gi|91686578|gb|ABE29778.1| NADH dehydrogenase subunit M [Burkholderia xenovorans LB400]
 gi|295889167|gb|EFG68970.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia sp. Ch1-1]
          Length = 496

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 338/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP L G+ V+   S        +  +AL  S ++F+ ++ + + FD   +  
Sbjct: 5   PILSIAIWLPILVGLLVLAIGSDRNPAPARW--IALIGSVVSFLVTIPLITGFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I +N  +Y+ AFL+L
Sbjct: 63  QFVEKANWIERFNITYHLGVDGISMWFVVLTALITVIVVIAAWEVITKNVAQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LLYLYVQTGTFDLAT-WQHAQIAMTPQVLLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPITPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAGGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D++ RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAIANDHVRSLLDINRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|329907894|ref|ZP_08274720.1| NADH-ubiquinone oxidoreductase chain M [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546876|gb|EGF31794.1| NADH-ubiquinone oxidoreductase chain M [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 500

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/451 (48%), Positives = 318/451 (70%), Gaps = 1/451 (0%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFC 99
           S ++F+ +L +   FD      Q  E   WI+ F   Y LG+DGIS+ LVVLT+F+T   
Sbjct: 47  SVVSFLVTLPLIQRFDNAAHGMQFAEKMPWIERFNIQYFLGIDGISLWLVVLTSFITIIV 106

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           ++S+W+ IQ+   +YM AFL+L  +++G F +LD +LFY+FFEA+LIPMF+IIGVWGG  
Sbjct: 107 VISAWEVIQKKVAQYMGAFLILSGLMVGVFCALDGMLFYVFFEATLIPMFIIIGVWGGGN 166

Query: 160 RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSF 219
           R+YAA KFFLYTFFGS+ ML A++ + +    S  I  +     P ++Q  +++AF  +F
Sbjct: 167 RVYAAIKFFLYTFFGSLLMLVALLYLYFASGGSFDITYWHDLPLPLNVQIPLFLAFLMAF 226

Query: 220 AIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIF 279
           A+K+PM+P HTWLP+AHV+APT GSV LA IMLK+G YG +RF LP+ P AS Y AP++ 
Sbjct: 227 AVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHYLAPMMI 286

Query: 280 FLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLV 339
            LSLIA+IY  LV++VQTD+KKL+AYSSIAHMG+VT+G F+     V+G + QM+SHG V
Sbjct: 287 TLSLIAVIYIGLVALVQTDMKKLVAYSSIAHMGFVTLGFFAFNDMAVQGGIVQMVSHGFV 346

Query: 340 SSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVI 399
           S+A+F C+GV+YDR+HTR I  YGG+V+ MP++A   ++F++AN GLP TSGF+GEF+VI
Sbjct: 347 SAAMFLCIGVLYDRMHTRAIADYGGVVNTMPKFAAFFVLFSLANCGLPATSGFVGEFMVI 406

Query: 400 MSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIA 459
           +   + +  + +LA   ++  A YSLWL ++V+FG     +V +LKDLSLRE  M+  +A
Sbjct: 407 LGAIKFNFWIGLLAGTALIFGAAYSLWLVKRVIFGAVANPQVAKLKDLSLREFGMLGVLA 466

Query: 460 VLTVFFGIYPVPIRDTFSVPLSSIIENYTLK 490
           +  +  G+YP PI D     ++ ++++ ++ 
Sbjct: 467 IAVLVMGVYPAPITDAMQTSVADLLQHVSIS 497


>gi|112253904|ref|YP_717159.1| NADH dehydrogenase subunit 4 [Brassica napus]
 gi|37591106|dbj|BAC98908.1| NADH dehydrogenase subunit 4 [Brassica napus]
          Length = 495

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 323/483 (66%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDSSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++ ++  T+ +  +   ++F    Q ++WIAFF  FA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILFQTGTTDL-QILLTTEFSERRQIFLWIAFFAFFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKFGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSPNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGLVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|255019919|ref|ZP_05291994.1| NADH-ubiquinone oxidoreductase chain M [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970699|gb|EET28186.1| NADH-ubiquinone oxidoreductase chain M [Acidithiobacillus caldus
           ATCC 51756]
          Length = 494

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/440 (48%), Positives = 313/440 (71%), Gaps = 1/440 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTF 94
           VAL  S + F  +L + + FD   ++ Q +E   WI      YHLGVDGIS+  V+LT+F
Sbjct: 35  VALLGSVVTFAITLEILAGFDTRTAAMQFVERIPWIPALNIDYHLGVDGISLWFVLLTSF 94

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           LT   ++SSW +++    +++ AFL+++ ++IG F +LD +LFY F+EA+LIPMF+IIGV
Sbjct: 95  LTILVVISSWTNVERRLAQFLGAFLIMDGLMIGVFCALDAILFYFFWEATLIPMFLIIGV 154

Query: 155 WGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           WGG  R+YA  KFFLYTF GS+ ML A++ + +    S  +  +  +      Q W+++A
Sbjct: 155 WGGPRRVYATIKFFLYTFLGSVLMLVALLYLHFHSGGSFNLLTFQNTPLGMVAQIWIFLA 214

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF +FA+KIPM+P HTWLP+AHV+APTAGSV LA +MLKMG YG +R  LP+ P AS + 
Sbjct: 215 FFLAFAVKIPMWPVHTWLPDAHVEAPTAGSVILAAVMLKMGAYGFLRLSLPITPDASHHL 274

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
           A ++  LSLIAI+Y +LV++VQ D+KKL+AYSSIAHMG+VT+G F    + +EG + QML
Sbjct: 275 AWLMVLLSLIAIVYIALVAIVQQDMKKLVAYSSIAHMGFVTLGFFVFDATAMEGGIIQML 334

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG +S+A+F C+GV+YDR+HTRDI AYGG+ + MP +A  MM+F M N+GLPGTSGF+G
Sbjct: 335 SHGFISAAMFLCIGVLYDRMHTRDIHAYGGVANVMPIFASFMMLFAMGNVGLPGTSGFVG 394

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           EF+V++  +Q     A++A+ G++  A Y+LWL+++V+FG     +V  L+DL+L+E  +
Sbjct: 395 EFMVVLGTYQVQPWAAIVAATGLITGAGYTLWLFKRVIFGPVIHPQVAALQDLNLQEFLV 454

Query: 455 VYPIAVLTVFFGIYPVPIRD 474
           +  +AVLT+  G++P P  D
Sbjct: 455 LGSLAVLTLLMGVWPAPFLD 474


>gi|71275678|ref|ZP_00651963.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Dixon]
 gi|71897778|ref|ZP_00680004.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Ann-1]
 gi|71163569|gb|EAO13286.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Dixon]
 gi|71732333|gb|EAO34387.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Ann-1]
          Length = 501

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 325/486 (66%), Gaps = 18/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +I+    +   R +   VAL      F FSL +   +D  + +
Sbjct: 3   NWPLLSVLIWLPIIGGLLIMGLRNVHVARWAALAVALA----TFGFSLHLLGGYDIAKDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ LV+LTT +T   ++ SW +I +   +Y+ AFL+
Sbjct: 59  LQFVEQHVWIQTYSIGYNLGVDGIAVALVLLTTLVTVLVLIGSWGAINQRVPQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + IG F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAIKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYAM +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYAM-QLSAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA V+  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLIAVIYVGLVALVQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+GIF               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLIAYSSIAHMGFVTLGIFISFTLARDFGNTDAARLGLQGAMVQMISHGFVSGAMFTCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRLHTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 358 VLYDRLHTRRIADYGGVVNVMPWFATFAMLFYMANAGLPGTSGFVGEFMVILASFQKHPL 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V  LKD+++RE  ++   A+  +  G+Y
Sbjct: 418 VAFGAGATLVITAAYTLWLYKRVFFGEVANTHVAALKDINIREASVLVLFAIGVLVLGLY 477

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 478 PKPLID 483


>gi|44888246|sp|P93313|NU4M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
          Length = 495

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 323/483 (66%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDSSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+F E+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFPESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++ ++  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILFQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKFGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSPNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFSFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGLVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|118340557|gb|ABK80607.1| putative NADH:ubiquinone oxidoreductase subunit M [uncultured
           marine Nitrospinaceae bacterium]
          Length = 533

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/489 (44%), Positives = 333/489 (68%), Gaps = 10/489 (2%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           FL+ +TFLPFLG   + F         +    AL ++  +F+ SL +W+ FD      Q 
Sbjct: 2   FLTFITFLPFLGAVCLAFMPKENVS--AIKQTALAVAVADFLLSLLLWTNFDNTTHKMQF 59

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
                WI+ +  +YH+G+DGIS+LL V+TTFLT  C+++SW  ++++ REYMIA L L +
Sbjct: 60  GLNIPWIEQWGINYHIGLDGISLLLYVMTTFLTMICVIASW-DVKKHIREYMIAMLSLST 118

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
            ++G F++LD+ +FY+F+E  L+PM++I+GVWGG  RIYA+ KFFL+T  GS+ ML AI+
Sbjct: 119 GMLGVFIALDLFMFYVFWEFQLVPMYIIVGVWGGPRRIYASIKFFLFTAVGSLLMLVAIL 178

Query: 184 VMCWE-KKTSSIID---LYAMSKFPFSIQ--YWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            + +  ++T+ +     LY       S+    W+W+AFF +FAIK+PMFPFHTWLP+AHV
Sbjct: 179 WIYFHIQQTTGVATADILYITEHLDVSLDASKWLWLAFFLAFAIKVPMFPFHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMG YG +RF LP FP AS  F P++ +LS+I IIY +LV+MVQ 
Sbjct: 239 EAPTAGSVILAGVLLKMGTYGFLRFNLPFFPQASYEFVPIVAWLSIIGIIYGALVAMVQE 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSS++H+G++ +GIF+    G++GA+ Q ++HG+ +SALF  VG++YDR HTR
Sbjct: 299 DLKKLVAYSSVSHLGFIMLGIFALNPYGIQGALIQNINHGISTSALFLLVGIVYDRRHTR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  +GGL   MP+Y V  M+  ++++GLPG +GF+GEFLV++ +FQ +   A  A+ GV
Sbjct: 359 LISEFGGLAKIMPKYTVCFMIVALSSIGLPGMNGFVGEFLVLLGIFQVNGLWAACATSGV 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L+A Y LW++++V+F   K  K   +KD++ RE   + P+ VL  + G+YP     TF 
Sbjct: 419 ILAACYILWMFQRVMFLELKNPKNMDMKDMNTREMITIAPLIVLIFWIGLYPNTFMKTFD 478

Query: 478 VPLSSIIEN 486
             ++ ++  
Sbjct: 479 ASVNHLVSK 487


>gi|187923352|ref|YP_001894994.1| NADH dehydrogenase subunit M [Burkholderia phytofirmans PsJN]
 gi|187714546|gb|ACD15770.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia phytofirmans PsJN]
          Length = 496

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/485 (47%), Positives = 337/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LSI  +LP L G+ V+   S        +  +AL  S ++F+ ++ + + FD   +  
Sbjct: 5   PILSIAIWLPILVGLLVLAIGSDQNPAPARW--IALIGSVVSFLVTIPLITGFDSSTADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI+ F  +YHLGVDGIS+  VVLT  +T   ++++W+ I +   +Y+ AFL+L
Sbjct: 63  QFVEKANWIERFNITYHLGVDGISMWFVVLTALITVIVVIAAWEVITKKVGQYLAAFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F S D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSSADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LLYLYIQTGTFDLAT-WQHAQIAMTPQVLIFIAFFMAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APVI  LSLIA+IY  LV+MVQTD+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFVRFSLPIAPDASHFLAPVIVTLSLIAVIYIGLVAMVQTDMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAGGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG      V+ L D++ RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAIANNHVKGLLDINRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLAH 486


>gi|170729501|ref|YP_001774934.1| NADH dehydrogenase subunit M [Xylella fastidiosa M12]
 gi|167964294|gb|ACA11304.1| NADH dehydrogenase (quinone) [Xylella fastidiosa M12]
          Length = 501

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 324/486 (66%), Gaps = 18/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +I+        R +   VAL      F FSL +   +D  + +
Sbjct: 3   NWPLLSVLIWLPIIGGLLIMGLRNAHVARWAALAVALA----TFGFSLHLLGGYDIAKDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ LV+LTT +T   ++ SW +I +   +Y+ AFL+
Sbjct: 59  LQFVEQHVWIQTYSIGYNLGVDGIAVALVLLTTLVTVLVLIGSWGAINQRVPQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + IG F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAIKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYAM +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYAM-QLSAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA V+  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLIAVIYVGLVALVQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+GIF               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLIAYSSIAHMGFVTLGIFISFTLARDFGNTDAARLGLQGAMVQMISHGFVSGAMFTCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRLHTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 358 VLYDRLHTRRIADYGGVVNVMPWFATFAMLFYMANAGLPGTSGFVGEFMVILASFQKHPL 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V  LKD+++RE  ++   A+  +  G+Y
Sbjct: 418 VAFGAGATLVITAAYTLWLYKRVFFGEVANTHVAALKDINIREASILVLFAIGVLVLGLY 477

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 478 PKPLID 483


>gi|71897866|ref|ZP_00680092.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Ann-1]
 gi|71732421|gb|EAO34475.1| Proton-translocating NADH-quinone oxidoreductase, chain M [Xylella
           fastidiosa Ann-1]
          Length = 501

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 324/486 (66%), Gaps = 18/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +I+        R +   VAL      F FSL +   +D  + +
Sbjct: 3   NWPLLSVLIWLPIIGGLLIMGLRNAHVARWAALAVALA----TFGFSLHLLGGYDIAKDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ LV+LTT +T   ++ SW +I +   +Y+ AFL+
Sbjct: 59  LQFVEQHVWIQTYSIGYNLGVDGIAVALVLLTTLVTVLVLIGSWGAINQRVPQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + IG F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAIKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYAM +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYAM-QLSAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA V+  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLIAVIYVGLVALVQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+GIF               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLIAYSSIAHMGFVTLGIFIAFTLARDFGNTDAARLGLQGAMVQMISHGFVSGAMFTCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRLHTR I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 358 VLYDRLHTRRIADYGGVVNVMPWFATFAMLFYMANAGLPGTSGFVGEFMVILASFQKHPL 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V  LKD+++RE  ++   A+  +  G+Y
Sbjct: 418 VAFGAGATLVITAAYTLWLYKRVFFGEVANTHVAALKDINIREASVLVLFAIGVLVLGLY 477

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 478 PKPLID 483


>gi|33597899|ref|NP_885542.1| NADH dehydrogenase subunit M [Bordetella parapertussis 12822]
 gi|33602804|ref|NP_890364.1| NADH dehydrogenase subunit M [Bordetella bronchiseptica RB50]
 gi|33574328|emb|CAE38664.1| NADH-ubiquinone oxidoreductase, chain M [Bordetella parapertussis]
 gi|33577246|emb|CAE35803.1| NADH-ubiquinone oxidoreductase, chain M [Bordetella bronchiseptica
           RB50]
          Length = 500

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/490 (45%), Positives = 330/490 (67%), Gaps = 10/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDK 57
           N P+L++  F+P   VF +L    L  GR    G+  G+S I     F+ ++ +++ FD 
Sbjct: 10  NFPWLTLAIFVPI--VFGLLV---LALGRDDRPGLTRGLSLIGALAGFLVTIPLYTGFDA 64

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
           G +  Q +E   WI+ F  +YHLG+DGIS+  V+LT F+T   + + W+ I     +YM 
Sbjct: 65  GTAQMQFVEKASWIEAFNVNYHLGIDGISLWFVLLTAFITIIVVGAGWQVITSRVAQYMA 124

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 125 AFLILSGLMVGVFAALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSL 184

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
             L A V +      S  I  +  +K  ++ Q  +++A   +FA+K+PM+P HTWLP+AH
Sbjct: 185 LTLVAFVYLWNVSGGSFDIQTWHQTKLGYTPQVLIFVALLAAFAVKVPMWPVHTWLPDAH 244

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ
Sbjct: 245 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHGLAGLMIALSLIAVIYIGLVAIVQ 304

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS+AHMG+VT+G F    +G+EGA+ QM+SHG VS A+F C+GV+YDR+H+
Sbjct: 305 DDMKKLVAYSSVAHMGFVTLGFFIFNTAGLEGAIVQMISHGFVSGAMFLCIGVLYDRMHS 364

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MPR+    ++F+MAN GLP TSGF+GEFLVIM   + +  + +L +  
Sbjct: 365 RRIADYGGVVNVMPRFVTFFVLFSMANSGLPATSGFVGEFLVIMGAVEYNFWIGLLTATA 424

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A YSLW+ ++V FG    ++V+++ DLS RE  ++  +A+  +F GIYP P  D  
Sbjct: 425 LILGASYSLWMLKRVAFGDIGNDRVREMTDLSGREFLILGVMAIAVLFMGIYPKPFTDVM 484

Query: 477 SVPLSSIIEN 486
            V + +++++
Sbjct: 485 HVSVEALLQH 494


>gi|255067303|ref|ZP_05319158.1| NADH dehydrogenase, M subunit [Neisseria sicca ATCC 29256]
 gi|255048454|gb|EET43918.1| NADH dehydrogenase, M subunit [Neisseria sicca ATCC 29256]
          Length = 498

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/432 (49%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L V+L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLRINYSLGVDGISVLFVILNAFITLMVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D LLFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFSARDALLFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML AIV + ++    SI D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAIVYLSYQAGGFSIEDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P AS+YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPILPDASRYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA++Y  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVVYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFINGQLNDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFAMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V  +KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAALTLIYGASYTLWMYKRVIFGAVGNPHVADMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|313672290|ref|YP_004050401.1| NADH dehydrogenase subunit m [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939046|gb|ADR18238.1| NADH dehydrogenase subunit M [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 498

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 338/490 (68%), Gaps = 14/490 (2%)

Query: 6   LSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LSI+ F P +  VF+++FS     G+ + +   +  S I FI ++ + + FDKG +  Q 
Sbjct: 5   LSILIFFPVVAAVFIMIFSK---SGKFAMWSAFIA-SVIEFILTIPLMTNFDKGSAGMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E Y+WI      Y+LGVDGISIL+V LTTFL+   IL S+  IQ+  +E+ ++ LVLE+
Sbjct: 61  VERYYWIRSLNIDYYLGVDGISILMVFLTTFLSAIAILGSFTYIQKRQKEFYVSMLVLEA 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
            ++G F +LD  LFYIF+EA LIPM++IIGVWGG  RIYAA KFFLYT  GS+FM+ AI+
Sbjct: 121 AMVGVFCALDFFLFYIFWEAMLIPMYLIIGVWGGQRRIYAAVKFFLYTLAGSVFMMLAII 180

Query: 184 VMCWE------KKTSSIIDLYAM-SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            + ++      + T  I+ + AM ++FP   Q  +++AFF  FAIK+PMFPFHTWLP+AH
Sbjct: 181 ALYFKYGSMTGEYTFDILKISAMGAQFPLGFQIIVFLAFFFGFAIKVPMFPFHTWLPDAH 240

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APTAGSV LAG++LKMG YG +RF LP+ P+AS  F P++  LS+IAIIY  LV+MVQ
Sbjct: 241 VEAPTAGSVILAGVLLKMGTYGFLRFCLPITPIASIKFVPLVAILSVIAIIYGGLVAMVQ 300

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS++HMG+VT+GI++  +SG+EG + QM +HG+++ ALF  +G+IY+R HT
Sbjct: 301 EDVKKLVAYSSVSHMGFVTLGIYAFNQSGIEGGILQMFNHGIITGALFLLIGLIYERTHT 360

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+   +P YA V ++FTMA++ LP   GFIGEFLV++  F+   T A LA+ G
Sbjct: 361 RLIADYGGIAAKVPVYATVFLIFTMASVALPSMGGFIGEFLVLVGAFKAFPTYAGLAALG 420

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           V++SA+Y LW+Y++V F  S    +  L D+++RE   + P+ ++  + G+YP       
Sbjct: 421 VIVSAVYMLWMYQRVFFQ-SVNPNLHHLDDMTVREVFYMIPLIIVVFWTGMYPETFTSYM 479

Query: 477 SVPLSSIIEN 486
              + +++E 
Sbjct: 480 HESVKALVEQ 489


>gi|225024107|ref|ZP_03713299.1| hypothetical protein EIKCOROL_00975 [Eikenella corrodens ATCC
           23834]
 gi|224943132|gb|EEG24341.1| hypothetical protein EIKCOROL_00975 [Eikenella corrodens ATCC
           23834]
          Length = 500

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 320/476 (67%), Gaps = 13/476 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSFQ 63
           LS+  +LP     ++L +   GC RR+     L    +   F+ +L +++ FD+    FQ
Sbjct: 7   LSLAIWLPIAAGLLVLAT---GCDRRAPLARILAFVGALAGFLVTLPLFTQFDRLSGGFQ 63

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E+Y WI     +Y LGVDGIS+L V+L  F+T   +L+ W+ IQ+   +YM AFL++ 
Sbjct: 64  FAEFYAWIPALNINYALGVDGISVLFVILNAFITLMVVLAGWEVIQKKVAQYMAAFLIMS 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ GAF++ D +LFYIFFE  LIP+++IIGVWGG  R+YA+ K FLYT  GS+ ML A+
Sbjct: 124 GLINGAFVARDAMLFYIFFEGMLIPLYLIIGVWGGPRRVYASVKLFLYTLMGSLLMLVAL 183

Query: 183 VVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           V +  +   S +I D   + + P   Q  ++ AFF SFA+K+PMFP HTWLP+AHV+APT
Sbjct: 184 VYLSLQTGGSFAIEDFQNIKQIPLFTQQILFAAFFLSFAVKVPMFPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GS+ LA I LK+G YG +RF+LP+ P AS+YFAP I  LSLIA+IY  +V++ QTD+KK
Sbjct: 244 GGSMVLAAITLKLGAYGFLRFILPILPDASRYFAPAIIVLSLIAVIYIGMVALAQTDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKS------GVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           L+AYSSI+HMG+VT+G+F            ++GA+ QM+SHG VS+A+FFC+GV+YDRLH
Sbjct: 304 LVAYSSISHMGFVTLGMFLFTNQVQLQPWALKGAIMQMISHGFVSAAMFFCIGVMYDRLH 363

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           +R+I  YGG+V  MP++A  MM+F MAN GLP TSGF+GEF+VIM     +  V  LA+ 
Sbjct: 364 SRNIADYGGVVTVMPKFAAFMMLFAMANAGLPATSGFVGEFMVIMGAVNYNLFVGALAAL 423

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
            ++L A Y+LW+Y++V+FG      V ++KD++ RE  ++  +A   +  G++P P
Sbjct: 424 TLILGAAYTLWMYKRVIFGTVTNPHVAEMKDINRREFAILAILAATVLGMGLWPEP 479


>gi|170696387|ref|ZP_02887516.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia graminis C4D1M]
 gi|170138715|gb|EDT06914.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Burkholderia graminis C4D1M]
          Length = 496

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 338/485 (69%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS+  +LP L G+ V+   S    G   +  VAL  S ++FI ++ + + FD   +  
Sbjct: 5   PILSLAIWLPILCGLLVLAIGSDRNPGPARW--VALIGSIVSFIVTIPLITGFDSSSADL 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E  +WI+ F  +YHLGVDGIS+  VVLT  +T   +++ W+ I +N  +Y+ +FL+L
Sbjct: 63  QFVEQANWIERFNITYHLGVDGISMWFVVLTALITVIVVIAGWEVITKNVGQYLASFLIL 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F + D +LFY+FFEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A
Sbjct: 123 SGIMVGVFSAADGMLFYVFFEATLIPMYIIIGVWGGANRVYAAFKFFLYTLMGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  T  +   +  ++   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 LLYLYVQTGTFDLAT-WQHAQIAMTPQVLLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS + APV+  LSLIA+IY  LV+MVQ D+KK
Sbjct: 242 GGSVVLAAIMLKLGAYGFLRFSLPIAPDASHFLAPVVITLSLIAVIYIGLVAMVQADMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + GVEGA+ QM+SHG VS A+F  +GV+YDR+H+R I  
Sbjct: 302 LVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVSGAMFLSIGVLYDRMHSRQIAD 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A  +M+F+MAN GLPGTSGF+GEF+VI++  Q +  +A  A+  ++L A
Sbjct: 362 YGGVVNVMPKFAAFVMLFSMANCGLPGTSGFVGEFMVILAAVQYNFWIAGGAAVTLILGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y++V FG    + V+ L D++ RE  M+  +A LT+F G+YP P  D   V + 
Sbjct: 422 AYTLWMYKRVYFGAVANDHVKGLFDINRREFFMLAVLAALTLFMGLYPKPFTDVMHVSVE 481

Query: 482 SIIEN 486
           +++ +
Sbjct: 482 NLLSH 486


>gi|91203932|emb|CAJ71585.1| similar to NADH:ubiquinone oxidoreductase subunit M [Candidatus
           Kuenenia stuttgartiensis]
          Length = 525

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/495 (45%), Positives = 345/495 (69%), Gaps = 11/495 (2%)

Query: 3   LPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           +P L+++TFLP +GV +IL  S+    +      +L +S + F+ S+ ++  FD      
Sbjct: 1   MPILTLITFLPIVGVLLIL--SFDSRHKELIRVTSLLVSVVTFLISVPLYFAFDANTYDM 58

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI  F  SYHLG+DGIS+ +V+LTTF+TP  I +SW +++ N +EYMIA LVL
Sbjct: 59  QFVEKLRWIPSFGVSYHLGIDGISLFMVLLTTFITPIAIFASW-NVKRNVKEYMIAMLVL 117

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E+ ++G F+SLD+ LFY+F+E  LIPM++IIG+WGG  RIYAA KFF+YT  GS+FML A
Sbjct: 118 ETGMVGVFVSLDVFLFYVFWELMLIPMYLIIGIWGGQRRIYAAIKFFVYTMAGSVFMLLA 177

Query: 182 IVVM------CWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           I+ +         + T ++++ Y +    +++Q+W+++AFF +FAIK+PMFP HTWLP+A
Sbjct: 178 IIGLFFLNHKATGEYTFNLLEFYRLD-ISYAVQFWLFLAFFLAFAIKVPMFPLHTWLPDA 236

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APTAGSV LAG++LKMG YG IRF LPLFP  S  F PVI +++++ IIY +LV+MV
Sbjct: 237 HVEAPTAGSVILAGVLLKMGTYGFIRFCLPLFPEVSHSFIPVISWMAIVGIIYGALVAMV 296

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KKL+AYSS++H+G+V +GIF+    G+EG + QM++HGL + ALF  VG++YDR H
Sbjct: 297 QDDLKKLVAYSSVSHLGFVMLGIFAFNIQGIEGGITQMINHGLSTGALFLIVGMLYDRRH 356

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           TR I  YGGL   +P +A++ M+ T +++GLPG +GF+GEFL+++ VF++    A +A+ 
Sbjct: 357 TRLISDYGGLTKQIPVFAILFMIVTFSSIGLPGLNGFVGEFLILVGVFKSRILYASIATS 416

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           G++L+A+Y LW++++V+F     E+ + LKD+S RE  ++ PI ++  + GIYP      
Sbjct: 417 GIILAAIYMLWMFQRVMFHNITHEENKTLKDVSSRELAIMIPIVLMIFWIGIYPNSFLRK 476

Query: 476 FSVPLSSIIENYTLK 490
               +  ++E    K
Sbjct: 477 MDSSVKHLLEQVERK 491


>gi|110225712|ref|YP_665717.1| NADH dehydrogenase subunit 4 [Mesostigma viride]
 gi|17222583|gb|AAL36756.1|AF353999_36 NADH dehydrogenase subunit 4 [Mesostigma viride]
          Length = 484

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 239/491 (48%), Positives = 330/491 (67%), Gaps = 16/491 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGV-ALGISTINFIFSLFVWSVFDKGR 59
           MN   L  V   P LG    +F S++   +  +  + A   S I ++ SLF+W  F    
Sbjct: 1   MNSKLLLFVWLFPILGA---IFLSFIPESKIRWIRLGAFWFSCITWLVSLFLWVGFQNLT 57

Query: 60  SSFQMIEYYHWIDYFC-SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           + FQ ++    ID F  ++ +GVDGIS+  ++LTTFL P C+L SW +I    + Y IAF
Sbjct: 58  ADFQFLQK---IDIFPFTFFVGVDGISLFFILLTTFLIPVCLLVSWSNIHHYRKAYFIAF 114

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIF 177
           L +ES++I  F  LD+LLFYIFFE+ LIPMF+IIGVWG  ER I AAY+FF+YT FGS+F
Sbjct: 115 LAMESLLISVFCLLDLLLFYIFFESVLIPMFLIIGVWGSRERKIRAAYQFFIYTLFGSVF 174

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML  I+ + +E  T+  + L   ++    +Q   W+AFF SFA+K+PM P H WLP AHV
Sbjct: 175 MLLGILFLHFEIGTTDFLVLQT-TEISEKVQLICWLAFFASFAVKVPMVPVHIWLPEAHV 233

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAGI+LK+G YG +RF + LFP+AS YF P+++ +S+IAI+Y SL ++ Q 
Sbjct: 234 EAPTAGSVLLAGILLKLGTYGLLRFSITLFPMASIYFTPLVYTMSVIAILYTSLTTLRQI 293

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KK+IAYSS+AHM +VTIG+FS    G+EG++F MLSHGLVSSALF CVGV+Y+R  TR
Sbjct: 294 DLKKIIAYSSVAHMNFVTIGLFSQNVQGIEGSIFLMLSHGLVSSALFLCVGVLYERHKTR 353

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            +  YGG VH MP +A+  ++FT+A +  PGTS F+GEFL+++  FQN+ + A+LAS G+
Sbjct: 354 LLKYYGGSVHTMPLFAIFFLIFTLAGLSFPGTSSFVGEFLILVGAFQNNISTAILASIGM 413

Query: 418 VLSALYSLWLYRKVVFGVSKCE--KVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           VL A YS+WLY +VVFG  K    K  Q  DL+ RE  ++ P  +  +F GIYP    D 
Sbjct: 414 VLGAAYSIWLYNRVVFGNLKSHYSKTFQWSDLNRREVAIMTPFVIGIIFMGIYP----DI 469

Query: 476 FSVPLSSIIEN 486
           F  P+ + + +
Sbjct: 470 FLNPMHASVSH 480


>gi|254805700|ref|YP_003083921.1| nuoM; NADH dehydrogenase I chain M [Neisseria meningitidis alpha14]
 gi|254669242|emb|CBA08106.1| nuoM; NADH dehydrogenase I chain M [Neisseria meningitidis alpha14]
          Length = 498

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA IMLK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAIMLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFTILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|238023179|ref|ZP_04603605.1| hypothetical protein GCWU000324_03105 [Kingella oralis ATCC 51147]
 gi|237865562|gb|EEP66702.1| hypothetical protein GCWU000324_03105 [Kingella oralis ATCC 51147]
          Length = 500

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/477 (45%), Positives = 326/477 (68%), Gaps = 13/477 (2%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSF 62
            LS+  +LP L   ++L +   G   ++     L +  +  +F+ +L +++ FD+    +
Sbjct: 6   LLSLAIWLPILAGVLVLAT---GSDEKAPLARILALVGAAASFVITLPLFTQFDRASGGY 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E + WI     +Y LGVDGIS+L ++L  F+T   +L+ W+ IQ+   +YM AFL++
Sbjct: 63  QFTELHAWIPALNLNYALGVDGISVLFIILNAFITLMVVLAGWEVIQKRPAQYMAAFLIM 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++ GAF + D +LFY FFE  LIP+++IIG+WGG  R+YAA K FLYT  GS+ ML A
Sbjct: 123 SGLINGAFAAQDAILFYTFFEGMLIPLYLIIGMWGGQRRMYAAMKLFLYTLLGSLLMLVA 182

Query: 182 IVVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           ++ + ++   S +I DL A+   P  +Q  ++IAFF SFA+K+PMFP HTWLP+AHV+AP
Sbjct: 183 LIYLSYQAGGSFAIADLQAIKNIPLGVQQLLFIAFFLSFAVKVPMFPVHTWLPDAHVEAP 242

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GS+ LA I LK+G YG +RF+LP+ P AS+YFAPV+  LSLIA++Y  LV++VQTD+K
Sbjct: 243 TGGSMVLAAITLKVGAYGFLRFILPILPDASRYFAPVVIVLSLIAVVYIGLVALVQTDMK 302

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGV------EGAMFQMLSHGLVSSALFFCVGVIYDRL 354
           KL+AYSSI+HMG+VT+G F  M++G       +GA+ QM+SHG VS+A+F C+GV+YDRL
Sbjct: 303 KLVAYSSISHMGFVTLGFFLFMQNGQPESWAFKGAIMQMISHGFVSAAMFMCIGVMYDRL 362

Query: 355 HTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLAS 414
           HTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM     S  +  +A+
Sbjct: 363 HTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGATHYSLWIGAIAA 422

Query: 415 FGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
             ++  A Y+LW+Y++V+FG      V+++KD++ RE  ++  +AV  +  G+ P P
Sbjct: 423 TTLIWGASYTLWMYKRVIFGDILHPAVKEMKDINAREFVILAILAVAVLGMGLLPEP 479


>gi|332968219|gb|EGK07296.1| NADH-quinone oxidoreductase subunit M [Kingella kingae ATCC 23330]
          Length = 505

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/480 (45%), Positives = 328/480 (68%), Gaps = 18/480 (3%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSF 62
            LS+  ++P L   ++L +   G   R+     L +  +   F+ +L +++ FD+  + +
Sbjct: 6   LLSLAIWVPILAGVLVLAT---GTDSRAPLARILALIGAVAGFLVTLPLFTHFDRANAGY 62

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E + WI     +Y LGVDGIS+L V+L  F+T   +L+ W+ IQ+   +YM AFL++
Sbjct: 63  QFTELHAWIPALNLNYALGVDGISVLFVILNAFITLMVVLAGWEVIQKRPAQYMAAFLIM 122

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             ++ GAF + D +LFY+FFEA LIP+++I+G+WGG  R+YAA K FLYT  GS+ ML A
Sbjct: 123 SGLINGAFAAQDAILFYVFFEAMLIPLYLIVGMWGGPRRVYAAMKLFLYTLLGSLLMLVA 182

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ +  +  + +I DL  + + P  +Q  ++IAFF SFA+K+PMFP HTWLP+AHV+APT
Sbjct: 183 LIYLGAQANSFAITDLQNLKQIPMGVQQLVFIAFFLSFAVKVPMFPVHTWLPDAHVEAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GS+ LA I LK+G YG +RF+LP+ P AS+YFAPVI  LSLIA+IY  +V++VQTD+KK
Sbjct: 243 GGSMVLAAITLKIGAYGFLRFVLPIVPDASRYFAPVIIVLSLIAVIYIGMVALVQTDMKK 302

Query: 302 LIAYSSIAHMGYVTIGI--FSGMKS----------GVEGAMFQMLSHGLVSSALFFCVGV 349
           L+AYSSI+HMG+VT+GI  FSG+ S          G++GA+ QM+SHG VS+A+F C+GV
Sbjct: 303 LVAYSSISHMGFVTLGIFLFSGLFSGNPLGELNAWGLKGAIIQMISHGFVSAAMFMCIGV 362

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM   + +  +
Sbjct: 363 MYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGAVEVNLWI 422

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
             LA+  ++  A Y+LW+Y++ +FG      V ++KD++ RE  ++  +A   +  G+YP
Sbjct: 423 GALAALTLIYGASYTLWMYKRTIFGEVTNPHVAEMKDINCREFAILAILAAAVLGMGLYP 482


>gi|289665185|ref|ZP_06486766.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 491

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 317/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F  SL +   +D    + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVIALSLIAVIYVGLVALVQEDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVRDYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFSMLFFMANAGLPGTSGFVGEFMVILASFQKHPLVAFAAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLYPKPLTD 473


>gi|261378527|ref|ZP_05983100.1| NADH dehydrogenase, M subunit [Neisseria cinerea ATCC 14685]
 gi|269145077|gb|EEZ71495.1| NADH dehydrogenase, M subunit [Neisseria cinerea ATCC 14685]
          Length = 498

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+  S +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSSGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|289667367|ref|ZP_06488442.1| NADH dehydrogenase subunit M [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 491

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 317/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F  SL +   +D    + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVIALSLIAVIYVGLVALVQEDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVRDYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFSMLFFMANSGLPGTSGFVGEFMVILASFQKHPLVAFAAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLYPKPLTD 473


>gi|294624666|ref|ZP_06703336.1| NADH dehydrogenase subunit M [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601022|gb|EFF45089.1| NADH dehydrogenase subunit M [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 477

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/451 (49%), Positives = 307/451 (68%), Gaps = 15/451 (3%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFL 95
           +L ++   F  SL +   +D    + Q IE + WI  Y   Y+LGVDGI++ L+VLTT +
Sbjct: 11  SLAVAVATFALSLPLLG-YDTANDAMQFIELHAWIPAYNIGYNLGVDGIAVALIVLTTLV 69

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
           T   ++ +W+SI +   +Y+ AFL+LE + +G F + D +LFY+FFEA LIPMF+IIGVW
Sbjct: 70  TVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVW 129

Query: 156 GGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAF 215
           GG  RIYAA KFFLYTF GS+ ML  +V +  +  +  + DLYA+ +     Q W++ AF
Sbjct: 130 GGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKGGSFQLADLYAL-QLTAKEQTWIFFAF 188

Query: 216 FCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFA 275
             +FA+K+PMFP HTWLP+AHV+APTAGSV LA I LK+GGYG +RF LP+ P AS  FA
Sbjct: 189 LIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFA 248

Query: 276 PVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF------------SGMK 323
            ++  LSLIA+IY  LV++VQ D+KKL+AYSSIAHMG+VT+G F               +
Sbjct: 249 WLVITLSLIAVIYVGLVALVQDDMKKLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAAR 308

Query: 324 SGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMAN 383
            G++GAM QM+SHG VS A+F C+GV+YDR+HTR I  YGG+V+ MP +A   M+F MAN
Sbjct: 309 LGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTRRIADYGGVVNVMPWFATFSMLFFMAN 368

Query: 384 MGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQ 443
            GLPGTSGF+GEF+VI++ FQ    VA  A+  +V++A Y+LWLY++V FG      V +
Sbjct: 369 AGLPGTSGFVGEFMVILASFQKHPLVAFAAATTLVITAAYTLWLYKRVFFGEVANAHVAE 428

Query: 444 LKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 429 LKDINGREAFVLGVFAAGVLALGLYPKPLTD 459


>gi|325921399|ref|ZP_08183256.1| NADH dehydrogenase subunit M [Xanthomonas gardneri ATCC 19865]
 gi|325548157|gb|EGD19154.1| NADH dehydrogenase subunit M [Xanthomonas gardneri ATCC 19865]
          Length = 491

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/477 (47%), Positives = 318/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F+ SL +   +D    + Q +E + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFVLSLPLLG-YDTANDALQFVELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTLGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVITLSLIAVIYVGLVALVQDDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVRDYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    +A  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILASFQKHPLIAFGAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLYPKPLTD 473


>gi|317402000|gb|EFV82600.1| NADH-ubiquinone oxidoreductase [Achromobacter xylosoxidans C54]
          Length = 495

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/488 (45%), Positives = 332/488 (68%), Gaps = 10/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDKGR 59
           P+L++  F+P   VF +L    L  GR    G+  G+S I     F+ ++ +++ FD   
Sbjct: 7   PWLTLAIFVPI--VFGLLV---LAVGRDDRPGLTRGLSLIGSIAGFLVTIPLYTGFDSKT 61

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLGVDGIS+  V+LT F+T   +L+ W+ I     +YM AF
Sbjct: 62  AAMQFVEKTSWIEAFNVNYHLGVDGISLWFVLLTAFITIIVVLAGWEVITSRVSQYMAAF 121

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  
Sbjct: 122 LILSGLMVGVFCALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLMGSLLT 181

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A V +      S  I  +  +K  ++ Q  +++A   +FA+K+PM+P HTWLP+AHV+
Sbjct: 182 LVAFVYLWNASGGSFDILTWQQTKLGYTPQILIFVALLAAFAVKVPMWPVHTWLPDAHVE 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GS+ LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ D
Sbjct: 242 APTGGSIVLAAIMLKLGAYGFLRFSLPIAPDASHSLAGLMITLSLIAVIYIGLVAIVQDD 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AHMG+VT+G F    +GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 302 MKKLVAYSSVAHMGFVTLGFFIFNTAGVEGAIVQMISHGFVSGAMFMCIGVLYDRMHSRR 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MPR+A   ++F+MAN GLP TSGF+GEF+VIM   +++  + +LA+  ++
Sbjct: 362 IADYGGVVNVMPRFATFFILFSMANSGLPATSGFVGEFMVIMGAVEHNFWIGLLAATALI 421

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A YSLW+ ++VV G    + V++L D++ RE  ++  +A+  ++ GI+P P  D   V
Sbjct: 422 LGASYSLWMVKRVVLGDVANDHVRELTDINRREFVILGVMAIAVLYMGIHPKPFTDVMHV 481

Query: 479 PLSSIIEN 486
            + +++++
Sbjct: 482 SVEALLQH 489


>gi|241760716|ref|ZP_04758808.1| NADH dehydrogenase subunit M [Neisseria flavescens SK114]
 gi|241318897|gb|EER55423.1| NADH dehydrogenase subunit M [Neisseria flavescens SK114]
          Length = 498

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTQFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|188577684|ref|YP_001914613.1| NADH dehydrogenase subunit M [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188522136|gb|ACD60081.1| NADH-ubiquinone oxidoreductase Nqo13 subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 491

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/477 (48%), Positives = 316/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F  SL +   +D    + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGVDGI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVDGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLSAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVIALSLIAVIYVGLVALVQDDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A   +
Sbjct: 357 RIADYGGVVNVMPWFATFAMLFFMANAGLPGTSGFVGEFMVILASFQKHPLVAFAAGTTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLAMGLYPKPLTD 473


>gi|163855999|ref|YP_001630297.1| NADH dehydrogenase subunit M [Bordetella petrii DSM 12804]
 gi|163259727|emb|CAP42028.1| NADH-ubiquinone oxidoreductase, chain M [Bordetella petrii]
          Length = 500

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/488 (44%), Positives = 330/488 (67%), Gaps = 10/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDKGR 59
           P+L++  F+P   VF +L    L  GR    G+  G+S +     F+ ++ +++ FD   
Sbjct: 12  PWLTLAIFVPI--VFGLLV---LALGRDDRPGLTRGLSLVGALAGFVVTIPLYTGFDAST 66

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLG+DGIS+  V+LT F+T   +L+ W+ I     +YM AF
Sbjct: 67  AAMQFVEKASWIEAFNVNYHLGIDGISLWFVLLTAFITIIVVLAGWEVITSRVAQYMAAF 126

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  
Sbjct: 127 LILSGLMVGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLT 186

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A + +      S  I  +   K  ++ Q  +++A   +FA+K+PM+P HTWLP+AHV+
Sbjct: 187 LVAFIYLWNASGGSFDIQTWHQVKLGYTPQVLIFVALLAAFAVKVPMWPVHTWLPDAHVE 246

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ D
Sbjct: 247 APTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAGLMIALSLIAVIYIGLVAIVQDD 306

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AHMG+VT+G F    +GVEGA+ QM+SHG VS A+FFC+GV+YDR+H+R 
Sbjct: 307 MKKLVAYSSVAHMGFVTLGFFIFNTAGVEGAIVQMISHGFVSGAMFFCIGVLYDRMHSRR 366

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+++ MPR+    ++F+MAN GLP TSGF+GEF+VIM   +++  + +LA+  ++
Sbjct: 367 IADYGGVINVMPRFVTFFVLFSMANSGLPATSGFVGEFMVIMGAVEHNFWIGLLAATALI 426

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A YSLW+ ++V FG    + V++L D++ RE  ++  +A+  ++ GIYP P  D    
Sbjct: 427 LGASYSLWMVKRVAFGDIANDHVRELSDVNRREFLILGVMAIAVLYMGIYPKPFTDVMHA 486

Query: 479 PLSSIIEN 486
            + +++++
Sbjct: 487 SVQALLQH 494


>gi|309379788|emb|CBX21564.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 498

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIVPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG  +   V ++KD++ RE  ++  
Sbjct: 404 VIMGTVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIRNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +A+  +  G+YP
Sbjct: 464 LAIAVLGMGLYP 475


>gi|296040775|gb|ADG85355.1| NADH dehydrogenase subunit 4 [Silene noctiflora]
          Length = 495

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 329/484 (67%), Gaps = 7/484 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGR-RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS +   P LG  ++LF   L   R R    + L  S I F++S+ +W  FD   + FQ 
Sbjct: 12  LSGLLLCPVLGSMILLF---LPNSRIRLIRLIGLSASLITFLYSILLWIQFDPSTAKFQF 68

Query: 65  IEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W +I+   +EY+IAFL+ E 
Sbjct: 69  VESIRWLPYENINFYLGIDGISLFFVLLTTFLIPICILVGWANIRSYGKEYIIAFLICEF 128

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAI 182
           ++I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML  I
Sbjct: 129 LMIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLGI 188

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           +++  E  T+ +  L + ++F    Q ++W+AFF SFA+K+PM P H WLP AHV+APTA
Sbjct: 189 LLILLETGTTDLQILLS-TEFSERRQLFLWLAFFASFAVKVPMVPVHIWLPEAHVEAPTA 247

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+
Sbjct: 248 GSVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKI 307

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHM +VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  Y
Sbjct: 308 IAYSSVAHMNFVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLLRYY 367

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV  MP ++ + + FT+ANM LPGTS F+GEFL+++  FQ ++ VA LA+ G++L A 
Sbjct: 368 GGLVSTMPNFSTIFLFFTLANMSLPGTSSFVGEFLILVGAFQRNSLVATLAAIGMILGAA 427

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           YSLWLY +VV G  K + + +  D++ RE  +  P  +  ++ G+YP    D     +S+
Sbjct: 428 YSLWLYNRVVSGNLKPDFIHKFSDINRRECFIFIPFLLGVLWMGVYPKVFLDCMHTSVSN 487

Query: 483 IIEN 486
           ++++
Sbjct: 488 LVQH 491


>gi|261379566|ref|ZP_05984139.1| NADH dehydrogenase, M subunit [Neisseria subflava NJ9703]
 gi|284798040|gb|EFC53387.1| NADH dehydrogenase, M subunit [Neisseria subflava NJ9703]
          Length = 498

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLHYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|325143097|gb|EGC65444.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           961-5945]
 gi|325143167|gb|EGC65513.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           961-5945]
          Length = 498

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILVI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|33592019|ref|NP_879663.1| NADH dehydrogenase subunit M [Bordetella pertussis Tohama I]
 gi|33571663|emb|CAE41156.1| NADH-ubiquinone oxidoreductase, chain M [Bordetella pertussis
           Tohama I]
 gi|332381435|gb|AEE66282.1| NADH dehydrogenase subunit M [Bordetella pertussis CS]
          Length = 499

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/490 (45%), Positives = 330/490 (67%), Gaps = 10/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDK 57
           N P+L++  F+P   VF +L    L  GR    G+  G+S I     F+ ++ +++ F+ 
Sbjct: 9   NFPWLTLAIFVPI--VFGLLV---LALGRDDRPGLTRGLSLIGALAGFLVTIPLYTGFEA 63

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
           G +  Q +E   WI+ F  +YHLG+DGIS+  V+LT F+T   + + W+ I     +YM 
Sbjct: 64  GTAQMQFVEKASWIEAFNVNYHLGIDGISLWFVLLTAFITIIVVGAGWQVITSRVAQYMA 123

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+
Sbjct: 124 AFLILSGLMVGVFAALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSL 183

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
             L A V +      S  I  +  +K  ++ Q  +++A   +FA+K+PM+P HTWLP+AH
Sbjct: 184 LTLVAFVYLWNVSGGSFDIQTWHQTKLGYTPQVLIFVALLAAFAVKVPMWPVHTWLPDAH 243

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ
Sbjct: 244 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHGLAGLMIALSLIAVIYIGLVAIVQ 303

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS+AHMG+VT+G F    +G+EGA+ QM+SHG VS A+F C+GV+YDR+H+
Sbjct: 304 DDMKKLVAYSSVAHMGFVTLGFFIFNTAGLEGAIVQMISHGFVSGAMFLCIGVLYDRMHS 363

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MPR+    ++F+MAN GLP TSGF+GEFLVIM   + +  + +L +  
Sbjct: 364 RRIADYGGVVNVMPRFVTFFVLFSMANSGLPATSGFVGEFLVIMGAVEYNFWIGLLTATA 423

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A YSLW+ ++V FG    ++V+++ DLS RE  ++  +A+  +F GIYP P  D  
Sbjct: 424 LILGASYSLWMLKRVAFGDIGNDRVREMTDLSGREFLILGVMAIAVLFMGIYPKPFTDVM 483

Query: 477 SVPLSSIIEN 486
            V + +++++
Sbjct: 484 HVSVEALLQH 493


>gi|325135061|gb|EGC57689.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M13399]
          Length = 498

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/472 (45%), Positives = 326/472 (69%), Gaps = 11/472 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSFQ 63
           LS+  ++P     ++L +   G   R+ F   L    +   F+ +L +++ FD+    +Q
Sbjct: 7   LSLAIWIPIAAGVLVLAT---GSDSRAPFARVLAFMGALAGFLVTLPLFTGFDRLSGGYQ 63

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E++ WI     +Y LGVDGIS+L ++L  F+T   +L+ W+ IQ+   +YM AFL++ 
Sbjct: 64  FTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLAGWEVIQKRPAQYMAAFLIMS 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+YA+ K FLYT  GS+ ML A+
Sbjct: 124 GLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVYASVKLFLYTLMGSLLMLVAM 183

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           V + ++  + SI+D   + + P  +Q  +++AFF SFA+K+PMFP HTWLP+AHV+APT 
Sbjct: 184 VYLYYQTGSFSIVDFQNIEQIPLGVQQLLFVAFFLSFAVKVPMFPVHTWLPDAHVEAPTG 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LSLIA+IY  +V++VQTD+KKL
Sbjct: 244 GSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLSLIAVIYIGMVALVQTDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           +AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG VS+A+F C+GV+YDRLHTR
Sbjct: 304 VAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHGFVSAAMFMCIGVMYDRLHTR 363

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM   + +  V  LA+  +
Sbjct: 364 NIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGAVKVNFWVGALAAMTL 423

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           +  A Y+LW+Y++V++G      V ++KD++ RE  ++  +AV+ +  G+YP
Sbjct: 424 IYGASYTLWMYKRVIYGAIHNPHVAEMKDINCREFAILAILAVVVLGMGLYP 475


>gi|261364364|ref|ZP_05977247.1| NADH dehydrogenase, M subunit [Neisseria mucosa ATCC 25996]
 gi|288567630|gb|EFC89190.1| NADH dehydrogenase, M subunit [Neisseria mucosa ATCC 25996]
          Length = 498

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 211/432 (48%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L V+L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLRINYSLGVDGISVLFVILNAFITLMVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D LLFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFSARDALLFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML AIV + ++    +I D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAIVYLSYQVGGFAIEDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P AS+YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPILPDASRYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA++Y  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVVYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFAMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V  +KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAALTLIYGASYTLWMYKRVIFGAVGNPHVADMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|325197542|gb|ADY92998.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           G2136]
          Length = 498

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|298370363|ref|ZP_06981679.1| NADH dehydrogenase (ubiquinone), M subunit [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298281823|gb|EFI23312.1| NADH dehydrogenase (ubiquinone), M subunit [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 498

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 211/432 (48%), Positives = 307/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L V+L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLRINYSLGVDGISVLFVILNAFITLMVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D LLFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFSARDALLFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML AIV + ++    SI D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAIVYLSYQAGGFSIEDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P AS+YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPILPDASRYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA++Y  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVVYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFINGQLNDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+ + MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVANVMPKFAAFMMLFAMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V  +KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAALTLIYGASYTLWMYKRVIFGAVGNPHVADMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|307101734|ref|YP_003875493.1| NADH dehydrogenase subunit 4 [Silene latifolia]
 gi|296040773|gb|ADG85354.1| NADH dehydrogenase subunit 4 [Silene latifolia]
 gi|301338029|gb|ADK73321.1| NADH dehydrogenase subunit 4 [Silene latifolia]
          Length = 495

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 236/483 (48%), Positives = 325/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++  +  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILLQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM +VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNFVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREIFIFIPFLVGVVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|218768959|ref|YP_002343471.1| NADH dehydrogenase subunit M [Neisseria meningitidis Z2491]
 gi|121052967|emb|CAM09321.1| NADH dehydrogenase chain M [Neisseria meningitidis Z2491]
 gi|319411257|emb|CBY91664.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M;
           NDH-1, chain M) [Neisseria meningitidis WUE 2594]
          Length = 498

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNSHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|325129052|gb|EGC51902.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           N1568]
          Length = 498

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|261400486|ref|ZP_05986611.1| NADH dehydrogenase, M subunit [Neisseria lactamica ATCC 23970]
 gi|269209745|gb|EEZ76200.1| NADH dehydrogenase, M subunit [Neisseria lactamica ATCC 23970]
          Length = 498

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFAGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG  +   V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIRNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +A+  +  G+YP
Sbjct: 464 LAIAVLGMGLYP 475


>gi|304389084|ref|ZP_07371128.1| NADH-quinone oxidoreductase subunit M [Neisseria meningitidis ATCC
           13091]
 gi|304336957|gb|EFM03147.1| NADH-quinone oxidoreductase subunit M [Neisseria meningitidis ATCC
           13091]
          Length = 498

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L V+L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFVILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFTILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|311104670|ref|YP_003977523.1| NADH-quinone oxidoreductase subunit M [Achromobacter xylosoxidans
           A8]
 gi|310759359|gb|ADP14808.1| NADH-quinone oxidoreductase subunit M [Achromobacter xylosoxidans
           A8]
          Length = 500

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/488 (45%), Positives = 331/488 (67%), Gaps = 10/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDKGR 59
           P+L++  F+P   VF +L    L  GR    G+  G+S +     F+ ++ +++ FD   
Sbjct: 12  PWLTLAIFVPI--VFGLLV---LAVGRDDRPGLTRGLSLVGAIAGFLVTIPLYTGFDSTT 66

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           +  Q +E   WI+ F  +YHLG+DGIS+  V+LT F+T   +L+ W+ I     +YM AF
Sbjct: 67  AKMQFVEKTSWIEAFNVNYHLGIDGISMWFVLLTAFITIIVVLAGWEVITSRVAQYMAAF 126

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  
Sbjct: 127 LILSGLMVGVFCALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLMGSLLT 186

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A V +      S  I  +  +K  ++ Q  +++A   +FA+K+PM+P HTWLP+AHV+
Sbjct: 187 LVAFVYLWNVSGGSFDILTWQQTKLGYTPQILIFVALLAAFAVKVPMWPVHTWLPDAHVE 246

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GS+ LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV++VQ D
Sbjct: 247 APTGGSIVLAAIMLKLGAYGFLRFSLPIAPDASHSLAGMMITLSLIAVIYIGLVAIVQDD 306

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AHMG+VT+G F    +GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 307 MKKLVAYSSVAHMGFVTLGFFIFNTAGVEGAIVQMISHGFVSGAMFMCIGVLYDRMHSRR 366

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MPR+A   ++F+MAN GLP TSGF+GEF+VIM   +++  + +LA+  ++
Sbjct: 367 IADYGGVVNVMPRFATFFILFSMANSGLPATSGFVGEFMVIMGAVEHNFWIGLLAATALI 426

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A YSLW+ ++VV G    + V++L D++ RE  ++  +A+  ++ GIYP P  D   V
Sbjct: 427 LGASYSLWMVKRVVLGDVANDHVRELTDINRREFVILGVMAIAVLYMGIYPKPFTDVMHV 486

Query: 479 PLSSIIEN 486
            + +++++
Sbjct: 487 SVEALLQH 494


>gi|121634128|ref|YP_974373.1| NADH dehydrogenase subunit M [Neisseria meningitidis FAM18]
 gi|120865834|emb|CAM09566.1| NADH dehydrogenase chain M [Neisseria meningitidis FAM18]
          Length = 498

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|162279932|ref|NP_064080.2| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. vulgaris]
 gi|323435100|ref|YP_004222318.1| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. maritima]
 gi|20429167|dbj|BAB91330.1| NADH dehydrogenase subunit 4 [Beta vulgaris]
 gi|148491436|dbj|BAA99473.2| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. vulgaris]
 gi|317905655|emb|CBJ14051.1| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. maritima]
 gi|319439833|emb|CBJ17542.1| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. maritima]
 gi|320148081|emb|CBJ20743.1| NADH dehydrogenase subunit 4 [Beta vulgaris subsp. maritima]
          Length = 495

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 236/483 (48%), Positives = 324/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y    ++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENIHFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++  +  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILLQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM +VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNFVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGVVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|294670445|ref|ZP_06735327.1| hypothetical protein NEIELOOT_02164 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307909|gb|EFE49152.1| hypothetical protein NEIELOOT_02164 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 500

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/476 (46%), Positives = 320/476 (67%), Gaps = 13/476 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSFQ 63
           LS+  +LP     ++L +   GC RR+     L    +   F+ +L +++ FD+    FQ
Sbjct: 7   LSLAIWLPIAAGLLVLAT---GCDRRAPLARILAFVGALAGFLVTLPLFTQFDRLSGGFQ 63

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E+Y W+     +Y LGVDGIS+L V+L  F+T   +L+ W+ IQ+   +YM AFL++ 
Sbjct: 64  FAEFYAWVPALNINYALGVDGISVLFVILNAFITLMVVLAGWEVIQKKVAQYMAAFLIMS 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ GAF + D +LFYIFFE  LIP+++IIGVWGG  R+YA+ K FLYT  GS+ ML A+
Sbjct: 124 GLINGAFAARDAMLFYIFFEGMLIPLYLIIGVWGGPRRVYASVKLFLYTLMGSLLMLVAM 183

Query: 183 VVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           V +  +   S +I D   + + P  IQ  +++AFF SFA+K+ M+P HTWLP+AHV+APT
Sbjct: 184 VYLSHQAGGSFAIADFQNLKQIPLGIQQILFVAFFLSFAVKMSMWPVHTWLPDAHVEAPT 243

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GS+ LA I LK+G YG +RF+LP+ P AS+YFAP I  LSLIA+IY  +V++ QTD+KK
Sbjct: 244 GGSMALAAITLKLGAYGFLRFILPILPDASRYFAPAIIVLSLIAVIYIGMVALAQTDMKK 303

Query: 302 LIAYSSIAHMGYVTIGIFSGMKS------GVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           L+AYSSI+HMG+VT+G+F            ++GA+ QM+SHG VS+A+FFC+GV+YDRLH
Sbjct: 304 LVAYSSISHMGFVTLGMFLFTNQVQLQPWALKGAIMQMISHGFVSAAMFFCIGVMYDRLH 363

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           +R+I  YGG+V  MP++A  MM+F MAN GLP TSGF+GEF+VIM     +  V  LA+ 
Sbjct: 364 SRNIADYGGVVTVMPKFAAFMMLFAMANAGLPATSGFVGEFMVIMGAVNYNLFVGALAAL 423

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
            ++L A Y+LW+Y++V+FG      V ++KD++ RE  ++  +A   +  G++P P
Sbjct: 424 TLILGAAYTLWMYKRVIFGAVNNPHVAEMKDINRREFAILAILAATVLGMGLWPEP 479


>gi|319638831|ref|ZP_07993589.1| NADH dehydrogenase chain M [Neisseria mucosa C102]
 gi|317399735|gb|EFV80398.1| NADH dehydrogenase chain M [Neisseria mucosa C102]
          Length = 498

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIVQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|187477553|ref|YP_785577.1| NADH dehydrogenase subunit M [Bordetella avium 197N]
 gi|115422139|emb|CAJ48663.1| NADH dehydrogenase I chain M [Bordetella avium 197N]
          Length = 500

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/490 (45%), Positives = 331/490 (67%), Gaps = 10/490 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDK 57
           N P+L++  F+P   VF +L    L  GR     +  G+S I     F+ ++ +++ FDK
Sbjct: 10  NFPWLTLAIFVPI--VFGLLV---LALGRDDRPCLTRGLSLIGAVAGFLVTIPLYTGFDK 64

Query: 58  GRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
             ++ Q +E   WI+ F  +YHLGVDGIS+  V+LT F+T   + + W+ I     +YM 
Sbjct: 65  TTAAMQFVEKASWIESFNVNYHLGVDGISVWFVLLTAFITIIVVAAGWEVITNRVPQYMA 124

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSI 176
           AFL+L  +++G F +LD LLFY+FFEA+LIPM++I+GVWGG  R+YAA+KFFLYT  GS+
Sbjct: 125 AFLILSGLMVGVFSALDGLLFYVFFEATLIPMYIIVGVWGGPNRVYAAFKFFLYTLMGSL 184

Query: 177 FMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
             L A V +      S  I  +  +K  ++ Q  ++IA   +FA+K+PM+P HTWLP+AH
Sbjct: 185 LTLVAFVYLWNVSGGSFDILTWQQTKLGYTPQILIFIALLAAFAVKVPMWPVHTWLPDAH 244

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF LP+ P AS   + ++  LSLIA+IY  LV++VQ
Sbjct: 245 VEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHSLSGLMIALSLIAVIYIGLVAIVQ 304

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS+AHMG+VT+G F    +GVEGA+ QM+SHG VS A+F C+GV+YDR+H+
Sbjct: 305 EDMKKLVAYSSVAHMGFVTLGFFIFNTAGVEGAIVQMISHGFVSGAMFLCIGVLYDRMHS 364

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MPR+A   ++F+MAN GLP TSGF+GEF+VIM   +++  V +LA+  
Sbjct: 365 RRIADYGGVVNVMPRFATFFVLFSMANSGLPATSGFVGEFMVIMGAVEHNFWVGLLAATA 424

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++L A YSLW+ ++VVFG      V ++ DL+ RE  ++  +A+  ++ GIYP P  D  
Sbjct: 425 LILGASYSLWMVKRVVFGDITNPHVSEMSDLNRREFWILGVMAIAVLYMGIYPKPFTDVM 484

Query: 477 SVPLSSIIEN 486
            V + +++++
Sbjct: 485 HVSVEALLQH 494


>gi|254491642|ref|ZP_05104821.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Methylophaga thiooxidans DMS010]
 gi|224463120|gb|EEF79390.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Methylophaga thiooxydans DMS010]
          Length = 503

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/499 (45%), Positives = 332/499 (66%), Gaps = 19/499 (3%)

Query: 2   NLPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           +LP LS+V +LP LG V  IL    +G  R      AL I+T+  + S  ++  FD    
Sbjct: 4   DLPLLSLVIWLPILGGVIAIL----IGDERPILKPFALAIATLTMLLSFGLYIGFDNTTY 59

Query: 61  SFQMIEYYHWIDYFC-SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E + WI+ F  +YHLGVDG S+ L++LTT  T   ++++W+ I++   +Y+ AFL
Sbjct: 60  QMQFVERHSWIETFAINYHLGVDGFSMPLIILTTISTLLVVVAAWEVIKDRLSQYLAAFL 119

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++E +++  F +LD +LFY+FFEA LIP+F++IG+WGG  R+YA  KFFLYTFFGS+F+L
Sbjct: 120 IMEGLMLAVFSALDAILFYVFFEAMLIPLFLVIGIWGGPNRVYATIKFFLYTFFGSVFLL 179

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A++ +     + +I+D + +       Q W+ +AF  +FA+K+PM+P HTWLP+AHV+A
Sbjct: 180 VALLYLRHVSDSFAILDFHNVG-LSLKEQTWLLLAFLIAFAVKVPMWPVHTWLPDAHVEA 238

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA I LK+GGYG +RF LP+ P AS      I  LSLIAI+Y   V++ Q+D+
Sbjct: 239 PTGGSVILAAITLKIGGYGFLRFALPIAPDASLVLDWFIISLSLIAIVYIGFVALAQSDL 298

Query: 300 KKLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCV 347
           KKLIAYSSIAHMG+VT+G+F            +G    +EGAM QM+SHG +S+A+F  V
Sbjct: 299 KKLIAYSSIAHMGFVTLGLFIIFRIFANASTGTGAVLAIEGAMVQMISHGFISAAMFLAV 358

Query: 348 GVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSN 407
           GV+YDR+HTR+I AYGG+V+ MP +A   + F MAN GLPGTSGF+GEF+VI++ FQ + 
Sbjct: 359 GVLYDRMHTREISAYGGVVNTMPVFAAFAVFFAMANAGLPGTSGFVGEFMVILAAFQANF 418

Query: 408 TVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGI 467
             A LA+  ++L A Y+LW+ ++V +G    ++V  LKD++ RE  M+  +AV+ +F G+
Sbjct: 419 WFAFLAATTLILGAAYTLWMVKRVFYGEVANQEVAALKDINRREFAMLASLAVIVLFIGV 478

Query: 468 YPVPIRDTFSVPLSSIIEN 486
           +P P+ D     +  ++  
Sbjct: 479 WPDPLLDVMHASVEHLLTQ 497


>gi|15676182|ref|NP_273314.1| NADH dehydrogenase subunit M [Neisseria meningitidis MC58]
 gi|7225481|gb|AAF40712.1| NADH dehydrogenase I, M subunit [Neisseria meningitidis MC58]
 gi|316985186|gb|EFV64138.1| NADH-quinone oxidoreductase subunit M [Neisseria meningitidis
           H44/76]
 gi|325141094|gb|EGC63597.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           CU385]
 gi|325145251|gb|EGC67530.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M01-240013]
 gi|325199461|gb|ADY94916.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           H44/76]
          Length = 498

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/472 (45%), Positives = 325/472 (68%), Gaps = 11/472 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSSFQ 63
           LS+  ++P     ++L +   G   R+ F   L    +   F+ +L +++ FD+    +Q
Sbjct: 7   LSLAIWIPIAAGVLVLAT---GSDSRAPFARVLAFMGALAGFLVTLPLFTGFDRLSGGYQ 63

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E++ WI     +Y LGVDGIS+L ++L  F+T   +L+ W+ IQ+   +YM AFL++ 
Sbjct: 64  FTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLAGWEVIQKRPAQYMAAFLIMS 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+YA+ K FLYT  GS+ ML A+
Sbjct: 124 GLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVYASVKLFLYTLMGSLLMLVAM 183

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           V + ++  + SI+D   + + P  +Q  +++AFF SFA+K+PMFP HTWLP+AHV+APT 
Sbjct: 184 VYLYYQTGSFSIVDFQNIEQIPLGVQQLLFVAFFLSFAVKVPMFPVHTWLPDAHVEAPTG 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LSLIA+IY  +V++VQTD+KKL
Sbjct: 244 GSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLSLIAVIYIGMVALVQTDMKKL 303

Query: 303 IAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           +AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG VS+A+F C+GV+YDRLHTR
Sbjct: 304 VAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHGFVSAAMFMCIGVMYDRLHTR 363

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+VIM   + +  V  LA+  +
Sbjct: 364 NIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFMVIMGAVKVNFWVGALAAMTL 423

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           +  A Y+LW+Y++V+FG      V +++D++ RE  ++  +AV  +  G+YP
Sbjct: 424 IYGASYTLWMYKRVIFGAIHNPHVAEMQDINCREFAILAILAVAVLGMGLYP 475


>gi|325137083|gb|EGC59679.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M0579]
          Length = 498

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|294666765|ref|ZP_06731999.1| NADH dehydrogenase subunit M [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603426|gb|EFF46843.1| NADH dehydrogenase subunit M [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 477

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/451 (49%), Positives = 306/451 (67%), Gaps = 15/451 (3%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFL 95
           +L ++   F  SL +   +D    + Q IE + WI  Y   Y+LGVDGI++ L+VLTT +
Sbjct: 11  SLAVAVATFALSLPLLG-YDTANDAMQFIELHAWIPAYNIGYNLGVDGIAVALIVLTTLV 69

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
           T   ++ +W+SI +   +Y+ AFL+LE + +G F + D +LFY+FFEA LIPMF+IIGVW
Sbjct: 70  TVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIFAATDAMLFYVFFEAMLIPMFLIIGVW 129

Query: 156 GGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAF 215
           GG  RIYAA KFFLYTF GS+ ML  +V +  +  +  + DLYA+ +     Q W++ AF
Sbjct: 130 GGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKGGSFQLADLYAL-QLTAKEQTWIFFAF 188

Query: 216 FCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFA 275
             +FA+K+PMFP HTWLP+AHV+APTAGSV LA I LK+GGYG +RF LP+ P AS  FA
Sbjct: 189 LIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFA 248

Query: 276 PVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF------------SGMK 323
            ++  LSLIA+IY  LV++VQ D+KKL+AYSSIAHMG+VT+G F               +
Sbjct: 249 WLVITLSLIAVIYVGLVALVQDDMKKLVAYSSIAHMGFVTLGTFIAFTLVREYGSTDAAR 308

Query: 324 SGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMAN 383
            G++GAM QM+SHG VS A+F C+GV+YDR+HTR I  YGG+V+ MP +A   M+F  AN
Sbjct: 309 LGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTRRIADYGGVVNVMPWFATFSMLFFTAN 368

Query: 384 MGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQ 443
            GLPGTSGF+GEF+VI++ FQ    VA  A+  +V++A Y+LWLY++V FG      V +
Sbjct: 369 AGLPGTSGFVGEFMVILASFQKHPLVAFAAATTLVITAAYTLWLYKRVFFGEVANAHVAE 428

Query: 444 LKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 429 LKDINGREAFVLGVFAAGVLALGLYPKPLTD 459


>gi|308388476|gb|ADO30796.1| NADH dehydrogenase chain M [Neisseria meningitidis alpha710]
 gi|325202915|gb|ADY98369.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M01-240149]
 gi|325207286|gb|ADZ02738.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 498

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 310/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFTILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|253702583|ref|YP_003023772.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter sp. M21]
 gi|251777433|gb|ACT20014.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter sp. M21]
          Length = 535

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 233/496 (46%), Positives = 333/496 (67%), Gaps = 8/496 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFV-WSVFDKGRS 60
            LP LSI+TF P +G  ++LF +    G      +A+ + T      L   ++       
Sbjct: 3   QLPLLSILTFTPLIGAILLLFVNKNSHGVLRTVTMAVTVVTFVLSLPLITGYNAPGTDIG 62

Query: 61  SFQMIEYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            FQ IE   WI    +  SYHLG+DGIS+ LV+LTTF+ P  ILS++ +++E  +EYMI 
Sbjct: 63  GFQFIENVPWIAAGPFQMSYHLGIDGISLWLVILTTFIMPIAILSTYTAVEEKVKEYMIC 122

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
            L+LE  +IG F+S+D+ LFYI++E  LIPM+ +IG+WGG  RIYAA KFF+YT  GS+ 
Sbjct: 123 LLLLEVGMIGTFISIDLFLFYIYWEVMLIPMYFMIGIWGGKNRIYAAVKFFIYTAVGSLL 182

Query: 178 MLFAIVVMCWEKKTS--SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           ML A++ + ++      SII  + ++  P + Q WM++AF  +FAIK+PMFP HTWLP+A
Sbjct: 183 MLVALISLYFKAGGGDFSIIRFWELNLDP-ATQVWMFLAFALAFAIKVPMFPLHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           H +APTAGSV LA +MLK G YG IRF +PLFP AS  F P+I  LS+I IIYASLV+MV
Sbjct: 242 HTEAPTAGSVILAAVMLKCGTYGYIRFAMPLFPEASAQFTPLIATLSVIGIIYASLVAMV 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KKL+AYSS+AH+G+V +G+++    GV G M QML+HG+ + ALF  VG IY+R H
Sbjct: 302 QQDVKKLVAYSSVAHLGFVMLGLYALNTQGVTGGMLQMLNHGVSTGALFLIVGFIYERRH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVLAS 414
           TR I  +GGL   MP +A + M+ T +++GLPGT+GF+GEFLV++  F++     A++A+
Sbjct: 362 TRQISDFGGLAKQMPVFATMFMIVTFSSIGLPGTNGFVGEFLVLLGSFESELRWYAIIAT 421

Query: 415 FGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
            GV+LSA+Y LW++++V+FG  K  K Q LKDL+ RE  ++ P+  L  F G+YP PI D
Sbjct: 422 SGVILSAVYMLWMFQRVMFGELKNPKNQTLKDLNAREVAIMLPLLFLIFFLGVYPRPIID 481

Query: 475 TFSVPLSSIIENYTLK 490
           + +  +  +I    ++
Sbjct: 482 SMAPSIDRLIAQTKVQ 497


>gi|329118920|ref|ZP_08247615.1| NADH-quinone oxidoreductase subunit M [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464948|gb|EGF11238.1| NADH-quinone oxidoreductase subunit M [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 499

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 213/435 (48%), Positives = 310/435 (71%), Gaps = 7/435 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L V+L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLRINYSLGVDGISVLFVILNAFITLMVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D LLFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDALLFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSII-DLYAMSKFPFSIQYWMWIAFFCSFAI 221
           A+ K FLYT  GS+ ML A+V + ++   S +I D   + + P  IQ  +++AFF SFA+
Sbjct: 164 ASVKLFLYTLMGSLLMLVALVYLSYQAGGSFMIADFQNLKQIPLGIQQLLFVAFFLSFAV 223

Query: 222 KIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFL 281
           K+PM+P HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P AS+YFAPVI  L
Sbjct: 224 KVPMWPVHTWLPDAHVEAPTGGSMVLAAITLKVGAYGFLRFILPILPDASRYFAPVIVVL 283

Query: 282 SLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKS-----GVEGAMFQMLSH 336
           SLIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F  +        V+GA+ QM+SH
Sbjct: 284 SLIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFLDGRLNDWAVKGAIMQMISH 343

Query: 337 GLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEF 396
           G VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF
Sbjct: 344 GFVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEF 403

Query: 397 LVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVY 456
           +VIM     +  V +LA+  ++L A Y+LW+Y++V+FG      V ++KD++ RE  ++ 
Sbjct: 404 MVIMGSVAVNFWVGLLAAITLILGASYTLWMYKRVIFGAITNPHVAEMKDINAREFLILA 463

Query: 457 PIAVLTVFFGIYPVP 471
            +AV  +  G++P P
Sbjct: 464 VLAVTVLGMGLWPEP 478


>gi|240113855|ref|ZP_04728345.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae MS11]
 gi|254494612|ref|ZP_05107783.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae 1291]
 gi|268599923|ref|ZP_06134090.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae MS11]
 gi|226513652|gb|EEH62997.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae 1291]
 gi|268584054|gb|EEZ48730.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae MS11]
          Length = 498

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLTGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F CVGV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCVGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           V+M   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VVMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|325131598|gb|EGC54305.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M6190]
          Length = 498

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|296313732|ref|ZP_06863673.1| NADH dehydrogenase, M subunit [Neisseria polysaccharea ATCC 43768]
 gi|296839655|gb|EFH23593.1| NADH dehydrogenase, M subunit [Neisseria polysaccharea ATCC 43768]
          Length = 498

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLIMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIVPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|325130984|gb|EGC53711.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           OX99.30304]
 gi|325139147|gb|EGC61693.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           ES14902]
          Length = 498

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V++G      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIYGAIHNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|161870806|ref|YP_001599979.1| NADH dehydrogenase subunit M [Neisseria meningitidis 053442]
 gi|161596359|gb|ABX74019.1| NADH dehydrogenase chain M [Neisseria meningitidis 053442]
          Length = 477

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 23  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 82

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 83  GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 142

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 143 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 202

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 203 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 262

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 263 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 322

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 323 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 382

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 383 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAV 442

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 443 LAVAVLGMGLYP 454


>gi|325205342|gb|ADZ00795.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M04-240196]
          Length = 498

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFTILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|59802059|ref|YP_208771.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae FA 1090]
 gi|194099631|ref|YP_002002762.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae NCCP11945]
 gi|239999830|ref|ZP_04719754.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae 35/02]
 gi|240014986|ref|ZP_04721899.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae DGI18]
 gi|240017434|ref|ZP_04723974.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae FA6140]
 gi|240081576|ref|ZP_04726119.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae FA19]
 gi|240116589|ref|ZP_04730651.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID18]
 gi|240118813|ref|ZP_04732875.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID1]
 gi|240122055|ref|ZP_04735017.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID24-1]
 gi|240124352|ref|ZP_04737308.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID332]
 gi|240126564|ref|ZP_04739450.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-92-679]
 gi|240129026|ref|ZP_04741687.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-93-1035]
 gi|260439650|ref|ZP_05793466.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae DGI2]
 gi|268595640|ref|ZP_06129807.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae 35/02]
 gi|268597672|ref|ZP_06131839.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae FA19]
 gi|268602258|ref|ZP_06136425.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID18]
 gi|268604524|ref|ZP_06138691.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID1]
 gi|268682979|ref|ZP_06149841.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID332]
 gi|268685144|ref|ZP_06152006.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-92-679]
 gi|268687406|ref|ZP_06154268.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-93-1035]
 gi|291042891|ref|ZP_06568632.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae DGI2]
 gi|293398099|ref|ZP_06642304.1| NADH dehydrogenase I subunit M [Neisseria gonorrhoeae F62]
 gi|59718954|gb|AAW90359.1| putative NADH dehydrogenase I chain M [Neisseria gonorrhoeae FA
           1090]
 gi|193934921|gb|ACF30745.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae NCCP11945]
 gi|268549029|gb|EEZ44447.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae 35/02]
 gi|268551460|gb|EEZ46479.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae FA19]
 gi|268586389|gb|EEZ51065.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID18]
 gi|268588655|gb|EEZ53331.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID1]
 gi|268623263|gb|EEZ55663.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae PID332]
 gi|268625428|gb|EEZ57828.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-92-679]
 gi|268627690|gb|EEZ60090.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae SK-93-1035]
 gi|291013325|gb|EFE05291.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae DGI2]
 gi|291611362|gb|EFF40432.1| NADH dehydrogenase I subunit M [Neisseria gonorrhoeae F62]
 gi|317165119|gb|ADV08660.1| NADH dehydrogenase subunit M [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 498

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  +++AFF SFA+K
Sbjct: 164 ASVKLFLYTLTGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFVAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           V+M   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VVMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|269468287|gb|EEZ79969.1| NADH:ubiquinone oxidoreductase, chain M [uncultured SUP05 cluster
           bacterium]
          Length = 510

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 230/508 (45%), Positives = 335/508 (65%), Gaps = 28/508 (5%)

Query: 3   LPFLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           +  LS++ +LP LG   VIL  +      R    V++ IS + F+ SL +++ FD     
Sbjct: 1   MELLSLLIWLPILGGALVILIGNERADTARW---VSVAISILVFVMSLSLYTEFDSSTHL 57

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI  F  +YH+GVDGIS+ L++LTTF T   +++ W+ IQ     YM AFL+
Sbjct: 58  MQFVEKTSWISQFDINYHIGVDGISMPLIILTTFSTILVLIAGWEVIQRRTAHYMAAFLM 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++IG F +LD +LFY F+EASLIPM +IIGVWGG  R+YAA KFFLYTF GS+ ML 
Sbjct: 118 MEGLIIGVFSALDGILFYAFWEASLIPMLLIIGVWGGDNRVYAAIKFFLYTFLGSVMMLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           +++ M  +  + SI+D++ + +   + Q +++ AFF +FA+K+PMFP HTWLP+AHVQAP
Sbjct: 178 SLIYMYNKGGSFSILDMHNL-ELTLAEQSYIFWAFFVAFAVKVPMFPVHTWLPDAHVQAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLKMGGYG  RF LP+ P AS  F+ V+  LSLIAI+Y   V++VQ D+K
Sbjct: 237 TGGSVILAAIMLKMGGYGFFRFSLPITPDASLQFSDVVIALSLIAIVYIGFVALVQRDMK 296

Query: 301 KLIAYSSIAHMGYVTIGIFS----------------------GMKSGVEGAMFQMLSHGL 338
           KLIAYSSI+HMG+VT+G+F+                      G   G+EGAM QM+SHG 
Sbjct: 297 KLIAYSSISHMGFVTLGVFALFSILKMGADGNLVSLNGGSIDGALLGLEGAMVQMISHGF 356

Query: 339 VSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLV 398
           +S+A+F  VGV+YDRLH+R+I  YGG++++MP++    ++F MAN GLPGTSGF+GEF+V
Sbjct: 357 ISAAMFLVVGVLYDRLHSREISTYGGVINSMPKFTGFAVLFAMANAGLPGTSGFVGEFMV 416

Query: 399 IMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPI 458
           I+   Q +   AVLA+  +++ A Y+LW+ ++V +G    + V+ LKD++ RE  ++  +
Sbjct: 417 ILGAVQANIWYAVLAATTLIVGASYTLWMVKRVFWGPITNDAVKTLKDINGREFFILAIL 476

Query: 459 AVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           A+  +  G+YP PI +     +  ++  
Sbjct: 477 ALAVLIVGLYPQPIIEVMHASIDHLLNQ 504


>gi|313669272|ref|YP_004049556.1| NADH dehydrogenase chain M [Neisseria lactamica ST-640]
 gi|313006734|emb|CBN88204.1| NADH dehydrogenase chain M [Neisseria lactamica 020-06]
          Length = 498

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/432 (47%), Positives = 311/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFAGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ I++   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIRKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIILS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G  +   ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLNDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG  +   V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIRNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +A+  +  G+YP
Sbjct: 464 LAIAVLGMGLYP 475


>gi|325203373|gb|ADY98826.1| NADH:ubiquinone dehydrogenase, M subunit [Neisseria meningitidis
           M01-240355]
          Length = 498

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 308/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIHNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +AV  +  G+YP
Sbjct: 464 LAVAVLGMGLYP 475


>gi|300691037|ref|YP_003752032.1| NADH-quinone oxidoreductase subunit M [Ralstonia solanacearum
           PSI07]
 gi|299078097|emb|CBJ50740.1| NADH-quinone oxidoreductase subunit M [Ralstonia solanacearum
           PSI07]
          Length = 488

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/483 (46%), Positives = 329/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLISFVITLPLITRFDKSTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I E   +YM AFL+L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA KFFLYT  GS+  L A +
Sbjct: 121 LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVAFL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQV-KLSLNEQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   A  +  +SLIA+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFVIAISLIAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   Q +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVQFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +L+DL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVANKHVAELQDLNAREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|293603931|ref|ZP_06686346.1| NADH-quinone oxidoreductase subunit M [Achromobacter piechaudii
           ATCC 43553]
 gi|292817768|gb|EFF76834.1| NADH-quinone oxidoreductase subunit M [Achromobacter piechaudii
           ATCC 43553]
          Length = 500

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/488 (44%), Positives = 330/488 (67%), Gaps = 10/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTIN----FIFSLFVWSVFDKGR 59
           P+L++  F+P   VF +L    L  GR    G+  G+S +     F+ ++ +++ FD   
Sbjct: 12  PWLTLAIFVPI--VFGLLV---LAVGRDDRPGLTRGLSLVGAFAGFLVTIPLYTGFDNTT 66

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   WI+ F  +YHLG+DGIS+  V+LT F+T   +L+ W+ I     +YM AF
Sbjct: 67  AAMQFVEKASWIEAFNVNYHLGIDGISLWFVLLTAFITIIVVLAGWEVITSRVAQYMAAF 126

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  
Sbjct: 127 LILSGLMVGVFAALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLMGSLLT 186

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A + +      S  I  +   K   + Q  +++A   +FA+K+PM+P HTWLP+AHV+
Sbjct: 187 LIAFIYLWHASGGSFDILTWHQVKLGQTPQILIFVALLAAFAVKVPMWPVHTWLPDAHVE 246

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GS+ LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA+IY  LV+++Q D
Sbjct: 247 APTGGSIVLAAIMLKLGAYGFLRFSLPITPDASHSLAGLMITLSLIAVIYIGLVAIIQED 306

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AHMG+VT+G F    +GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R 
Sbjct: 307 MKKLVAYSSVAHMGFVTLGFFIFNTAGVEGAIVQMISHGFVSGAMFMCIGVLYDRMHSRR 366

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MPR+A   ++F+MAN GLP TSGF+GEF+VIM   +++  + +LA+  ++
Sbjct: 367 IADYGGVVNVMPRFATFFILFSMANSGLPATSGFVGEFMVIMGAVEHNFWIGLLAATALI 426

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A YSLW+ ++VV G    + V++L D++ RE  ++  +A+  ++ GIYP P  D   V
Sbjct: 427 LGASYSLWMVKRVVLGDIANDHVRELTDINRREFVILGVMAIAVLYMGIYPKPFTDVMHV 486

Query: 479 PLSSIIEN 486
            + +++++
Sbjct: 487 SVEALLQH 494


>gi|254671581|emb|CBA09240.1| NADH-ubiquinone oxidoreductase, chain M [Neisseria meningitidis
           alpha153]
 gi|261391789|emb|CAX49244.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M;
           NDH-1, chain M) [Neisseria meningitidis 8013]
          Length = 498

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIGVWGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGVWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F    G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVDGQLDDWALKGAVIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V++G      V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIYGAIHNPHVAEMKDINCREFAILAI 463

Query: 458 IAVLTVFFGIYP 469
           +AV+ +  G+YP
Sbjct: 464 LAVVVLGMGLYP 475


>gi|325924687|ref|ZP_08186125.1| NADH dehydrogenase subunit M [Xanthomonas perforans 91-118]
 gi|325544893|gb|EGD16238.1| NADH dehydrogenase subunit M [Xanthomonas perforans 91-118]
          Length = 491

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 228/477 (47%), Positives = 316/477 (66%), Gaps = 19/477 (3%)

Query: 11  FLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +LP +G  +IL        R +    +L ++   F  SL +   +D    + Q IE + W
Sbjct: 3   WLPIIGGALILALRNAETARWA----SLAVAVATFALSLPLLG-YDTANDAMQFIELHAW 57

Query: 71  ID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I  Y   Y+LGV GI++ L+VLTT +T   ++ +W+SI +   +Y+ AFL+LE + +G F
Sbjct: 58  IPAYNIGYNLGVGGIAVALIVLTTLVTVLALIGAWRSIDKRVNQYVAAFLILEGVTVGIF 117

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEK 189
            + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML  +V +  + 
Sbjct: 118 AATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAMKFFLYTFLGSVLMLVGLVYLYLKG 177

Query: 190 KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAG 249
            +  + DLYA+ +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+APTAGSV LA 
Sbjct: 178 GSFQLADLYAL-QLTAKEQTWIFFAFLIAFAVKVPMFPVHTWLPDAHVEAPTAGSVILAA 236

Query: 250 IMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIA 309
           I LK+GGYG +RF LP+ P AS  FA ++  LSLIA+IY  LV++VQ D+KKL+AYSSIA
Sbjct: 237 IALKIGGYGFLRFNLPIVPDASHEFAWLVITLSLIAVIYVGLVALVQDDMKKLVAYSSIA 296

Query: 310 HMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           HMG+VT+G F               + G++GAM QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 297 HMGFVTLGTFIAFTLVREYGSTDAARLGLQGAMVQMISHGFVSGAMFSCIGVLYDRMHTR 356

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP +A   M+F MAN GLPGTSGF+GEF+VI++ FQ    VA  A+  +
Sbjct: 357 RIADYGGVVNVMPWFATFSMLFFMANAGLPGTSGFVGEFMVILASFQKHPLVAFGAATTL 416

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           V++A Y+LWLY++V FG      V +LKD++ RE  ++   A   +  G+YP P+ D
Sbjct: 417 VITAAYTLWLYKRVFFGEVANAHVAELKDINGREAFVLGVFAAGVLALGLYPKPLTD 473


>gi|83746309|ref|ZP_00943362.1| NADH-quinone oxidoreductase chain M [Ralstonia solanacearum UW551]
 gi|207723885|ref|YP_002254283.1| transmembrane nadh dehydrogenaseI(chain m) protein [Ralstonia
           solanacearum MolK2]
 gi|207742747|ref|YP_002259139.1| transmembrane nadh dehydrogenaseI(chain m) protein [Ralstonia
           solanacearum IPO1609]
 gi|83727059|gb|EAP74184.1| NADH-quinone oxidoreductase chain M [Ralstonia solanacearum UW551]
 gi|206589090|emb|CAQ36052.1| transmembrane nadh dehydrogenaseI(chain m) protein [Ralstonia
           solanacearum MolK2]
 gi|206594141|emb|CAQ61068.1| transmembrane nadh dehydrogenaseI(chain m) protein [Ralstonia
           solanacearum IPO1609]
          Length = 488

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 226/483 (46%), Positives = 328/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLISFVITLPLITRFDKSTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I E   +YM AFL+L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA KFFLYT  GS+  L A +
Sbjct: 121 LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVAFL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            +     T  I+  + + K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYLHSGTFEILQWHQL-KLSLNEQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   A  +  +SLIA+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFVIAISLIAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +L+DL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVANQHVAELQDLNAREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|95928434|ref|ZP_01311182.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135705|gb|EAT17356.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Desulfuromonas acetoxidans DSM 684]
          Length = 528

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/503 (45%), Positives = 337/503 (66%), Gaps = 16/503 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSL-FVWSVFDKGR 59
           M+   LS++TF P LG+F++L       G     G  L  + I F+ SL        K  
Sbjct: 1   MSEHLLSLMTFFPLLGMFIVLMLPKNNGGLLK--GATLVFTLITFVISLPLALDPVFKTS 58

Query: 60  SSFQMIEYYHWI---DYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYM 115
                 E+  WI   +YF  +Y +G+DGIS+ LV+LTTF+ P  +LS+W+++ +N + YM
Sbjct: 59  GGMHYTEFAEWISVTNYFQMNYSVGIDGISLWLVMLTTFIMPIAVLSTWQAVTKNVKGYM 118

Query: 116 IAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGS 175
              L+LE+ ++GAF++LD+ LFYIF+E  LIPM+ +IG+WGG+ RIYAA KFF+YT  GS
Sbjct: 119 ALMLLLETAMLGAFIALDLFLFYIFWELMLIPMYFMIGIWGGANRIYAAVKFFIYTAVGS 178

Query: 176 IFMLFAIVVMCWEKKTS-------SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPF 228
           + ML AI+ + +    S       SI D Y +S  P ++Q W+++AF  SFAIK+PMFP 
Sbjct: 179 LLMLVAILFIYYAAVNSGMDISGFSIADFYNLSLDP-ALQKWLFLAFAFSFAIKVPMFPV 237

Query: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288
           HTWLP+AH +APTAGSV LA +MLKMG YG +RF +PLFP A+Q F P +  L++I I+Y
Sbjct: 238 HTWLPDAHTEAPTAGSVILAAVMLKMGTYGYVRFAMPLFPEATQTFLPYMTALAVIGIVY 297

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
            +LV+M+Q D+KKL+AYSS++H+G+V +GIF+    GV GA+ QM++HG+ + ALF  VG
Sbjct: 298 GALVAMMQKDVKKLVAYSSVSHLGFVMLGIFALNTVGVSGAVLQMINHGISTGALFLIVG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-N 407
            IY+R HTR I  +GGL   MP +AV+ M+ T++++GLP T+GF+GEF++++  FQ+   
Sbjct: 358 FIYERRHTRLISEFGGLSKQMPVFAVIFMIVTLSSIGLPATNGFVGEFMILLGAFQSELR 417

Query: 408 TVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGI 467
             AV+A+ GV+L+A+Y LW++++V+FG     K Q LKDL+LRE C++ P+ V   + G+
Sbjct: 418 WFAVVATSGVILAAVYMLWMFQRVMFGKLDNPKNQVLKDLNLRELCVILPLLVFVFWIGV 477

Query: 468 YPVPIRDTFSVPLSSIIENYTLK 490
           YP    +  +  +  +IE  + K
Sbjct: 478 YPNTFLEKMTPAIDQMIEQVSGK 500


>gi|291613550|ref|YP_003523707.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sideroxydans lithotrophicus ES-1]
 gi|291583662|gb|ADE11320.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sideroxydans lithotrophicus ES-1]
          Length = 497

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 226/486 (46%), Positives = 328/486 (67%), Gaps = 9/486 (1%)

Query: 4   PFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRS 60
           P LS   +LP L GV V+      G  R +     +AL  + ++F+ ++ +++ FD+  S
Sbjct: 6   PLLSAAIWLPILFGVLVLA----TGNDRNARLARTIALVGAILSFLVTIPLYTGFDRMTS 61

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +    WI  F   YHLGVDGIS+L V+L +F TP  +++ W+ I++   +YM AFL
Sbjct: 62  DMQFVVLKDWIPRFNIHYHLGVDGISLLFVLLNSFFTPLVVIAGWQVIEKRVAQYMAAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++  +V G F+SLD +LFY+F+EA LIPMF+IIGVWGG  R+YAA KFFLYT  GS+ ML
Sbjct: 122 IMSGLVNGVFVSLDAMLFYVFWEAMLIPMFIIIGVWGGPNRVYAALKFFLYTLLGSLLML 181

Query: 180 FAIVVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
            A++ +  +   S  I+D + M+    + Q  ++IAFF +F++K+PMFP HTWLP+AHV+
Sbjct: 182 VALLYLYHQSGGSFDILDYHRMAIPSLTAQILVFIAFFMAFSVKVPMFPVHTWLPDAHVE 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLK+G YG IRF LP+ P AS Y APV+  LSLIA++Y  LV++ Q+D
Sbjct: 242 APTGGSVILAAIMLKVGAYGFIRFSLPIVPDASHYLAPVMIALSLIAVVYIGLVALTQSD 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSI+HMG+VT+G F     G+EGA+ QM+SHG +S ALF C+GV+YDR+H+R 
Sbjct: 302 MKKLVAYSSISHMGFVTLGFFIFNSYGMEGALLQMISHGFISGALFLCIGVLYDRVHSRQ 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+ + MP +A   M+F MAN GLPGTSGF+GEF+VIM   + +   A  A+  ++
Sbjct: 362 IVDYGGVANKMPVFAAFFMLFAMANSGLPGTSGFVGEFMVIMGAVKANFWFAFAAASTLI 421

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
             A Y+LW+Y++V+FG    + V  L+D+S RE+ +   +A+  +  G+YP+P  D    
Sbjct: 422 FGAAYTLWMYKRVIFGAVANDHVAHLRDISGREKIVFIILAITVLGMGLYPLPFADIMHT 481

Query: 479 PLSSII 484
            ++ ++
Sbjct: 482 SVTDLL 487


>gi|225077036|ref|ZP_03720235.1| hypothetical protein NEIFLAOT_02088 [Neisseria flavescens
           NRL30031/H210]
 gi|224951593|gb|EEG32802.1| hypothetical protein NEIFLAOT_02088 [Neisseria flavescens
           NRL30031/H210]
          Length = 498

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/432 (47%), Positives = 309/432 (71%), Gaps = 6/432 (1%)

Query: 44  NFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILS 102
            F+ +L +++ FD+    +Q  E++ WI     +Y LGVDGIS+L ++L  F+T   +L+
Sbjct: 44  GFLVTLPLFTGFDRLSGGYQFTEFHEWIPLLKINYALGVDGISVLFIILNAFITLLVVLA 103

Query: 103 SWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIY 162
            W+ IQ+   +YM AFL++  ++ GAF + D +LFY+FFE  LIP+++IIG WGG  R+Y
Sbjct: 104 GWEVIQKRPAQYMAAFLMMSGLINGAFAAQDAILFYVFFEGMLIPLYLIIGGWGGPRRVY 163

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           A+ K FLYT  GS+ ML A+V + ++  + SI+D   + + P  +Q  ++ AFF SFA+K
Sbjct: 164 ASVKLFLYTLMGSLLMLVAMVYLYYQTGSFSIVDFQNIKQIPLGVQQLLFAAFFLSFAVK 223

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFP HTWLP+AHV+APT GS+ LA I LK+G YG +RF+LP+ P A++YFAPVI  LS
Sbjct: 224 VPMFPVHTWLPDAHVEAPTGGSMVLAAITLKLGAYGFLRFILPIMPDAARYFAPVIIVLS 283

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIF---SGMKS--GVEGAMFQMLSHG 337
           LIA+IY  +V++VQTD+KKL+AYSSI+HMG+VT+G+F   +G      ++GA+ QM+SHG
Sbjct: 284 LIAVIYIGMVALVQTDMKKLVAYSSISHMGFVTLGMFLFVNGQLDDWALKGAIIQMISHG 343

Query: 338 LVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFL 397
            VS+A+F C+GV+YDRLHTR+I  YGG+V+ MP++A  MM+F MAN GLP TSGF+GEF+
Sbjct: 344 FVSAAMFMCIGVMYDRLHTRNIADYGGVVNVMPKFAAFMMLFGMANAGLPATSGFVGEFM 403

Query: 398 VIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYP 457
           VIM   + +  V  LA+  ++  A Y+LW+Y++V+FG  +   V ++KD++ RE  ++  
Sbjct: 404 VIMGAVKVNFWVGALAAMTLIYGASYTLWMYKRVIFGAIRNPHVAEMKDINCREFAILAV 463

Query: 458 IAVLTVFFGIYP 469
           +A+  +  G+YP
Sbjct: 464 LAIAVLGMGLYP 475


>gi|77166011|ref|YP_344536.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosococcus oceani ATCC 19707]
 gi|254436371|ref|ZP_05049877.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Nitrosococcus oceani AFC27]
 gi|76884325|gb|ABA59006.1| NADH dehydrogenase subunit M [Nitrosococcus oceani ATCC 19707]
 gi|207088061|gb|EDZ65334.1| proton-translocating NADH-quinone oxidoreductase, chain M subfamily
           [Nitrosococcus oceani AFC27]
          Length = 504

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/498 (45%), Positives = 328/498 (65%), Gaps = 17/498 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            LP LS+V +LP LG F++L    +G        ++LG+S + F+ S  +++ FD   ++
Sbjct: 4   GLPLLSLVIWLPILGGFLVL---AVGNHVERVRWLSLGVSGLTFVVSWSLYTGFDISTAT 60

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   W++ F   YHLG+DGIS+ L++LTTF T   +++ W+ I+    +YM +FL+
Sbjct: 61  MQFQEKLSWVEAFDVYYHLGIDGISMPLIILTTFSTVLVVIAGWRVIEHKLAQYMASFLI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++ G F +LD +LFY FFE  LIP+F+IIG+WGG  RIYA  KFFLYTF GS+F L 
Sbjct: 121 MEGLMNGVFAALDAVLFYFFFEGMLIPLFLIIGIWGGPNRIYATLKFFLYTFLGSVFFLL 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +       SI++ + +       Q  +++AF  +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 181 ALLYLRSVTGGFSILEFHQV-PLDMQAQIGIFLAFLLAFAVKVPMWPVHTWLPDAHVEAP 239

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I LK+G YG +RF LP+ P AS     +I  LSLIA++Y  LV++VQ D+K
Sbjct: 240 TGGSVILAAITLKIGAYGFMRFSLPITPDASMALNWLIITLSLIAVVYIGLVAIVQEDLK 299

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+G+F             G   G+EGA+ QM+SHGLVS+A+F CVG
Sbjct: 300 KLIAYSSIAHMGFVTLGLFIAFAIFSQGVEGDGALLGLEGALVQMISHGLVSAAMFLCVG 359

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRLHTR I  YGG+V+ MP +A  M++F MAN+GLPGTSGF+GEFLVI+  FQ    
Sbjct: 360 VLYDRLHTRLIKDYGGVVNKMPIFASFMVLFAMANVGLPGTSGFVGEFLVILGAFQADFW 419

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
            A  AS  ++L A Y+LW+ ++VVFG    +KV  ++DL+ RE  ++  +A   +  G++
Sbjct: 420 YAFFASMTLILGATYTLWMVKRVVFGDIANDKVATMEDLNSREFLVLGTLAAAVLLLGVW 479

Query: 469 PVPIRDTFSVPLSSIIEN 486
           P P+ +     L +++  
Sbjct: 480 PQPLLEVMHTSLENLLSQ 497


>gi|269836333|ref|YP_003318561.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphaerobacter thermophilus DSM 20745]
 gi|269785596|gb|ACZ37739.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Sphaerobacter thermophilus DSM 20745]
          Length = 527

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/502 (47%), Positives = 330/502 (65%), Gaps = 38/502 (7%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS +T++P +G  +I F  +     ++   VALG S ++   SL + + FD   S  Q
Sbjct: 5   PILSALTYVPLVGAAIIFF--WPKASPQAARWVALGASLVSLALSLVMLAGFDTSASGMQ 62

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +E + W+     SYH GVDGIS+LL+VL+T LT   I++SW SIQ   REYMI  L+LE
Sbjct: 63  FVERFEWLPALGVSYHFGVDGISVLLIVLSTLLTTIGIVASWSSIQHRVREYMITMLMLE 122

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + ++G F+SLD+ LFYIF+E  LIPM ++IGVWG + R+YAA KFFLYT  GS+ ML  I
Sbjct: 123 TGMLGVFVSLDLFLFYIFWEVMLIPMALLIGVWGSANRVYAAVKFFLYTLAGSLLMLVGI 182

Query: 183 VVMC---WEKKTSSIIDLYAMSK--FPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           + +    +E+     +D+  + +  + ++ Q W++ AFF +FAIK+PM+PFHTWLP+AHV
Sbjct: 183 IALYQSYFEQTGIRTLDVLQLQQGNYGYTFQMWVFAAFFIAFAIKVPMWPFHTWLPDAHV 242

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMGGYG +RF LPLFP A++ +APVI  LS+I IIY +LV++VQ 
Sbjct: 243 EAPTAGSVLLAGVLLKMGGYGLLRFNLPLFPDAARDWAPVIIVLSVIGIIYGALVALVQP 302

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSS++HMG+VT+GIF+    G+ GAM  MLSHGLV+SALF CVGVIYDR HTR
Sbjct: 303 DLKKLVAYSSVSHMGFVTLGIFAFNAQGLYGAMIVMLSHGLVTSALFLCVGVIYDRGHTR 362

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  +GGL  NMP YA  + +FT A++GLPG SGF+GEFL I+  F+      V+A   V
Sbjct: 363 LISRFGGLATNMPVYASFLGLFTFASLGLPGLSGFVGEFLSILGAFRAERAAGVIAFLVV 422

Query: 418 VLSALYSLWLYRKVVFGVSKCE------------------------------KVQQLKDL 447
           + SA Y LW+Y++V +  +  E                                +  +D+
Sbjct: 423 IFSAWYMLWMYQRVAWQRAPGEPPDANDPEAKLAGDEPRPVMGGAEHGGDVVDPRTFRDV 482

Query: 448 SLRERCMVYPIAVLTVFFGIYP 469
           + RE   + P+AVLT++ G+YP
Sbjct: 483 TWREAMTLAPLAVLTIWMGVYP 504


>gi|150406469|ref|YP_001315113.1| NADH dehydrogenase subunit 4 [Chlorokybus atmophyticus]
 gi|126507706|gb|ABO15103.1| NADH dehydrogenase subunit 4 [Chlorokybus atmophyticus]
          Length = 502

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 329/480 (68%), Gaps = 5/480 (1%)

Query: 9   VTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYY 68
           V F P +G  ++ F        R    +A   S I F+FSL +W  FD   + FQ +   
Sbjct: 23  VAFTPLVGAIILFFIP--NEKIRLIRSIAFTTSLITFLFSLLLWLEFDYSTAKFQFVNNV 80

Query: 69  HWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIG 127
           +W+ +   ++++GVDGISI  ++LTTFL P CIL  W +++   ++Y+IAFLVLE+++I 
Sbjct: 81  NWLPFSNINFYIGVDGISIFFIILTTFLIPVCILVGWSTVKNYLKQYLIAFLVLETLMIF 140

Query: 128 AFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMC 186
            F +LD+LLFY+FFE+ LIPMF+IIG+WG  ER I AAY+FFLYT FGS+FML AI+ + 
Sbjct: 141 VFCTLDLLLFYLFFESVLIPMFLIIGIWGSRERKIRAAYQFFLYTLFGSVFMLLAILFIY 200

Query: 187 WEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
           ++  T+ +  LY  ++F    Q  +W+AFF SFA+K+PM P H WLP AHV+APTAGSV 
Sbjct: 201 FQTGTTDLQILYT-TEFTVQRQIILWLAFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVI 259

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF +P+FP A+ YF P+I+ +S+IAIIY SL ++ Q D+KK+IAYS
Sbjct: 260 LAGILLKLGSYGFLRFSIPIFPEATLYFTPLIYTMSVIAIIYTSLTTLSQIDLKKIIAYS 319

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +VTIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR I  YGG V
Sbjct: 320 SVAHMNFVTIGLFSLNIQGIEGSLLLMLSHGLVSSALFLCVGALYDRHKTRLIQYYGGCV 379

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP +++  ++FT+ N+ LPGTS F+GEFL+++  FQ++  +  LA+ G+VL A YSLW
Sbjct: 380 QTMPLFSLFFLIFTLGNLSLPGTSSFVGEFLILVGSFQSNTMITTLAATGMVLGAAYSLW 439

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           LY +V+FG  K   + +  DL+ RE  M  P  +   + GIYP        + +S++I++
Sbjct: 440 LYNRVIFGPFKPNFINRFSDLNRREVMMFLPFIIGIFWIGIYPEIFLRVMHISVSALIQH 499


>gi|17546769|ref|NP_520171.1| NADH dehydrogenase subunit M [Ralstonia solanacearum GMI1000]
 gi|17429069|emb|CAD15757.1| probable transmembrane nadh dehydrogenaseI(chain m) oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 488

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 329/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S ++F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLVSFVITLPLITRFDKSTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I E   +YM AFL+L  
Sbjct: 61  VEKSTWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA KFFLYT  GS+  L A +
Sbjct: 121 LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVAFL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQL-KLSLNEQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   A  +  +SLIA+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFVIAISLIAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +L+DL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVANKHVAELQDLNAREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|217970168|ref|YP_002355402.1| NADH dehydrogenase subunit M [Thauera sp. MZ1T]
 gi|217507495|gb|ACK54506.1| proton-translocating NADH-quinone oxidoreductase, chain M [Thauera
           sp. MZ1T]
          Length = 493

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/489 (44%), Positives = 330/489 (67%), Gaps = 8/489 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGR 59
           ++P LS+  ++P +G  ++L +   G  R +     +AL ++   F+ ++ +++ FD G 
Sbjct: 3   DIPLLSLAIWVPIIGGLLVLAT---GSDRNAPLARMLALAVAVAGFVVTIPLYTGFDVGT 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           S+ Q +E   W+  F  +YHLGVDGIS+L V+L  F+T   + + W+ IQ    +YM AF
Sbjct: 60  SAMQFVELQSWVPRFNINYHLGVDGISVLFVLLNAFITIIVVAAGWQVIQTKVAQYMAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L++  ++ G F +LD +LFY+FFEASLIP+++IIG+WGG+ R+YAA KFFLYT FGS+ M
Sbjct: 120 LIMSGLMNGIFSALDAVLFYVFFEASLIPLYLIIGIWGGANRVYAAIKFFLYTLFGSLLM 179

Query: 179 LFAIVVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           L A++ +  +   S SI+D + +   P   Q  +++AF  +F +K+PM+P HTWLP+AHV
Sbjct: 180 LIALLYLFMQSGGSFSILDWHQL-PLPIEPQILIFLAFLIAFGVKVPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA I LK+G YG +RF LP+ P A+   AP++  LSLIA++Y   V++VQ 
Sbjct: 239 EAPTGGSVVLAAIALKLGAYGFLRFSLPIVPDAANELAPLVITLSLIAVVYIGFVALVQA 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSI+HMG+VT+G F     GVEGA+ QM+SHG VS A+F C+GV+YDRLH+R
Sbjct: 299 DMKKLVAYSSISHMGFVTLGFFMFNSLGVEGALVQMISHGFVSGAMFLCIGVLYDRLHSR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+VH MP++A   M+FTMAN GLP TSGF+GEF+V++   Q +  +  +A+  +
Sbjct: 359 QIADYGGVVHTMPKFAAFFMLFTMANSGLPATSGFVGEFMVVLGAVQYNFWIGFVAATTL 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L A YSLW+Y++VVFG      V +L+D++ RE   +  +A   +  G+YP P  +   
Sbjct: 419 ILGAAYSLWMYKRVVFGKVANPHVAELEDINGREFAFLAVLAACVLAMGLYPFPFTEVMH 478

Query: 478 VPLSSIIEN 486
             ++ ++ +
Sbjct: 479 ASVNELLRH 487


>gi|300703654|ref|YP_003745256.1| NADH-quinone oxidoreductase subunit m [Ralstonia solanacearum
           CFBP2957]
 gi|299071317|emb|CBJ42635.1| NADH-quinone oxidoreductase subunit M [Ralstonia solanacearum
           CFBP2957]
          Length = 488

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 328/483 (67%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLISFVITLPLITRFDKSTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   W++ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I E   +YM AFL+L  
Sbjct: 61  VEKSSWVERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA KFFLYT  GS+  L A +
Sbjct: 121 LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVAFL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            +     T  I+  + + K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYLHSGTFEILQWHQL-KLSLNEQILLFIAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   A  +  +SLIA+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFVIAISLIAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +L+DL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVGNQHVAELQDLNAREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|295311648|ref|YP_003587245.1| NADH dehydrogenase subunit 4 [Citrullus lanatus]
 gi|259156776|gb|ACV96638.1| NADH dehydrogenase subunit 4 [Citrullus lanatus]
          Length = 495

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 323/483 (66%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L  S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSRIRLIRLIGLCASLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   +++LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENINFYLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++  +  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILLQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+    P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKLGTYGFLRFSIPMFPEATLCATPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGVVWMGVYPKVFLDYMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|167375203|gb|ABZ79355.1| NADH dehydrogenase subunit 4 [Bambusa oldhamii]
 gi|196052308|gb|ABZ79357.2| NADH dehydrogenase subunit 4 [Phyllostachys edulis]
          Length = 495

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 234/483 (48%), Positives = 323/483 (66%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L +S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSSIRLIRLIGLCVSLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDYFCSY-HLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   + ++G+DG+S+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENIHLYMGIDGLSLFFVILTTFLIPICILVGWSGMRSFGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++  +  T+ +  +   ++F    Q  +WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILLQTGTTDL-QILLTTEFSERRQILLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLYKFSDLNGREVFIFLPFLVGVVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|152980305|ref|YP_001353164.1| NADH dehydrogenase I chain M [Janthinobacterium sp. Marseille]
 gi|151280382|gb|ABR88792.1| NADH dehydrogenase I chain M [Janthinobacterium sp. Marseille]
          Length = 496

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/494 (45%), Positives = 330/494 (66%), Gaps = 22/494 (4%)

Query: 4   PFLSIVTFLPF-LGVFVILFSSYLGCGRR---------SFFGVALGISTINFIFSLFVWS 53
           P LS+  +LP   GVF+      L  GR          S FG     S ++F+ +L + +
Sbjct: 7   PLLSLAIWLPIAFGVFI------LAVGRDTNPNAVRVLSLFG-----SIVSFLVTLPIVA 55

Query: 54  VFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFR 112
            FD      Q +E   WID F  +Y LGVDG+S+  V+LT F+T F ++++W+ I++   
Sbjct: 56  KFDNAAHGMQFVEKMKWIDIFNINYSLGVDGLSMWFVILTAFITIFVVIAAWEVIEKRVA 115

Query: 113 EYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTF 172
           +YM AFL+L  ++IG F +LD LLFY+FFE++LIPMF+IIGVWGG+ R+YA+ KFFLYTF
Sbjct: 116 QYMGAFLILSGLMIGVFCALDGLLFYVFFESTLIPMFIIIGVWGGANRVYASIKFFLYTF 175

Query: 173 FGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWL 232
           FGS+ ML A++ + ++   S  I  +     P   Q  +++AF  +FA+K+PM+P HTWL
Sbjct: 176 FGSLLMLVALLYLYFKSGHSFDILAWHTLPLPMDAQILIFLAFLMAFAVKVPMWPVHTWL 235

Query: 233 PNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLV 292
           P+AHV+APT GSV LA IMLK+G YG +RF LP+ P AS Y +  +  LSLIA+IY  LV
Sbjct: 236 PDAHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHYLSGFMITLSLIAVIYIGLV 295

Query: 293 SMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYD 352
           ++VQTD+KKL+AYSSIAHMG+VT+G F      V+G + QM+SHG VS A+F C+GV+YD
Sbjct: 296 ALVQTDMKKLVAYSSIAHMGFVTLGFFMFNDMAVQGGIVQMISHGFVSGAMFLCIGVLYD 355

Query: 353 RLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVL 412
           R+HTR+I  YGG+V+ MP++A   ++F+M N GLP TSGF+GEF+VI+   + +  + +L
Sbjct: 356 RMHTRNIADYGGVVNVMPKFAAFFVLFSMGNAGLPATSGFVGEFMVILGAVKFNFWIGLL 415

Query: 413 ASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           A+  ++L A YSLWL ++V+FG      V ++KDL+ RE  M+  +A+  +  G+YP P 
Sbjct: 416 AATALILGAAYSLWLAKRVIFGAITNHHVSEMKDLNKREFLMLGLLAIAVLAMGLYPAPF 475

Query: 473 RDTFSVPLSSIIEN 486
            D     ++ ++++
Sbjct: 476 TDAMQTSVTDLLKH 489


>gi|134095019|ref|YP_001100094.1| NADH dehydrogenase I subunit M [Herminiimonas arsenicoxydans]
 gi|133738922|emb|CAL61969.1| NADH-quinone oxidoreductase subunit M [Herminiimonas
           arsenicoxydans]
          Length = 496

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 225/493 (45%), Positives = 328/493 (66%), Gaps = 12/493 (2%)

Query: 4   PFLSIVTFLPF-LGVFVILFSSYLGCGRRSFFGVALGIS----TINFIFSLFVWSVFDKG 58
           P LS+  +LP   G+ VI        GR     VA  +S     ++F+ +L +   FD  
Sbjct: 7   PLLSLAIWLPIAFGIVVI------ALGRDDNPNVARSVSLVGAIVSFLVTLPLIQKFDNA 60

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
               Q +E + WID F  +Y LGVDG+S+  VVLT F+T F +++ W+ I++   +YM A
Sbjct: 61  AHGMQFVEKFKWIDIFNINYSLGVDGLSMWFVVLTAFITIFVVIAGWEVIEKRVGQYMGA 120

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+L  ++IG F +LD LLFY+FFE++LIPMF+IIGVWGG+ R+YA+ KFFLYTFFGS+ 
Sbjct: 121 FLILSGLMIGVFCALDGLLFYVFFESTLIPMFIIIGVWGGANRVYASIKFFLYTFFGSLL 180

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A++ + ++   S  I  +     P   Q  +++AF  +FA+K+PM+P HTWLP+AHV
Sbjct: 181 MLVALLYLYFKSGHSFDILAWHTLPLPMDAQILIFLAFLMAFAVKVPMWPVHTWLPDAHV 240

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA IMLK+G YG +RF LP+ P AS Y +  +  LSLIA+IY  LV++VQ 
Sbjct: 241 EAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHYLSGFMITLSLIAVIYIGLVALVQK 300

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSIAHMG+VT+G F      V+G + QM+SHG VS A+F C+GV+YDR+HTR
Sbjct: 301 DMKKLVAYSSIAHMGFVTLGFFMFNDMAVQGGIAQMISHGFVSGAMFLCIGVLYDRMHTR 360

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
           +I  YGG+V+ MP++A   ++F+M N GLP TSGF+GEF+VI+   Q +  + +LA+  +
Sbjct: 361 NIADYGGVVNTMPKFAAFFVLFSMGNAGLPATSGFVGEFMVILGAVQYNFWIGLLAATAL 420

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +L A YSLWL ++V+FG      V +LKD++ RE  M+  +A+  +  G+YP P  D   
Sbjct: 421 ILGAAYSLWLAKRVLFGAVANHHVAELKDINKREFLMLGLLAIAVLAMGLYPAPFTDVMQ 480

Query: 478 VPLSSIIENYTLK 490
             ++ ++++  + 
Sbjct: 481 TSVADLLKHVAIS 493


>gi|30249725|ref|NP_841795.1| NADH dehydrogenase subunit M [Nitrosomonas europaea ATCC 19718]
 gi|30180762|emb|CAD85676.1| possible nuoM; transmembrane NADH dehydrogenase I (chain M)
           oxidoreductase protein [Nitrosomonas europaea ATCC
           19718]
          Length = 493

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 222/485 (45%), Positives = 326/485 (67%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LS++ +LP +   ++L           +F +   ++   F+ +L ++S FD   S+ Q
Sbjct: 6   PLLSLIIWLPIIFGLIVLVMGDRNVRAVRWFSLVGAVA--GFLVALPLYSGFDPSTSAMQ 63

Query: 64  MIEYYHWIDYFCS-YHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E+  W +     Y LGVDGIS+ L++L  F+TP  +++ W+ I+E   +YM AFL++ 
Sbjct: 64  FTEHLVWFERLNVFYSLGVDGISMPLIILNCFITPIVVIAGWEVIRERVSQYMGAFLIMS 123

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            +V G F SLD +LFY F+E SLIPMF+IIGVWGG  RIYAA KFFLYT  GS+ ML A+
Sbjct: 124 GVVNGVFSSLDAVLFYSFWETSLIPMFIIIGVWGGPNRIYAAIKFFLYTLLGSLLMLVAL 183

Query: 183 VVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           + +      S SI+D Y     P + Q  ++IAF  +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 184 IYLYQTSGGSFSILD-YHHLPLPMTAQILIFIAFMLAFAVKVPMWPVHTWLPDAHVEAPT 242

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA I+LK+GGYG +RF LP+ P AS   + ++  LSLIA++Y  +V+++Q D+KK
Sbjct: 243 GGSVVLAAILLKLGGYGFLRFSLPVAPDASHELSGILIVLSLIAVVYIGIVALMQQDMKK 302

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSS++HMG+VT+G F     G+EGAM QM+SHG +S A+F CVGV+YDRLH+R I  
Sbjct: 303 LIAYSSVSHMGFVTLGFFLFNAYGIEGAMVQMISHGFISGAMFLCVGVLYDRLHSRQIAD 362

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP +A + M+F MAN GLPGTSGF+GEF+VIM   + +      A+  ++L A
Sbjct: 363 YGGVVNRMPVFAALFMLFAMANAGLPGTSGFVGEFMVIMGSIEVNFWYGFFAALTLILGA 422

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LW+Y+KV+FG      V+ ++D+S RE  ++  +AV+ +  GIYP+P+ +   V + 
Sbjct: 423 SYTLWMYKKVIFGEVTNSNVEGMQDISSREFLILAILAVMVLGLGIYPLPLTEVMHVTVD 482

Query: 482 SIIEN 486
           +++E+
Sbjct: 483 NLLEH 487


>gi|15836920|ref|NP_297608.1| NADH dehydrogenase subunit M [Xylella fastidiosa 9a5c]
 gi|9105140|gb|AAF83128.1|AE003884_13 NADH-ubiquinone oxidoreductase, NQO13 subunit [Xylella fastidiosa
           9a5c]
          Length = 501

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 325/486 (66%), Gaps = 18/486 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N P LS++ +LP +G  +IL    +   R +   VAL      F FSL++   +D  + +
Sbjct: 3   NWPLLSLLIWLPIIGGLLILGLRNVHVARWAALAVALA----TFGFSLYLLGGYDIAKDA 58

Query: 62  FQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI  Y   Y+LGVDGI++ LV+LTT +T   ++ SW +I +   +Y+ AFL+
Sbjct: 59  LQFVEQHVWIQTYSIGYNLGVDGIAVALVLLTTLVTVLVLIGSWGAINQRVPQYVAAFLI 118

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE + IG F + D +LFY+FFEA LIPMF+IIGVWGG  RIYAA KFFLYTF GS+ ML 
Sbjct: 119 LEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAIKFFLYTFLGSVLMLV 178

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            ++ +  +  +  + DLYAM +     Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 179 GLIYLYLKGGSFQLADLYAM-QLSAKEQTWLFFAFLIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P AS  FA V+  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLIAVIYVGLVALVQEDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+GIF               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLIAYSSIAHMGFVTLGIFISFTLVRDFGNTDAARLGLQGAMVQMISHGFVSGAMFTCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A   M F MAN GLPGTSGF+GEF+VI++ FQ    
Sbjct: 358 VLYDRMHTRCIADYGGVVNVMPWFATFAMFFYMANAGLPGTSGFVGEFMVILASFQKHPL 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           VA  A   +V++A Y+LWLY++V FG      V  LKD+++RE  ++   A+  +  G+Y
Sbjct: 418 VAFGAGATLVITAAYTLWLYKRVFFGEVANTHVAALKDINIREASVLALFAIGVLVLGLY 477

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 478 PKPLID 483


>gi|295311691|ref|YP_003587350.1| NADH dehydrogenase subunit 4 [Cucurbita pepo]
 gi|259156819|gb|ACV96680.1| NADH dehydrogenase subunit 4 [Cucurbita pepo]
          Length = 495

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 237/484 (48%), Positives = 323/484 (66%), Gaps = 7/484 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGR-RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS +   P LG  V+LF   +   R R    + L  S I F++SL +W  FD   + FQ 
Sbjct: 12  LSGLILCPVLGSIVLLF---IPNERIRLIRLIGLCASLITFLYSLVLWIQFDPSTAKFQF 68

Query: 65  IEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   W+ Y   ++ LG+DGIS+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E 
Sbjct: 69  VESLRWLPYENINFSLGIDGISLFFVILTTFLIPICILVGWSGMRSYGKEYIIAFLICEF 128

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAI 182
           ++I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI
Sbjct: 129 LMIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAI 188

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           +++  +  T+ +  +   ++F    Q ++WIAFF SFA+K+PM P H WLP AHV+APTA
Sbjct: 189 LLILLQTGTTDL-QILLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTA 247

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI+LK+G YG +RF +P+FP A+    P I+ LS IAIIY SL ++ Q D+KK+
Sbjct: 248 GSVILAGILLKLGTYGFLRFSIPMFPEATLCATPFIYTLSAIAIIYTSLTTLRQIDLKKI 307

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHM  VTIGIFS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  Y
Sbjct: 308 IAYSSVAHMNLVTIGIFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYY 367

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A 
Sbjct: 368 GGLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAA 427

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           YSLWLY +VV G  K + + +  DL+ RE  +  P  V  V  G++P    D     +S+
Sbjct: 428 YSLWLYNRVVSGNLKTDFLHKFSDLNGREVFIFIPFLVGVVRMGVHPKVFPDYMHTSVSN 487

Query: 483 IIEN 486
           ++++
Sbjct: 488 LVQH 491


>gi|94309884|ref|YP_583094.1| NADH dehydrogenase subunit M [Cupriavidus metallidurans CH34]
 gi|93353736|gb|ABF07825.1| NADH:ubiquinone oxidoreductase, membrane subunit M [Cupriavidus
           metallidurans CH34]
          Length = 488

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 330/485 (68%), Gaps = 9/485 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFF--GVALGISTINFIFSLFVWSVFDKGRSSF 62
           LS   +LP F G+ V++F    G  R   F   +AL  + ++F  +L +   FD   ++ 
Sbjct: 3   LSFAIWLPIFFGLVVLMF----GSDRSKCFVRWMALFGAIVSFAVTLPLIFHFDTASAAM 58

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q +E   WI+ F   YHLGVDGIS+  VVLT F+T   ++S+W+ I E   EYM +FL+L
Sbjct: 59  QFVEQATWIERFNIQYHLGVDGISMWFVVLTAFITVIVVISAWEVITERVAEYMASFLIL 118

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
             +++G F SLD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L  
Sbjct: 119 SGLMVGVFSSLDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTL-V 177

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
            ++  + K  S  I  +  +K   + Q  +++AFF +FA+K+PM+P HTWLP+AHV+APT
Sbjct: 178 ALLYLYNKTGSFDILTWHQAKLTMNEQIAIFLAFFMAFAVKVPMWPVHTWLPDAHVEAPT 237

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA IMLK+G YG +RF LP+ P AS Y AP I  +SLIA+IY  LV++VQ D+KK
Sbjct: 238 GGSVVLAAIMLKLGAYGFLRFSLPIAPDASHYLAPFIITISLIAVIYIGLVALVQADMKK 297

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           L+AYSSIAHMG+VT+G F   + G+EG + QM+SHG VS A+F C+GV+YDR+H+R I  
Sbjct: 298 LVAYSSIAHMGFVTLGFFIFNEIGIEGGIIQMISHGFVSGAMFLCIGVLYDRVHSRQIAD 357

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A
Sbjct: 358 YGGVVNVMPKFAALSVFFAMANCGLPATSGFVGEFMVILGAVKFNFWIGLLAATALIFGA 417

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            YSLW+ ++V+FG    E V++L DL+ RE  M+  +A++T++ G+YP P  D     + 
Sbjct: 418 AYSLWMVKRVIFGDIVHEHVRELVDLNKREFFMLGLLAIMTLYMGLYPKPFTDVMHASVV 477

Query: 482 SIIEN 486
           +++ +
Sbjct: 478 NLLSH 482


>gi|82702232|ref|YP_411798.1| NADH dehydrogenase subunit M [Nitrosospira multiformis ATCC 25196]
 gi|82410297|gb|ABB74406.1| NADH dehydrogenase subunit M [Nitrosospira multiformis ATCC 25196]
          Length = 495

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 228/489 (46%), Positives = 330/489 (67%), Gaps = 12/489 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRSS 61
           P LS+V +LP L    +L +   G  R +     +AL  S   F+ ++ +++ FD   S+
Sbjct: 6   PLLSLVIWLPILAGVAVLAT---GGDRNAPLARMIALVGSIAGFLVAIPLYTSFDPSTST 62

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E + WI+ F   YHLGVDGI++ L++L  F TP  +++ W+ I     +YM AFL+
Sbjct: 63  MQFVESHVWIERFNVHYHLGVDGIAMPLILLNAFTTPLVVIAGWEVITRRVSQYMGAFLI 122

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +  +V G F SLD +LFY+F+EASLIPMF+IIGVWGG  R+YAA KFFLYT  GS+ ML 
Sbjct: 123 MSGIVNGVFSSLDAILFYVFWEASLIPMFLIIGVWGGPNRVYAAIKFFLYTLLGSLLMLV 182

Query: 181 AIVVMCWEKKTS-SIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           A + +    + S SI++ +   K P S+  Q  ++IAF  +FA+K+PM+P HTWLP+AHV
Sbjct: 183 AFIYLYQVSEGSFSILEYH---KLPLSMASQILIFIAFLLAFAVKVPMWPVHTWLPDAHV 239

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA I+LKMGGYG +RF LP+ P AS   A ++  LSLIA++Y  LV++VQ 
Sbjct: 240 EAPTGGSVVLAAILLKMGGYGFLRFSLPILPDASHQLAGMMIALSLIAVVYIGLVALVQA 299

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKLIAYSS+AHMG+VT+G F     G+EGAM QM+SHG +S+A+F C+GV+YDRLH+R
Sbjct: 300 DMKKLIAYSSVAHMGFVTLGFFLFNNYGLEGAMVQMVSHGFISAAMFLCIGVMYDRLHSR 359

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+ H MP +A   M+F MAN GLPGTSGF+GEF+VIM+  + +   A LA+  +
Sbjct: 360 QIVDYGGVAHRMPAFAAFFMLFAMANSGLPGTSGFVGEFMVIMASMKVNFWYAFLAATTL 419

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +  A Y+LW+Y++V+FG      V+++KD+  RE  ++  +AV  +  G+YP+P+ +   
Sbjct: 420 ITGAAYTLWMYKRVIFGAVVHPAVEEMKDIGAREILVLTVLAVAVLGMGLYPLPLTEVMH 479

Query: 478 VPLSSIIEN 486
             +  ++ +
Sbjct: 480 TTVDDLLAH 488


>gi|38605710|sp|P27572|NU4M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
          Length = 495

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 233/483 (48%), Positives = 322/483 (66%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS +   P LG  ++LF        R    + L +S I F++SL +W  FD   + FQ +
Sbjct: 12  LSGLILCPVLGSIILLFIP--NSSIRLIRLIGLCVSLITFLYSLVLWIQFDPSTAKFQFV 69

Query: 66  EYYHWIDYFCSY-HLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   W+ Y   + ++G+DG+S+  V+LTTFL P CIL  W  ++   +EY+IAFL+ E +
Sbjct: 70  ESLRWLPYENIHLYMGIDGLSLFFVILTTFLIPICILVGWSGMRSFGKEYIIAFLICEFL 129

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIV 183
           +I  F  LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+
Sbjct: 130 MIAVFCMLDLLLFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSVFMLLAIL 189

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
           ++  +  T+ +  +   ++F    Q  +WIAFF SFA+K+PM P H WLP AHV+APTAG
Sbjct: 190 LILLQTGTTDL-QILLTTEFSERRQILLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAG 248

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LAGI+LK+G YG +RF +P+FP A+  F P I+ LS IAIIY SL ++ Q D+KK+I
Sbjct: 249 SVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKII 308

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSS+AHM  VTIG+FS    G+ G++  MLSHGLVSSALF CVGV+YDR  TR +  YG
Sbjct: 309 AYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYG 368

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           GLV  MP ++ +   FT+ANM LPGTS FIGEFL+++  FQ ++ VA L + G++L A Y
Sbjct: 369 GLVSTMPNFSTIFFFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLRALGMILGAAY 428

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLWLY +VV G  K + + +  DL+ RE  +  P  V  V+ G+YP    D     +S++
Sbjct: 429 SLWLYNRVVSGNLKPDFLYKFSDLNGREVFIFLPFLVGVVWMGVYPKVFLDCMHTSVSNL 488

Query: 484 IEN 486
           +++
Sbjct: 489 VQH 491


>gi|56478188|ref|YP_159777.1| NADH dehydrogenase subunit M [Aromatoleum aromaticum EbN1]
 gi|56314231|emb|CAI08876.1| NADH dehydrogenase I, chain M [Aromatoleum aromaticum EbN1]
          Length = 493

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/491 (45%), Positives = 334/491 (68%), Gaps = 12/491 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGR 59
            LPFLS+  ++P LG  ++L +   G  R +     +A+ ++   F+ +L ++S FD   
Sbjct: 3   GLPFLSLAIWVPILGGLLVLAT---GSDRNAPLARFLAMLVAIAGFLVTLPLYSQFDAST 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           S+ Q +E   WI  F  +YHLGVDGIS+L ++L  F+T   +++ W+ I+E   +YM AF
Sbjct: 60  SAMQFVEILPWIPRFNINYHLGVDGISVLFILLNAFITIVVVIAGWQVIREKVAQYMAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L++  ++ G F +LD +LFY FFEASLIP++++IG+WGG+ R+YAA KFFLYT  GS+ M
Sbjct: 120 LIMSGLMNGIFSALDAILFYTFFEASLIPLYLVIGIWGGTNRVYAAIKFFLYTLLGSLLM 179

Query: 179 LFAIVVMCWEKKTS-SIIDLYAM--SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           L A++ +  E   S +I+D + +     P ++ +W   AF  +FA+K+PM+P HTWLP+A
Sbjct: 180 LVALLYLFMEAGGSFNILDWHQLPLGMGPQTLIFW---AFLIAFAVKVPMWPVHTWLPDA 236

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APT GSV LA I LK+G YG +RF LP+ P A+Q  AP++  LSLIA+IY   V++V
Sbjct: 237 HVEAPTGGSVVLAAIALKLGAYGFLRFSLPIVPDAAQAMAPMMIALSLIAVIYIGFVAIV 296

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           QTD+KKL+AYSSIAHMG+VT+G F     G+EGA+ QM+SHG VS A+F C+GV+YDR+H
Sbjct: 297 QTDMKKLVAYSSIAHMGFVTLGFFMFNTLGLEGALVQMVSHGFVSGAMFLCIGVLYDRMH 356

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           TR+I  YGG+V  MP++A   M+F+MAN GLPGTSGF+GEF+V++   Q +  VA  A+ 
Sbjct: 357 TRNIADYGGVVKVMPKFAAFFMLFSMANAGLPGTSGFVGEFMVVLGAVQFNFWVAFGAAI 416

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
            ++L A Y+LW+Y++V+FGV     V QL D++ RE   +  +A+  +  G+YP P  + 
Sbjct: 417 TLILGAAYTLWMYKRVMFGVVGNSHVAQLNDINGREFAFLGVLALCVLAMGLYPYPFTEV 476

Query: 476 FSVPLSSIIEN 486
               ++ ++ +
Sbjct: 477 MHASVNELLRH 487


>gi|226348829|gb|ACO50733.1| NADH dehydrogenase subunit 4 [Micromonas pusilla CCMP1545]
          Length = 487

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 239/485 (49%), Positives = 325/485 (67%), Gaps = 5/485 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           PFL  +   P +G  V+           S   VAL ++ +NF+ ++ +W VFD   + FQ
Sbjct: 3   PFLPFLVLCPLVGAGVVALLPR--KATTSIQAVALSVALVNFVVAVALWMVFDTTTAKFQ 60

Query: 64  MIEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +    W+     +  LGVDGIS+L +VLTTFL P C+L  W +I    +EY IAFL+LE
Sbjct: 61  FVSTLSWLPLGNMTVSLGVDGISLLFLVLTTFLVPVCLLVGWVNIHTKVKEYCIAFLLLE 120

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFA 181
             +I  F  LD+LLFY+FFE+ L+PMFVIIGVWG  ER I AAY+FFLYT  GS+ ML A
Sbjct: 121 VGMIAVFCLLDLLLFYVFFESVLLPMFVIIGVWGSRERKIRAAYQFFLYTLIGSVLMLVA 180

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           +++M ++  T+  + +  +S F    Q  +W+AFF SFA+K+PM P H WLP AHV+APT
Sbjct: 181 LLLMYFQVGTTD-LQVLLVSHFSDKRQVLLWLAFFASFAVKVPMVPVHIWLPEAHVEAPT 239

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAGI+LK+G YG +RF +PLFP+AS YF P+++ LSLI IIYASL ++ Q D+KK
Sbjct: 240 AGSVILAGILLKLGTYGFLRFSIPLFPMASLYFMPLVYTLSLIGIIYASLTTLRQIDLKK 299

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           +IAYSS+AHMG+VT+G+FS    G+EGA+  MLSHG V+SALF C+G +YDR HTR +  
Sbjct: 300 IIAYSSVAHMGFVTLGLFSLNLQGIEGALILMLSHGFVASALFLCIGCVYDRTHTRVLQY 359

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGGLVH MP +A   +VFTM N+ LPGTS F+GEFL+++  FQ +   A LA+ G+VL  
Sbjct: 360 YGGLVHVMPLFAFFFLVFTMGNLSLPGTSSFVGEFLILVGTFQTNTLAATLAATGMVLGG 419

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            YS+WLY +VVFG  K   +    DLS RE  +  P  V  ++ G +P    DT  + +S
Sbjct: 420 AYSVWLYNRVVFGSLKPMYLASAADLSRREFWLFLPFVVAILWMGFFPGVFLDTMHLSVS 479

Query: 482 SIIEN 486
           ++I++
Sbjct: 480 NLIQH 484


>gi|237746739|ref|ZP_04577219.1| NADH-quinone oxidoreductase subunit M [Oxalobacter formigenes
           HOxBLS]
 gi|229378090|gb|EEO28181.1| NADH-quinone oxidoreductase subunit M [Oxalobacter formigenes
           HOxBLS]
          Length = 497

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 325/487 (66%), Gaps = 9/487 (1%)

Query: 4   PFLSIVTFLP-FLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRS 60
           P LS+  + P F G+ ++L     G   R+ F   +AL  +  +F+ +L +   FD+   
Sbjct: 10  PILSLAIWCPVFFGLLILL----TGKDERATFVRYLALLGAAASFVVTLPLAFHFDRSAH 65

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E + WI  F   Y LGVDGIS+  V+LT  +T   +L+ WK IQ    +YM AFL
Sbjct: 66  GLQFVERHSWIRLFRVEYALGVDGISMWFVLLTALITLIVVLAGWKVIQTQVAQYMGAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L  ++IG F + D LLFY+FFEA+LIPMFVIIG+WGG  R+YAA+KFFLYTFFGS+ ML
Sbjct: 126 ILSGLMIGVFSTFDGLLFYVFFEATLIPMFVIIGIWGGERRVYAAFKFFLYTFFGSLPML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            AI+ +  +  + +I   Y  +  P  +Q W++IAF  +FA+K+PM+P HTWLP+AHV+A
Sbjct: 186 IAILYLYLQTNSFNIFVWYK-APLPLYVQIWLFIAFLTAFAVKVPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA IMLK+G YG IRF LP+ P AS+Y A ++  LSL+A+ Y  LV++VQ D+
Sbjct: 245 PTGGSVILAAIMLKLGAYGFIRFSLPILPDASRYLAWLMIVLSLVAVTYIGLVALVQKDM 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSIAHMG+VT+G F      V+GA+ QM+SHG VS+A+F CVGV+YDR+HTR I
Sbjct: 305 KKLIAYSSIAHMGFVTLGFFLFENITVDGALVQMISHGFVSAAMFLCVGVLYDRMHTRHI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGG+VH MPR+A   ++F  AN GLPGTSGF+GE +VI+     +  VA + +  ++L
Sbjct: 365 GDYGGVVHVMPRFAAFFVLFAFANCGLPGTSGFVGEVMVILGAVSVNVWVAAVGALALIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+LW+ ++V++G  + E+V  LKD+  RE  ++  +    +  GIYP  + D   V 
Sbjct: 425 GASYTLWMIKRVLYGPIESEEVASLKDIGAREFFILAVLGAFVLAIGIYPAWVTDVMQVS 484

Query: 480 LSSIIEN 486
           +S ++ +
Sbjct: 485 VSDLLAH 491


>gi|300113277|ref|YP_003759852.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Nitrosococcus watsonii C-113]
 gi|299539214|gb|ADJ27531.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosococcus watsonii C-113]
          Length = 504

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 226/498 (45%), Positives = 326/498 (65%), Gaps = 17/498 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            L  LS+V +LP LG F++L +   G        ++LGIS + F+ S  +++ FD   ++
Sbjct: 4   GLSLLSLVIWLPILGGFLVLAA---GNHVERVRWLSLGISGLTFVVSWSLYTGFDTSTAA 60

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   W++ F   YHLG+DGIS+ L++LTTF T   +++ W+ I+    +YM +FL+
Sbjct: 61  MQFQEKLSWVETFDVYYHLGIDGISMPLIILTTFSTVLVVVAGWRVIEHKLAQYMASFLI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++ G F +LD +LFY FFE  LIP+F+IIG+WGG  RIYA  KFFLYTF GS+F L 
Sbjct: 121 MEGLMNGVFAALDAVLFYFFFEGMLIPLFLIIGIWGGPNRIYATLKFFLYTFLGSVFFLL 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +       SI++ + +       Q  +++AF  +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 181 ALLYLRSVTGGFSILEFHQV-PLDMQAQIGIFLAFLLAFAVKVPMWPVHTWLPDAHVEAP 239

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I LK+G YG +RF LP+ P AS     +I  LSLIA++Y  LV++VQ D+K
Sbjct: 240 TGGSVILAAITLKIGAYGFMRFSLPITPDASMALNWLIITLSLIAVVYIGLVAIVQEDLK 299

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+G+F             G   G+EGA+ QM+SHGLVS+A+F CVG
Sbjct: 300 KLIAYSSIAHMGFVTLGLFIAFAIFSQSIEGDGALLGLEGALVQMISHGLVSAAMFLCVG 359

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDRL TR I  YGG+V+ MP +A +M++F MAN+GLPGTSGF+GEFLVI+  FQ    
Sbjct: 360 VLYDRLRTRLIKDYGGVVNRMPIFASLMVLFAMANVGLPGTSGFVGEFLVILGAFQADFW 419

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
            A  AS  ++L A Y+LW+ ++VVFG    +KV  ++DL+ RE  ++  +A   +  G++
Sbjct: 420 YAFFASMTLILGATYTLWMIKRVVFGDIANDKVATMEDLNSREFLVLGTLAAAVLLLGVW 479

Query: 469 PVPIRDTFSVPLSSIIEN 486
           P P+ +     L  ++  
Sbjct: 480 PQPLLEVMHTSLEHLLSQ 497


>gi|299066345|emb|CBJ37529.1| NADH-quinone oxidoreductase subunit M [Ralstonia solanacearum
           CMR15]
          Length = 488

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 331/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S ++F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLVSFVITLPLITRFDKSTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I E   +YM AFL+L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  R+YAA KFFLYT  GS+  L A++
Sbjct: 121 LMIGVFAALDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAIKFFLYTLLGSLLTLVALL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQV-KLSMNEQILLFIAFFLAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   +  I  +SLIA+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPGASHSLSAFIIAISLIAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIVDYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGAVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +L+DL++RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVAHKHVAELQDLNVREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|114321107|ref|YP_742790.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227501|gb|ABI57300.1| NADH dehydrogenase subunit M [Alkalilimnicola ehrlichii MLHE-1]
          Length = 501

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/497 (44%), Positives = 328/497 (65%), Gaps = 16/497 (3%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
            LS++ +LP LG   ++        R  +   ALGI+ + F+ SL ++  F+ G    Q 
Sbjct: 6   LLSLLIWLPILGGVAVMVLGDSAPDRVRW--TALGIALVTFLASLPLYFGFEPGTHEMQF 63

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   W+      YHLGVDGIS+ L++LTTF T   +++ W+ I+    +Y+ AFL++E 
Sbjct: 64  VEQREWVSALQVYYHLGVDGISMPLIILTTFCTLLVVIAGWEVIKYRPSQYLAAFLIMEG 123

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           +++G F +LD +LFY+FFEA L+PMF+IIG+WGG+ RIYA  KFFLYTF GS+ ML A++
Sbjct: 124 IMVGVFSALDAILFYVFFEAMLVPMFLIIGIWGGANRIYATIKFFLYTFLGSVLMLVAVI 183

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            +  +  +  I+D++ +     + Q  +++AF  +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 184 YLRLQAGSFGILDMHGLD-LGLTAQVLIFLAFLGAFAVKVPMWPVHTWLPDAHVEAPTGG 242

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+GGYG +RF LP+ P AS     +I  +SL+A+ Y  LV+MVQ D+KKLI
Sbjct: 243 SVILAAIMLKIGGYGFLRFSLPITPEASMTLDWLIILMSLVAVAYIGLVAMVQKDMKKLI 302

Query: 304 AYSSIAHMGYVTIG---IFSGMKSG---------VEGAMFQMLSHGLVSSALFFCVGVIY 351
           AYSSIAHMG+VT+G   IF  M +G         ++G M QM+SHG +S+A+F CVGV+Y
Sbjct: 303 AYSSIAHMGFVTLGFFLIFQIMANGGGEQGGMLALQGGMVQMISHGFISAAMFLCVGVLY 362

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+H+R I  YGG+++ MP +    ++F MAN GLPGTSGF+GEF+VI++ FQ +   A 
Sbjct: 363 DRMHSRQIADYGGVINTMPWFGAFFVLFAMANAGLPGTSGFVGEFMVILAAFQANFWYAF 422

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
           +A   +VL A YSLW+ ++V+FG    E V +L+D++ RE  ++  +A + +  G++P P
Sbjct: 423 VAGTTLVLGAAYSLWMVKRVIFGEVANENVAKLEDVNRREVLVLGLLAAMVLLLGLWPAP 482

Query: 472 IRDTFSVPLSSIIENYT 488
           + +     L  ++   T
Sbjct: 483 LVEVMEPSLLHLLNQVT 499


>gi|323398660|ref|YP_004222735.1| NADH dehydrogenase subunit 4 [Glaucocystis nostochinearum]
 gi|321401353|gb|ADW83107.1| NADH dehydrogenase subunit 4 [Glaucocystis nostochinearum]
          Length = 488

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/468 (48%), Positives = 319/468 (68%), Gaps = 13/468 (2%)

Query: 12  LPFLGVFVILF-SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW 70
           +PFLG  +I F ++ L   + S F     I  + F  SLF W  FD     FQ +   +W
Sbjct: 14  IPFLGAVIIFFINNDLFIKKLSLF-----IFFVTFQLSLFFWIFFDNSVYQFQFLNSINW 68

Query: 71  IDYFCSYH-LGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAF 129
           I     Y+ +G+DGIS+  ++LTTFL P C+L+SW SI++NF+E++I FL+LES++I +F
Sbjct: 69  IPSENFYYTVGIDGISLFFIILTTFLIPICVLASWDSIKKNFKEFVICFLILESILILSF 128

Query: 130 LSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWE 188
             LD+LLFYIFFE+ LIPMF+IIG+WG  ER I AAY FFLYT  GS+FML  I+++ +E
Sbjct: 129 SVLDILLFYIFFESILIPMFLIIGIWGSRERKIRAAYYFFLYTLVGSLFMLLGILLIYFE 188

Query: 189 KKTSSIIDLYAMS--KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
             T+   DL  +S  KF    Q  +W+AFF SF++K+PM PFH WLP AHV++PTAGS+ 
Sbjct: 189 TGTT---DLQTLSFIKFSEKRQLLLWLAFFASFSVKVPMIPFHIWLPEAHVESPTAGSLV 245

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF L LFP A+ YF P++F + +I I+Y SL ++ Q D+KK+IAYS
Sbjct: 246 LAGILLKLGTYGFLRFSLNLFPWATIYFTPLVFTMGVIGIVYGSLTTLRQIDLKKIIAYS 305

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +V +GIF+    G+EG++  MLSHG+VS ALF  +GV+YDR  +R +  Y GLV
Sbjct: 306 SVAHMNFVVLGIFALNLQGIEGSILLMLSHGIVSPALFLAIGVLYDRYKSRILNYYSGLV 365

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP +A+    FT+AN+ LP TS F+GEFLV++  F+ +   A +A+ G++L A YSLW
Sbjct: 366 QVMPLFAIFFGFFTLANISLPTTSSFVGEFLVLLGAFRYNTIAAFIATLGIILGASYSLW 425

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           LY +V+FG  K   +    DL+ RE  +  P+ +++++ GIYP P  +
Sbjct: 426 LYNRVIFGNIKVYYLSYFYDLNRRETFLFIPLVLISLWMGIYPTPFLN 473


>gi|291285969|ref|YP_003502785.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290883129|gb|ADD66829.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 499

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/490 (45%), Positives = 331/490 (67%), Gaps = 14/490 (2%)

Query: 6   LSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LSI+ F P +  +F+++F      G +S    A   S I FI +L + + FDK     Q 
Sbjct: 6   LSILIFFPLVAALFILIFFR----GGKSTMWAAFVASVIEFIITLPLMANFDKSNPGMQF 61

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI      Y +GVDGISIL++ LTT LT   IL S+  IQ+  +E+ IA LVLE+
Sbjct: 62  VEKLDWIPALGIQYSVGVDGISILMIFLTTLLTAIAILGSFTYIQKRQKEFYIAMLVLET 121

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
            ++G FL+LD  LFYI +EA LIPM++IIGVWGG  RIYAA KFFLYTF GS+ M+ AI+
Sbjct: 122 GMVGVFLALDFFLFYILWEAMLIPMYLIIGVWGGKRRIYAAVKFFLYTFAGSVLMMIAII 181

Query: 184 VMCWE------KKTSSIIDLYAM-SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            + ++      + T  I+ + A  + +  S Q  ++ AFF  FAIK+PMFP HTWLP+AH
Sbjct: 182 ALYFKHGSITGEYTFDILKITAQHASYGMSFQMLIFAAFFLGFAIKVPMFPLHTWLPDAH 241

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APTAGSV LAG++LKMG YG +RF LP+ PLAS    P +  +S+IAIIY +LV+MVQ
Sbjct: 242 VEAPTAGSVILAGVLLKMGTYGMLRFCLPMTPLASIKLMPFVAVMSVIAIIYGALVAMVQ 301

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            DIKKL+AYSS++HMG+VT+GI++  +SG+EG + QM +HG+++ ALF  +G++Y+R HT
Sbjct: 302 KDIKKLVAYSSVSHMGFVTLGIYALNQSGIEGGILQMFNHGIITGALFLLIGLVYERTHT 361

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGG+  ++P +A + ++FTM ++GLP    FIGEFLV++  FQ  +  A+LA+ G
Sbjct: 362 REIADYGGIAKSVPVFATIFLIFTMGSIGLPSMGAFIGEFLVLVGAFQAFSDWAILAAIG 421

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           V+ SA+Y LW++++ VF  S   K ++LKD++LRE   ++P+ ++  + G+YP    +  
Sbjct: 422 VIFSAVYMLWVFQR-VFYQSLNTKWEKLKDMNLREVIYIFPLLIIVFWVGMYPETFTNYM 480

Query: 477 SVPLSSIIEN 486
              +  ++++
Sbjct: 481 HASVQHLVDH 490


>gi|71906600|ref|YP_284187.1| NADH dehydrogenase subunit M [Dechloromonas aromatica RCB]
 gi|71846221|gb|AAZ45717.1| NADH dehydrogenase subunit M [Dechloromonas aromatica RCB]
          Length = 494

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/493 (44%), Positives = 329/493 (66%), Gaps = 12/493 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSS 61
           P LS+  ++P     V+L +   G  R +     L +  +   F+ ++ +W+ FD     
Sbjct: 5   PLLSLAIWIPIFAGLVVLTT---GGDRNAPLARMLSLVGAVAAFLITIPLWTGFDVANGG 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI  F  +YHLGVDGIS+L VVL  F+T   + + W+ IQ    +Y  AFL+
Sbjct: 62  MQFVELKTWIPRFNINYHLGVDGISMLFVVLNAFITIIVVAAGWEVIQNKVAQYNAAFLI 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +  ++ G F SLD +LFY+FFEASLIP+++IIGVWGG  R+YAA+KFFLYT FGS+  L 
Sbjct: 122 MSGLMNGIFTSLDGVLFYVFFEASLIPLYLIIGVWGGPNRVYAAFKFFLYTLFGSLLFLL 181

Query: 181 AIVVMCWEKKTS-SIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           A++ +  +   S SI++ +   K P ++  Q W+++AF  +FA+K+PM+P HTWLP+AHV
Sbjct: 182 ALMYLFIQSGGSFSILEWH---KLPIALGPQIWLFLAFLIAFAVKVPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GS+ LA I LK+G YG +RF LP+ P AS   + ++  LSLIA++Y   V++VQ 
Sbjct: 239 EAPTGGSIVLAAIALKLGAYGFLRFSLPIAPDASHELSGLVVALSLIAVVYIGFVALVQE 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSIAHMG+VT+G F     G+EGA+ QM+SHG VS A+FFC+GV+YDR+H+R
Sbjct: 299 DMKKLVAYSSIAHMGFVTLGFFMFSAMGIEGALVQMVSHGFVSGAMFFCIGVMYDRVHSR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP++A + M+FTMAN GLP TSGF+GEF+VI+   + +  VA  A+  +
Sbjct: 359 QIADYGGVVNTMPKFAALFMLFTMANSGLPATSGFVGEFMVILGAVKFNFWVAFAAASSM 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           ++ A YSLW+Y++V+FG      V +L D+++RE  ++  +AV T++ G+YP P  +   
Sbjct: 419 IVGAAYSLWMYKRVIFGDVANHHVAELSDINMREFAILAVLAVATLWMGVYPQPFTEVMH 478

Query: 478 VPLSSIIENYTLK 490
             ++ ++ +  + 
Sbjct: 479 ASVNDLLHHVAIS 491


>gi|84872473|gb|ABC67282.1| NADH dehydrogenase subunit 4 [Sphagnum fallax]
          Length = 418

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/403 (53%), Positives = 290/403 (71%), Gaps = 3/403 (0%)

Query: 69  HWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIG 127
            W+ Y    +++G+DGIS+  VVLTTFL P CIL    SI+   REYMIAFL+ ES +I 
Sbjct: 3   RWLPYPNIHFYIGIDGISLFFVVLTTFLIPICILVGRSSIKSYKREYMIAFLICESFMIA 62

Query: 128 AFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMC 186
            F  LD+LLFY+FFE+ LIPM +IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + 
Sbjct: 63  VFCMLDLLLFYVFFESVLIPMSIIIGVWGSRQRKIQAAYQFFLYTLLGSVFMLLAILFIP 122

Query: 187 WEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
             +  S+ + +   ++F    Q  +WIAFF SF++K+PM PFH WLP AHV+APTAGSV 
Sbjct: 123 -SQTGSTDLQILLTTEFSERRQILLWIAFFASFSVKVPMIPFHIWLPEAHVEAPTAGSVI 181

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF +P+FP A+ YF P ++ LS+IAIIY SL ++ Q D+KK+IAYS
Sbjct: 182 LAGILLKLGTYGFLRFSIPMFPEATLYFTPFVYALSVIAIIYTSLTTIRQIDLKKIIAYS 241

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +VTIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV
Sbjct: 242 SVAHMNFVTIGMFSLNIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRLVKYYGGLV 301

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP ++ + + FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A YSLW
Sbjct: 302 STMPMFSTIFLFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLW 361

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           LY +V+FG  K + +Q+  DL+ RE  +  P  V  ++ G+YP
Sbjct: 362 LYNRVIFGNFKPKFLQKFSDLNRREVLIFLPFVVGIIWMGVYP 404


>gi|118602287|ref|YP_903502.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567226|gb|ABL02031.1| NADH dehydrogenase subunit M [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 501

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/499 (45%), Positives = 330/499 (66%), Gaps = 17/499 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGR-RSFFGVALGISTINFIFSLFVWSVFDKGR 59
           M    LS++ +LP     +++F   +G  R  +   V++ IS + F+ SL +++ FD   
Sbjct: 1   MQNSLLSLLIWLPIFSSVLVIF---IGNNRVNTARWVSVIISILVFMISLSLYTGFDSST 57

Query: 60  SSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
              Q +E   WI      YH+GVDGIS+ L++LTTF T   I++ W+ I +    YM AF
Sbjct: 58  HLMQFVEKESWILQLNIHYHIGVDGISMPLIILTTFSTILVIVAGWEVIAKRCAHYMAAF 117

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L++E ++IG F SLD +LFY F+EASLIPM +IIG+WGG  R+YA+ KFFLYTF GS+FM
Sbjct: 118 LMMEGLIIGVFSSLDAILFYAFWEASLIPMLLIIGIWGGDNRVYASIKFFLYTFLGSVFM 177

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L + + M  +  +  I+D++ + +     Q +++ AFF +FA+K+PMFP HTWLP+AHVQ
Sbjct: 178 LVSFIYMHNKGGSFLILDMHNL-ELSLEEQSYIFWAFFMAFAVKVPMFPVHTWLPDAHVQ 236

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GSV LA IMLKMGGYG  RF LP+ P AS  F+ +I  LSLIAI+Y   V++VQ D
Sbjct: 237 APTGGSVILAAIMLKMGGYGFFRFSLPITPDASLEFSEIIIVLSLIAIVYIGFVALVQRD 296

Query: 299 IKKLIAYSSIAHMGYVTIGIFS-----------GMKSGVEGAMFQMLSHGLVSSALFFCV 347
           +KKLIAYSSI+HMG+VT+G+F+           G   G+EGAM QM+SHG +S+A+F  V
Sbjct: 297 MKKLIAYSSISHMGFVTLGVFTLFLTYKPDTIEGALLGLEGAMVQMISHGFISAAMFLVV 356

Query: 348 GVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSN 407
           GV+YDRLH+R+I  YGG++++MP++    ++F MAN+GLPGTSGF+GEF+VI+   Q + 
Sbjct: 357 GVLYDRLHSREISTYGGVINSMPKFTGFALLFAMANVGLPGTSGFVGEFMVILGAIQANI 416

Query: 408 TVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGI 467
              VL +  +++ A Y+LW+ ++V +GV     V  LKD++ RE  M+  + V  +  G+
Sbjct: 417 WYGVLVASTLIVGAAYTLWMVKRVFWGVVSNPAVATLKDINAREFSMLAILVVAVLIMGL 476

Query: 468 YPVPIRDTFSVPLSSIIEN 486
           YP P+ +   + +  ++  
Sbjct: 477 YPQPVLELMYISIEHLLHQ 495


>gi|187929281|ref|YP_001899768.1| NADH dehydrogenase subunit M [Ralstonia pickettii 12J]
 gi|187726171|gb|ACD27336.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Ralstonia pickettii 12J]
          Length = 488

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 331/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSVISFVMTLPLITRFDKTTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++++W+ I E   +YM AFL+L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVIAAWEVITERVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F SLD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L A++
Sbjct: 121 LMIGVFASLDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTLVALL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  +++AFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQV-KLSMNEQVLIFLAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   +  I  +SL+A+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLSAFIIAISLVAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +LKDL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVTHKHVAELKDLNCREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|319787431|ref|YP_004146906.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465943|gb|ADV27675.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 501

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 230/486 (47%), Positives = 326/486 (67%), Gaps = 23/486 (4%)

Query: 5   FLSIVTFLPFLG-VFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
            LS++ +LP +G   V+         R S    ALG++ +  + S+ + + FD      Q
Sbjct: 5   LLSVLIWLPIIGGALVLALGDRPAAARWS----ALGVALLTLVLSVGLVTGFDYAAPGLQ 60

Query: 64  MIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +E + WI  Y   Y+LG DGI++ L++LTT +TP  ++ +W+SIQ+   +Y+ AFL+LE
Sbjct: 61  FVEAHAWIPAYDIHYNLGADGIAVALILLTTIVTPLALIGAWESIQKRVNQYVAAFLILE 120

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            + +G F + D +LFY+FFEA LIPMF+IIG+WGG  RIYAA KFFLYTF GS+ ML A+
Sbjct: 121 GVTVGIFAATDAILFYVFFEAMLIPMFLIIGIWGGPRRIYAAMKFFLYTFLGSVLMLVAL 180

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           + +  +  +  + DLYA+   P S   Q W++ AF  +FA+K+PMFP HTWLP+AHV+AP
Sbjct: 181 IYLYLKGGSFQLADLYAL---PLSAKEQTWIFFAFAIAFAVKVPMFPVHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA I LK+GGYG +RF LP+ P A   +A +I  LSLIA+IY  LV++VQ D+K
Sbjct: 238 TAGSVILAAIALKIGGYGFLRFNLPITPDAGHEWAWLIIALSLIAVIYVGLVALVQDDMK 297

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KL+AYSS+AHMG+VT+G F               + G++GAM QM+SHG VS A+F C+G
Sbjct: 298 KLVAYSSVAHMGFVTLGSFIAFTLVRDYGSVDAARLGLQGAMVQMISHGFVSGAMFSCIG 357

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+ + MP +A   M+F MAN GLPGTSGF+GEF++I++ FQ    
Sbjct: 358 VLYDRMHTRRIADYGGVANVMPWFATFSMLFFMANAGLPGTSGFVGEFMIILASFQKHPV 417

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
           +AVLA+  ++ +A Y+LWLYR+V FG      V +LKD++ RE  ++   A  T+ FG++
Sbjct: 418 IAVLAATTLITAAAYTLWLYRRVFFGEVANAHVAELKDINAREVLVLGVFAAGTLLFGLW 477

Query: 469 PVPIRD 474
           P P+ D
Sbjct: 478 PKPLTD 483


>gi|14272190|emb|CAC39487.1| NADH dehydrogenase subunit 4 [Riccia fluitans]
          Length = 418

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 292/403 (72%), Gaps = 3/403 (0%)

Query: 69  HWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIG 127
            W+ Y   ++++G+DGIS+  V+LTTFLTP CIL  + S++   +EYMIAF + ES +I 
Sbjct: 3   RWLPYSNINFYIGIDGISLFFVILTTFLTPICILVGFYSVKSYKKEYMIAFFICESFLIA 62

Query: 128 AFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMC 186
            F SLD+L+FY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + 
Sbjct: 63  VFCSLDLLIFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLMGSLFMLLAILFIF 122

Query: 187 WEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
           ++  T+  + +   ++F    Q  +WIAFF SF++K+PM P H WLP AHV+APTAGSV 
Sbjct: 123 FQTGTTD-LQILLTTEFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVI 181

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF +P+FP A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYS
Sbjct: 182 LAGILLKLGTYGFLRFSIPIFPEATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYS 241

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +VTIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV
Sbjct: 242 SVAHMNFVTIGMFSLNIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLV 301

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP ++ + + FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A YSLW
Sbjct: 302 STMPIFSTIFLFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLW 361

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           LY +VVFG  K   + +  DL+ RE  +  P  V  ++ G+YP
Sbjct: 362 LYNRVVFGNFKPNFILKFSDLNRREVLIFLPFIVGVIWMGVYP 404


>gi|15131109|emb|CAC48230.1| NADH dehydrogenase subunit 4 [Timmia megapolitana subsp. bavarica]
          Length = 415

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 291/403 (72%), Gaps = 3/403 (0%)

Query: 69  HWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIG 127
            W+ Y   ++++G+DGIS+  VVLTTFL P CIL  W SI+   +EYMIAFL+ ES +I 
Sbjct: 3   RWLPYSNINFYIGIDGISLFFVVLTTFLIPICILVGWSSIKSYKKEYMIAFLICESFMIA 62

Query: 128 AFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMC 186
            F  LD+LLFY+FFE+  IPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + 
Sbjct: 63  VFCMLDLLLFYVFFESVSIPMFIIIGVWGSRQRKIQAAYQFFLYTLLGSVFMLLAILFIF 122

Query: 187 WEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
           ++  T+ +  +   ++F    Q  +WIAFF SF++K+PM P H WLP AHV+APTAGSV 
Sbjct: 123 FQTGTTDL-QILLTTEFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVI 181

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF +P+FP A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAY 
Sbjct: 182 LAGILLKLGTYGFLRFSIPMFPEATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYP 241

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +VTIG+FS    G+EG++  MLSHG VSSALF CVGV+YDR  TR +  YGGLV
Sbjct: 242 SVAHMNFVTIGMFSLNIQGIEGSILLMLSHGPVSSALFLCVGVLYDRHKTRLVKYYGGLV 301

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP ++ + + FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A YSLW
Sbjct: 302 STMPMFSTIFLFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLW 361

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
            Y +V+FG  K + +Q+  DL+ RE  + +P  V  ++ G+YP
Sbjct: 362 PYNRVIFGNFKPKFLQKFSDLNRREVLIFFPFIVGVIWMGVYP 404


>gi|14272192|emb|CAC39486.1| NADH dehydrogenase subunit 4 [Lunularia cruciata]
          Length = 418

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 291/403 (72%), Gaps = 3/403 (0%)

Query: 69  HWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIG 127
            W+ Y   ++++G+DGIS+  V+LTTFLTP CIL  + S++   +EYMIAF + ES +I 
Sbjct: 3   RWLPYSNINFYIGIDGISLFFVILTTFLTPICILVGFYSVKSYKKEYMIAFFICESFLIA 62

Query: 128 AFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMC 186
            F SLD+L+FY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + 
Sbjct: 63  VFCSLDLLIFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLMGSLFMLLAILFIF 122

Query: 187 WEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVF 246
           ++  T+  + +   ++F    Q  +WIAFF SF++K+PM P H WLP AHV+APTAGSV 
Sbjct: 123 FQTGTTD-LQILLTTEFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVI 181

Query: 247 LAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYS 306
           LAGI+LK+G YG +RF +P+FP A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYS
Sbjct: 182 LAGILLKLGTYGFLRFSIPMFPEATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYS 241

Query: 307 SIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLV 366
           S+AHM +VTIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV
Sbjct: 242 SVAHMNFVTIGMFSLNIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLV 301

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLW 426
             MP +  + + FT+ANM LPGTS FIGEFL+++  FQ ++ VA LA+ G++L A YSLW
Sbjct: 302 STMPIFPTIFLFFTLANMSLPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLW 361

Query: 427 LYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           LY +VVFG  K   + +  DL+ RE  +  P  V  ++ G+YP
Sbjct: 362 LYNRVVFGNFKPNFILKFSDLNRREVLIFLPFIVGVIWMGVYP 404


>gi|194289171|ref|YP_002005078.1| NADH dehydrogenase subunit m [Cupriavidus taiwanensis LMG 19424]
 gi|193223006|emb|CAQ69011.1| NADH:ubiquinone oxidoreductase complex I, chain M [Cupriavidus
           taiwanensis LMG 19424]
          Length = 488

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/486 (45%), Positives = 331/486 (68%), Gaps = 11/486 (2%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCG---RRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           LS   +LP F G+ ++ F S    G     S FG     S  +F+ +L +   FD+  ++
Sbjct: 3   LSFSIWLPVFFGLLILAFGSDRSPGFVRWMSLFG-----SIASFVVTLPLVFHFDRATAA 57

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI+ F   Y LGVDG+S+  VVLT F+T   ++S+W+ I E   EYM +FL+
Sbjct: 58  MQFVEKASWIERFNIHYLLGVDGLSMWFVVLTAFITVIVVISAWEVITERVAEYMASFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L 
Sbjct: 118 LSGLMVGVFCALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +  +  T  I+  +  +K   + Q  +++AFF +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 178 ALLYLYNKTGTFDILQ-WHQAKLSMNEQIALFLAFFVAFAVKVPMWPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLK+G YG +RF LP+ P AS Y AP I  +SLIA+IY  LV++VQ D+K
Sbjct: 237 TGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHYLAPFIITISLIAVIYIGLVALVQADMK 296

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KL+AYSSIAHMG+VT+G F     GVEG + QM+SHG +S A+F C+GV+YDR+H+R I 
Sbjct: 297 KLVAYSSIAHMGFVTLGFFIFSDIGVEGGIIQMISHGFISGAMFLCIGVLYDRVHSRQIA 356

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++L 
Sbjct: 357 DYGGVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGAVKFNFWIGLLAATALILG 416

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YSLW+ ++V+FG    + V++L DL+ RE  M+  +A++T++ G++P P  D     +
Sbjct: 417 AAYSLWMVKRVIFGDVVHQHVRELADLNKREFVMLGLLAIMTLYMGLHPKPFTDVMHPSV 476

Query: 481 SSIIEN 486
            +++++
Sbjct: 477 VNLLQH 482


>gi|119897699|ref|YP_932912.1| NADH dehydrogenase subunit M [Azoarcus sp. BH72]
 gi|119670112|emb|CAL94025.1| putative NADH-ubiquinone oxidoreductase, chain M [Azoarcus sp.
           BH72]
          Length = 493

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/491 (44%), Positives = 332/491 (67%), Gaps = 12/491 (2%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGR 59
           ++P+LS+  ++P +G  ++L +   G  R +     +AL  S   F+ +L +++ FD   
Sbjct: 3   DIPYLSLAIWVPIIGGLLVLAT---GSDRNAPMARVLALLASIAGFVVTLPLYTGFDVSS 59

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           ++ Q +E   W+  F  +YHLGVDGIS+L V+L  F+T   +++ W+ I+E   +YM AF
Sbjct: 60  AAMQFVEIAPWVPRFNINYHLGVDGISVLFVLLNAFITIMVVIAGWQVIEEKVAQYMAAF 119

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L++  ++ G F +LD +LFY+FFEASLIP++++IG+WGG  R+YAA KFFLYT  GS+ M
Sbjct: 120 LIMSGLMNGIFSALDGILFYVFFEASLIPLYLVIGIWGGPNRVYAAIKFFLYTLLGSLLM 179

Query: 179 LFAIVVMCWEKKTS-SIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           L A++ +  E   S SI+D +   + P +I  Q  ++ AF  +F +K+PM+P HTWLP+A
Sbjct: 180 LIALLYLYMEAGGSFSILDWH---QLPLAIEPQTLIFFAFLIAFGVKVPMWPVHTWLPDA 236

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APT GSV LA I LK+G YG +RF LP+ P A+Q  APV+  LSLIA++Y   V++V
Sbjct: 237 HVEAPTGGSVVLAAIGLKLGAYGFLRFSLPILPDAAQQLAPVVITLSLIAVVYIGFVALV 296

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KKL+AYSSI+HMG+VT+G F      VEGA+ QM+SHG VS A+F C+GV+YDR+H
Sbjct: 297 QADMKKLVAYSSISHMGFVTLGFFMFNPLAVEGALVQMISHGFVSGAMFLCIGVLYDRMH 356

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           +R I  YGG+VH+MP++A   M+F MAN GLP TSGF+GEF+V++   Q +  +A LA+ 
Sbjct: 357 SRQIADYGGVVHSMPKFAAFFMLFAMANAGLPATSGFVGEFMVVLGAVQYNFWIAFLAAT 416

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
            ++L A Y+LW+Y++VVFG    + V +L+D++ RE   +  +A   +  G+YP P  + 
Sbjct: 417 TLILGAAYTLWMYKRVVFGAIGNKHVAELEDINAREFAFLGILAACVLAMGLYPFPFTEV 476

Query: 476 FSVPLSSIIEN 486
               ++ ++ +
Sbjct: 477 MHASVNELLRH 487


>gi|198284334|ref|YP_002220655.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667047|ref|YP_002426996.1| NADH-quinone oxidoreductase, M subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248855|gb|ACH84448.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519260|gb|ACK79846.1| NADH-quinone oxidoreductase, M subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 494

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/489 (46%), Positives = 330/489 (67%), Gaps = 5/489 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGR-RSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           P LS   ++P +G  ++L    +G  R  +   +AL  S + F  ++ +++ FD   ++ 
Sbjct: 5   PLLSYAIWVPIIGGLLVL---AVGDRRPEAARWLALVASLVAFAVTIPLFTGFDTHTAAM 61

Query: 63  QMIEYYHWIDYFCS-YHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q  E   WI      YHLG+DGIS+  ++LT+FLT   ++SSWK++QE   ++M AFL++
Sbjct: 62  QYSERVAWIPSLNIFYHLGIDGISLWFILLTSFLTVLVVISSWKNVQERVAQFMAAFLIM 121

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFA 181
           E ++IG F +LD +LFY+F+EA LIPMF+IIGVWGG  R+YA  KFFLYTF GS+ ML A
Sbjct: 122 EGLMIGVFCALDAILFYVFWEAMLIPMFLIIGVWGGPRRVYATIKFFLYTFLGSVLMLVA 181

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           ++ + +    S  +  +  +    S Q  +++AFF +FA+KIPM+P HTWLP+AHV+APT
Sbjct: 182 LLYLYFHSGDSFSLLEFQKTPLGMSAQTLIFLAFFFAFAVKIPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GSV LA +MLKMG YG +R  LP+ P AS   A ++  LSLIAIIY +LV++VQ D+KK
Sbjct: 242 GGSVILAAVMLKMGAYGFLRLSLPIVPDASHKLAWLMIVLSLIAIIYVALVAIVQEDMKK 301

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFA 361
           LIAYSSIAHMG+VT+G F      +EG + QMLSHG VS+A+F CVGV+YDR+HTR I A
Sbjct: 302 LIAYSSIAHMGFVTLGFFVFNSVAIEGGIIQMLSHGFVSAAMFLCVGVLYDRMHTRSIKA 361

Query: 362 YGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSA 421
           YGG+ + MP +A +MM+F M N+GLPGTSGF+GEF+V++  +Q +  +A+LA+  ++  A
Sbjct: 362 YGGVANVMPVFAALMMLFAMGNVGLPGTSGFVGEFMVVLGTYQVNPWLAILAATSLITGA 421

Query: 422 LYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLS 481
            Y+LWL+++V+FG     +V +LKDL  RE  ++  +A  T+  G++P P  D     + 
Sbjct: 422 GYTLWLFKRVIFGSVVQPEVARLKDLDGREVLVLGTLAAFTLLLGLWPAPFLDIVHSSVQ 481

Query: 482 SIIENYTLK 490
            ++   +L 
Sbjct: 482 HLVTQVSLS 490


>gi|237748879|ref|ZP_04579359.1| NADH-quinone oxidoreductase subunit M [Oxalobacter formigenes
           OXCC13]
 gi|229380241|gb|EEO30332.1| NADH-quinone oxidoreductase subunit M [Oxalobacter formigenes
           OXCC13]
          Length = 497

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/485 (45%), Positives = 321/485 (66%), Gaps = 9/485 (1%)

Query: 4   PFLSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRS 60
           P LS+  + P F G+ V++     G   R+ F   L +  + ++F  +L +   FD+   
Sbjct: 10  PVLSLAIWCPVFFGLLVLV----TGKDERALFVRWLSLLGAVVSFAVTLPLAIHFDRSAH 65

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E + WI  F   Y LGVDGIS+  V+L+  +T   +++ W  IQ+   +YM AFL
Sbjct: 66  GMQFVERHSWIKLFHVEYALGVDGISMWFVLLSALITLIVVIAGWNVIQKQIAQYMGAFL 125

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L  ++IG F + D LLFY+FFEA+LIPMFVIIGVWGG  R+YAA+KFFLYTFFGS+ ML
Sbjct: 126 ILSGLMIGVFSTFDGLLFYVFFEATLIPMFVIIGVWGGERRVYAAFKFFLYTFFGSLPML 185

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
             I+ +  +  + +I   Y  +  P ++Q W++IAF  +FA+K+PM+P HTWLP+AHV+A
Sbjct: 186 IGILYLYLQTNSFNIFTWYN-APIPLNVQIWLFIAFLTAFAVKVPMWPVHTWLPDAHVEA 244

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA +MLK+G YG IRF LP+ P AS+  A ++  LSLIA+IY  LV++VQ D+
Sbjct: 245 PTGGSVILAALMLKLGAYGFIRFSLPILPDASRTLAWLMIALSLIAVIYIGLVALVQKDM 304

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSIAHMG+VT+G F      V+GA+ QM+SHG VS+A+F CVGV+YDR+HTR I
Sbjct: 305 KKLIAYSSIAHMGFVTLGFFLFENITVDGALVQMISHGFVSAAMFLCVGVLYDRMHTRQI 364

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGG+   MPR+A   ++F +AN GLPGTSGF+GE +VI+   + +  +    +  ++L
Sbjct: 365 ADYGGVAFVMPRFAAFFVLFALANCGLPGTSGFVGEVMVILGAVKVNVWIGAAGALALIL 424

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+LW+ ++V++G  + E+V  LKD+S RE  M+  +    +  GIYP  + D     
Sbjct: 425 GAAYTLWMIKRVLYGPIENEQVAALKDISAREFFMLVVLGAFVLAIGIYPAWVTDVMQTS 484

Query: 480 LSSII 484
           ++ ++
Sbjct: 485 VADLL 489


>gi|121998532|ref|YP_001003319.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Halorhodospira halophila SL1]
 gi|121589937|gb|ABM62517.1| NADH dehydrogenase subunit M [Halorhodospira halophila SL1]
          Length = 505

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 228/481 (47%), Positives = 319/481 (66%), Gaps = 23/481 (4%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGV---ALGISTINFIFSLFVWSVFDKGRSS 61
            LS++ +LP LG      ++ L  GRRS   V   A G++ + F+FSL +W  F+ G   
Sbjct: 6   LLSLIIWLPILG-----GAAVLAVGRRSEVAVRELATGVAGLTFLFSLVLWFAFEPG-GG 59

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   W+  F   YHLGVDGIS+ LVVLT F T   +++    I     +YM AFLV
Sbjct: 60  MQFVEKRDWVPTFDIHYHLGVDGISMPLVVLTAFATLLVVIAGRSGITYRPAQYMGAFLV 119

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++IG F +LD +LFY+F+EA L+PMF++IG+WGG+ RIYA  KFFLYTF GS+ ML 
Sbjct: 120 MEGLMIGVFAALDAILFYVFWEAMLVPMFLLIGMWGGANRIYATIKFFLYTFLGSVLMLI 179

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A + + WE  +  ++D + +S      Q  +++A   +FA+K+PM+P HTWLP+AH +AP
Sbjct: 180 AFLYLRWEAGSFGVLDFHGLS-IGLEAQILIFLALLAAFAVKVPMWPVHTWLPDAHTEAP 238

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I LKMG YG +RF LP+ P ASQ  A ++  +SLIAI+Y  LV+MVQ D+K
Sbjct: 239 TGGSVILAAITLKMGAYGFLRFALPIAPEASQELAWLVIAMSLIAIVYIGLVAMVQEDMK 298

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGV-----EGAMF-------QMLSHGLVSSALFFCVG 348
           +LIAYSSIAHMG+ T+G F   ++G+     +GA+        Q++SHG +S+ALF CVG
Sbjct: 299 RLIAYSSIAHMGFATLGFFVIFQAGLGAEAGDGALMAMTGGYVQLISHGFISAALFLCVG 358

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR+I  YGG+++ MP +  + +VF MAN GLPGTSGF+GEFLVI+  +Q S  
Sbjct: 359 VLYDRMHTRNIADYGGVINRMPIFGALFVVFAMANAGLPGTSGFVGEFLVILGSYQASFW 418

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
            A +A   +++ A YSLWL ++VVFG    E+V  L DL  RE  ++  +AVL +  G+Y
Sbjct: 419 YAAIAGLTLIVGAAYSLWLVKRVVFGPVANERVAALNDLDRREFLLLGVLAVLVIGVGVY 478

Query: 469 P 469
           P
Sbjct: 479 P 479


>gi|241663472|ref|YP_002981832.1| NADH dehydrogenase subunit M [Ralstonia pickettii 12D]
 gi|240865499|gb|ACS63160.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Ralstonia pickettii 12D]
          Length = 488

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/483 (46%), Positives = 331/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSLISFVITLPLITRFDKTTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++++W+ I E   +YM AF++L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVIAAWEVITERVAQYMAAFMILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F SLD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L A++
Sbjct: 121 LMIGVFASLDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTLVALL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  +++AFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQV-KLSMNEQILIFLAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   +  I  +SL+A+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLSAFIIAISLVAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +LKDL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVTHKHVAELKDLNCREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|113867082|ref|YP_725571.1| NADH dehydrogenase subunit M [Ralstonia eutropha H16]
 gi|113525858|emb|CAJ92203.1| NADH dehydrogenase chain M [Ralstonia eutropha H16]
          Length = 488

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 329/486 (67%), Gaps = 11/486 (2%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCG---RRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           LS   +LP F G+ ++ F S    G     S FG     S  +F+ +L +   FD+  ++
Sbjct: 3   LSFSIWLPVFFGLLILAFGSDRSPGFVRWMSLFG-----SIASFVVTLPLVFGFDRASAA 57

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI+ F  +Y LGVDGIS+  VVLT F+T   ++S+W+ I E   EYM +FL+
Sbjct: 58  MQFVEKASWIERFNINYLLGVDGISMWFVVLTAFITVIVVISAWEVITERVAEYMASFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L 
Sbjct: 118 LSGLMVGVFCTLDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLAGSLLTLI 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +  +  T  I+  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 178 ALLYLYNKTGTFDILQ-WHQAKLSMNEQIALFIAFFVAFAVKVPMWPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLK+G YG +RF LP+ P AS Y AP I  +SLIA+IY  LV++VQ D+K
Sbjct: 237 TGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHYLAPFIITISLIAVIYIGLVALVQADMK 296

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KL+AYSSIAHMG+VT+G F     GVEG + QM+SHG +S A+F C+GV+YDR+H+R I 
Sbjct: 297 KLVAYSSIAHMGFVTLGFFIFSDIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIA 356

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   +    + +LA+  ++  
Sbjct: 357 DYGGVVNTMPKFAALAVFFAMANCGLPATSGFVGEFMVILGAVKFDFWIGLLAATALIFG 416

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YSLW+ ++V+FG    + V++L DL+ RE  M+  +A++T++ G++P P  D     +
Sbjct: 417 AAYSLWMVKRVIFGDIVHQHVRELVDLNKREFVMLGLLAIMTLYMGLHPKPFTDVMHASV 476

Query: 481 SSIIEN 486
            +++ +
Sbjct: 477 VNLLSH 482


>gi|312796889|ref|YP_004029811.1| NADH-quinone oxidoreductase chain M [Burkholderia rhizoxinica HKI
           454]
 gi|312168664|emb|CBW75667.1| NADH-quinone oxidoreductase chain M (EC 1.6.5.3) [Burkholderia
           rhizoxinica HKI 454]
          Length = 498

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/477 (46%), Positives = 327/477 (68%), Gaps = 9/477 (1%)

Query: 2   NLPFLSIVTFLPF-LGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           + P L+   +LP   G+ V+   S    G   +   AL  + I+FI +L + S FD   S
Sbjct: 4   HFPVLTFAIWLPIAFGIAVLAVGSDKTPGVARW--TALIGAVISFIVTLPLISGFDASTS 61

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
           + Q +E   WI+ F  +YHLGVDG+S+  VVLT F+T   +++ W+ I +   +YM AFL
Sbjct: 62  ALQFVEVAPWIERFNITYHLGVDGLSMWFVVLTAFITVIVVIAGWEVITDRVAQYMAAFL 121

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L  +++G F + D +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML
Sbjct: 122 ILSGLMVGVFSAADGMLFYVFFEATLIPMYLIIGVWGGPNRVYAAFKFFLYTLAGSLLML 181

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
            A++ +  + ++    +L A    P  +  Q  +++AFF +FA+K+PM+P HTWLP+AHV
Sbjct: 182 VALIYLYTQSQS---FELSAWHALPLGMTPQVLLFVAFFLAFAVKVPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA IMLK+G YG +RF LP+ P AS   AP +  LSL+A+IY   V++VQ 
Sbjct: 239 EAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHMLAPAVITLSLVAVIYIGFVALVQA 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSI HMG+VT+G F   + GVEGA+ QM+SHG VS A+F C+GV+YDR+H+R
Sbjct: 299 DMKKLVAYSSITHMGFVTLGFFLFSQLGVEGAIVQMISHGFVSGAMFLCIGVLYDRMHSR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP++A + ++F+MAN GLPGTSGF+GEF+VI++  + +  + +LA+  +
Sbjct: 359 QIADYGGVVNTMPKFAALAILFSMANCGLPGTSGFVGEFMVILAAVKFNFWIGLLAAITL 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           +L A Y+LW+ ++V FG    + V +L D+S RE  M+  +A+L ++ GIYP P  +
Sbjct: 419 ILGAAYTLWMVKRVYFGAVANDHVAKLVDVSRREFWMLMVLALLVLYMGIYPKPFTN 475


>gi|114777373|ref|ZP_01452370.1| NADH dehydrogenase subunit M [Mariprofundus ferrooxydans PV-1]
 gi|114552155|gb|EAU54657.1| NADH dehydrogenase subunit M [Mariprofundus ferrooxydans PV-1]
          Length = 420

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/408 (52%), Positives = 290/408 (71%), Gaps = 6/408 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           +  P LS+  FLP  G  VI LF      G R+    AL +S   FI +L +  +FDK  
Sbjct: 7   LGFPILSLSIFLPMFGALVIWLFVR----GDRAVRWAALAVSVATFIVTLPLAFMFDKNT 62

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           +  Q  E + WI  F  +Y LGVDGIS+  ++LT+ LT  CI+S+W+ IQ   +EYM+AF
Sbjct: 63  AHMQFEELHPWISTFHVNYQLGVDGISMPFIILTSLLTIICIISAWECIQTRVKEYMLAF 122

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           LVLE+ +IG F +LD +LFY F+EA LIPM++IIGVWGG  R+YA  KFFLYT  GS+ M
Sbjct: 123 LVLETTLIGVFCALDAILFYFFWEAMLIPMYLIIGVWGGKNRVYATLKFFLYTLAGSVLM 182

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ M ++   +  +  Y    F F+ Q+W+WIAFF +FA+K+PM+P HTWLP+AH +
Sbjct: 183 LIAVLAMYFKAGHTFSLLAYMDYPFDFTWQFWIWIAFFIAFAVKVPMWPVHTWLPDAHTE 242

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LAGI+LKMG YG +RF LP+ P ASQYF P +  LSL+AI+Y SLV+M+QTD
Sbjct: 243 APTAGSVILAGILLKMGAYGFLRFSLPILPDASQYFVPFMVILSLVAIVYISLVAMMQTD 302

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +K+LIAYSSIAHMG+VT+G F   +  +EGA+F M+SHG V++ALF CVGV+YDRLHTR+
Sbjct: 303 MKRLIAYSSIAHMGFVTLGTFMFTQVALEGALFGMISHGFVAAALFLCVGVMYDRLHTRE 362

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS 406
           I AYGG+ + MP +A V+++F MAN+ LPG S F+ E +V++  F  S
Sbjct: 363 IAAYGGVANVMPIFAAVIILFAMANVALPGASSFVAEIMVLIGTFDAS 410


>gi|319789719|ref|YP_004151352.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thermovibrio ammonificans HB-1]
 gi|317114221|gb|ADU96711.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Thermovibrio ammonificans HB-1]
          Length = 482

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/423 (51%), Positives = 299/423 (70%), Gaps = 11/423 (2%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTF 94
           +ALG + +  + SL +W  FD  +  FQ +E  +W+ +    Y +GVDG+S+++VV+TT 
Sbjct: 28  IALGFTAVELLISLVMWWKFDLSKPGFQFVEVANWLPNLSVKYKVGVDGLSLIMVVMTTL 87

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           LT   + S+W  I+   + +    L+LE+ ++G F+SLD+LLFYIF+EA LIPM +IIG+
Sbjct: 88  LTFVAVASAWSYIERRRKLFYALLLMLETAMVGVFVSLDLLLFYIFWEAMLIPMALIIGI 147

Query: 155 WGGSERIYAAYKFFLYTFFGSIFMLFAIVVMC------WEKKTSSIIDLYAMSKFPFSIQ 208
           WGG  RIY+A KFF+YTF GSIF+L  +VV+         + T  I  L A+ K P  +Q
Sbjct: 148 WGGERRIYSALKFFIYTFAGSIFLLIGMVVLVIVYGGLTGQYTFDIQQLTAV-KLPVELQ 206

Query: 209 YWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFP 268
            W++ AFF +FA+K+P+FPFHTWLP+AHV+APT GSV LAG++LKMG YG +RF LPLFP
Sbjct: 207 KWLFWAFFLAFAVKVPVFPFHTWLPDAHVEAPTPGSVILAGVLLKMGTYGFLRFSLPLFP 266

Query: 269 LASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEG 328
            A + FAPVIF L ++AIIY +LV++VQ D+KK++AYSS++HMG+V IG+FS    G+EG
Sbjct: 267 DAYREFAPVIFALGVVAIIYTALVALVQDDVKKVVAYSSVSHMGFVMIGLFSLNVQGIEG 326

Query: 329 AMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPG 388
           A+FQML+HGLVS+ALFF VG IY+RLHTR I   GGL    P+ A + M+FTMAN+GLPG
Sbjct: 327 AVFQMLNHGLVSAALFFLVGAIYERLHTRSIRKMGGLAEFAPKLATLAMLFTMANVGLPG 386

Query: 389 TSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           TS FIGEFL I+  F+ +  V VL + GV+  A Y L++YR V F      K+   KDL+
Sbjct: 387 TSSFIGEFLTILGGFKAATWVGVLMALGVIFGAAYMLYMYRNVFF---LEPKILSFKDLN 443

Query: 449 LRE 451
            RE
Sbjct: 444 RRE 446


>gi|309781864|ref|ZP_07676597.1| NADH dehydrogenase (ubiquinone), M subunit [Ralstonia sp.
           5_7_47FAA]
 gi|308919505|gb|EFP65169.1| NADH dehydrogenase (ubiquinone), M subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 488

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 330/483 (68%), Gaps = 5/483 (1%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS   +LP F GV V+   S    G   +  ++L  S I+F+ +L + + FDK  ++ Q 
Sbjct: 3   LSFAIWLPIFFGVLVLASGSDRNPGYVRW--MSLIGSVISFVMTLPLITRFDKTTAAMQF 60

Query: 65  IEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   WI+ F  SY+LGVDGIS+  VVLT F+T   ++S+W+ I     +YM AFL+L  
Sbjct: 61  VEKSSWIERFHISYYLGVDGISMWFVVLTAFITVIVVISAWEVITVRVAQYMAAFLILSG 120

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG F SLD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L A++
Sbjct: 121 LMIGVFASLDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTLVALL 180

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            + +   T  I+  + + K   + Q  +++AFF +FA+K+PM+P HTWLP+AHV+APT G
Sbjct: 181 YLYFHSGTFEILQWHQV-KLSMNEQILIFLAFFMAFAVKVPMWPVHTWLPDAHVEAPTGG 239

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+G YG +RF LP+ P AS   +  I  +SL+A+IY  LV++VQ D+KKL+
Sbjct: 240 SVVLAAIMLKLGAYGFLRFSLPIAPDASHSLSAFIIAISLVAVIYIGLVALVQADMKKLV 299

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSIAHMG+VT+G F   + GVEG + QM+SHG +S A+F C+GV+YDR+H+R I  YG
Sbjct: 300 AYSSIAHMGFVTLGFFIFNEIGVEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIADYG 359

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  A Y
Sbjct: 360 GVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVKFNFWIGLLAATALIFGAAY 419

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           SLW+ ++V+FG    + V +LKDL+ RE  M+  +A+ T++ G+YP P  D     + ++
Sbjct: 420 SLWMVKRVIFGDVTHKHVAELKDLNCREFFMLGVLAIATLYMGLYPKPFTDVMHASVVNL 479

Query: 484 IEN 486
           + +
Sbjct: 480 LTH 482


>gi|256821527|ref|YP_003145490.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Kangiella koreensis DSM 16069]
 gi|256795066|gb|ACV25722.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Kangiella koreensis DSM 16069]
          Length = 505

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 231/504 (45%), Positives = 329/504 (65%), Gaps = 18/504 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILF---SSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
            LP LS++ ++P +G  VI+F      L   +R    + +    ++       W+ F   
Sbjct: 4   QLPILSLLIWIPIIGGLVIMFGPGDRLLAVSQRIGILLGIITLLLS---CWLTWA-FATD 59

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            +  Q  E   WI      Y L +DGIS+ L+VLT+ +    ++S+  SI++   +Y  A
Sbjct: 60  TAEMQFAETARWIPSLNIRYDLAIDGISLPLIVLTSLIGLLVLISATGSIKKRQSQYFAA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
            L++  ++ G F + D +LFY+ +EA LIPMF++IGVWGG  RIYA  KFFL+TFFGSIF
Sbjct: 120 VLMMTGLMNGVFAAQDSILFYVLWEAMLIPMFLMIGVWGGENRIYATVKFFLFTFFGSIF 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A++ M  E  + +I  L  +S    + Q W++ AF  +FA+KIPMFP HTWLP+AHV
Sbjct: 180 MLVALIYMGREADSFAISKLQQLS-LSLTEQKWIFFAFLAAFAVKIPMFPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GSV LA IMLKMGGYG +RF LP+ P A   +A  +   SLIAI+Y  LV++ Q 
Sbjct: 239 EAPTGGSVILAAIMLKMGGYGFLRFSLPITPDAVAEYAYWLILFSLIAIVYIGLVALAQK 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIF--------SGMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           D+KKL+AYSSIAHMG+VT+G F              ++GAM QM+SHGLVS ALFF +GV
Sbjct: 299 DMKKLVAYSSIAHMGFVTLGTFIIVFLTATQAQSMALQGAMIQMISHGLVSGALFFSIGV 358

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDR+H+RDI  YGG+V++MP +A ++M+F +AN GLPGTSGF+GEF VI++ FQ    +
Sbjct: 359 LYDRMHSRDIADYGGVVNSMPIFAALLMLFILANAGLPGTSGFVGEFFVIIASFQADWRI 418

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A++A   ++L+A YSLW+Y++V+FG S  E V +L D++ RER +++ +A+L +  GIYP
Sbjct: 419 ALVAGLTLILAAAYSLWVYKRVIFGKSANESVARLDDVTKRERLVLFTLAILILALGIYP 478

Query: 470 VPIRDTFSVPLSSIIENYTL-KTG 492
            P+ +     L  IIE+ TL KTG
Sbjct: 479 QPLIEIMQPSLEKIIESATLSKTG 502


>gi|189426175|ref|YP_001953352.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter lovleyi SZ]
 gi|189422434|gb|ACD96832.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Geobacter lovleyi SZ]
          Length = 535

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 221/493 (44%), Positives = 334/493 (67%), Gaps = 11/493 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS++TFLP +GV ++LF      G  +   VAL  + + FI SL + + + +  + +Q +
Sbjct: 5   LSVMTFLPIVGVLLLLFIPKGSNG--ALRSVALVTTVVTFIASLPILTGY-QTNAEYQFV 61

Query: 66  EYYHWI---DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           E   WI    +   Y++G+DGIS+ LV+LTTF+ P  +LS+W ++++  +EYMI  L+LE
Sbjct: 62  ENVPWIAAGPFAMRYNIGIDGISLWLVILTTFIMPIAVLSTWTAVEDKVKEYMICLLILE 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + ++GAF+SLD+ LFYIF+E  LIPM+ +IG+WGG  R+YA  KFF+YT  GS+ ML A+
Sbjct: 122 TAMLGAFISLDLFLFYIFWELMLIPMYFMIGIWGGKNRLYATVKFFIYTLVGSLLMLVAL 181

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSI----QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           + + +    + I D   +  F   I    Q W++ AF  +FAIK+PMFP HTWLP+AH +
Sbjct: 182 IYLYFLGTKTGITDFSLVHFFDLKIDPATQTWLFAAFALAFAIKVPMFPVHTWLPDAHTE 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA IMLKMG YG IRF +PLFP A+  F P+I  L++I IIYA+LV+MVQ D
Sbjct: 242 APTAGSVILAAIMLKMGTYGFIRFAMPLFPEATHQFTPLIATLAVIGIIYAALVAMVQED 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AH+G+V +G+F+  + GV GA+ Q L+HG+ + ALF  VG IY+R HTR 
Sbjct: 302 VKKLVAYSSVAHLGFVMLGLFALNEQGVTGALLQNLNHGISTGALFLIVGFIYERRHTRL 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNS-NTVAVLASFGV 417
           I  +GGL   MP +AV+ M+ T++++ LPGT+GF+GEFL+++  F++S     ++AS GV
Sbjct: 362 ITDFGGLSKQMPIFAVIFMIVTLSSVALPGTNGFVGEFLILVGGFESSLRWWTIVASSGV 421

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           + +A+Y LW++++V+FG     K Q L DL+ RE  ++ P+ V+    G+YP P  +  +
Sbjct: 422 IFAAVYMLWMFQRVMFGELDNPKNQALLDLNAREIAIMVPLLVMIFVLGVYPNPFIEKMT 481

Query: 478 VPLSSIIENYTLK 490
             +  +I +  ++
Sbjct: 482 PSIKKVIAHTRIE 494


>gi|11465635|ref|NP_049306.1| NADH dehydrogenase subunit 4 [Porphyra purpurea]
 gi|4106942|gb|AAD03109.1| NADH dehydrogenase subunit 4 [Porphyra purpurea]
          Length = 488

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 213/437 (48%), Positives = 307/437 (70%), Gaps = 3/437 (0%)

Query: 35  GVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTT 93
            +A G + + FI S+ +W  FD   S FQ +   +W   Y   Y +G+DGIS+  ++LTT
Sbjct: 34  NIAFGTAQLTFISSILLWICFDPTISLFQFVCTINWFPSYNIYYTIGIDGISLFFIILTT 93

Query: 94  FLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIG 153
           +L   C+L SW  I    +EY+I FL LE ++I  F  LD++ FYIFFE+ LIPMF+IIG
Sbjct: 94  WLVTTCVLISWTMINTQIKEYLICFLTLEFILIQVFCVLDVIFFYIFFESVLIPMFLIIG 153

Query: 154 VWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMW 212
           +WG  +R I AAY+FF+YT  GS+ ML AI+V+ +++ T+ I  L+ +S F    Q  +W
Sbjct: 154 IWGSRQRKIRAAYQFFIYTLAGSLLMLLAILVIYFQQGTTDIQILWNVS-FDTRTQILLW 212

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           ++FF S A+KIPM PFH WLP AH +APTAGSV LAG++LKMGGYG +RF LP+ P AS 
Sbjct: 213 LSFFSSLAVKIPMIPFHIWLPEAHAEAPTAGSVILAGVLLKMGGYGFLRFSLPMLPEASL 272

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF+P+I+ LS++A +YASL ++ Q D+KK+IAYSS++HMG+VT+G+FS    G+EG++  
Sbjct: 273 YFSPLIYLLSIVAAVYASLTTIRQVDLKKIIAYSSVSHMGFVTLGLFSFNLQGLEGSIIL 332

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
           MLSHGLVSSALF CVG++YDR  TR +  YGGLV  MP ++++++ FT +N+G PGTS F
Sbjct: 333 MLSHGLVSSALFLCVGILYDRHKTRILKYYGGLVQVMPIFSILLLFFTFSNIGFPGTSSF 392

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRER 452
           +GEFLV+  +F+ S+    L++F ++L A YS+WL+ ++ FG  K + V   +D+S RE 
Sbjct: 393 VGEFLVLTGLFKVSSISTFLSAFSMILGAGYSIWLFNRICFGSLKLQYVTNFQDISRREF 452

Query: 453 CMVYPIAVLTVFFGIYP 469
            ++ P+AV  +  G+ P
Sbjct: 453 YILLPLAVSILLMGVCP 469


>gi|91776401|ref|YP_546157.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylobacillus flagellatus KT]
 gi|91710388|gb|ABE50316.1| NADH dehydrogenase subunit M [Methylobacillus flagellatus KT]
          Length = 495

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/490 (45%), Positives = 327/490 (66%), Gaps = 3/490 (0%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           +LPFLS+  ++P L   ++LF+        + +   LG S   F  ++ ++  FD     
Sbjct: 3   DLPFLSLSIWVPILAGVLVLFTGGDKHASAARWLALLG-SIAGFAVTVPLYLGFDTQYGG 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           FQ +E   WI  F   YHLGVDGI++ L++LT+F T   +++ W+ I++   +YM AFL+
Sbjct: 62  FQFVERLQWIPAFNIQYHLGVDGIAVPLILLTSFTTFIVVIAGWEVIEKRVAQYMAAFLI 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +  ++IG F +LD +L+YIF+EA LIPMF++IG+WGG  R+YA  KFFLYT  GS+ ML 
Sbjct: 122 MSGIMIGVFSALDAILYYIFWEAMLIPMFLVIGIWGGPNRVYATIKFFLYTLLGSLLMLV 181

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A + +  +  +  I D Y M      +Q W+++AFF +FA+KIPM+P HTWLP+AHV+AP
Sbjct: 182 AFIYLYHQSGSFDITDYYRM-PLALDVQIWLFVAFFMAFAVKIPMWPVHTWLPDAHVEAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I LK+GGY  +RF +P+ P AS Y A  +  LSLIA++Y +LV++VQ D+K
Sbjct: 241 TGGSVVLAAIALKLGGYSFLRFAMPIAPDASHYLAGFMITLSLIAVVYIALVALVQKDMK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSI+HMG+VT+G F     G+EGA+ QM+SHG +S+A+F CVGV+YDR+H+R I 
Sbjct: 301 KLIAYSSISHMGFVTLGFFLFNPLGLEGAIVQMISHGFISAAMFLCVGVLYDRMHSRQIA 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP +    ++F MAN GLPGTSGF+GEF+VI+   Q +   A LA+  ++  
Sbjct: 361 DYGGVVNTMPVFTAFAVLFAMANAGLPGTSGFVGEFMVILGTVQVNFWYAFLAATTLIFG 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y+LW+ ++V +G     +V  LKD++ RE  ++  +A+L + FGIYP PI +     +
Sbjct: 421 AAYTLWMVKRVYYGEIANPQVAALKDINRREFFILGLLALLVLGFGIYPQPITEMTHATV 480

Query: 481 SSIIENYTLK 490
           S ++E+  L 
Sbjct: 481 SQLLEHMALS 490


>gi|14272171|emb|CAC39485.1| NADH dehydrogenase subunit 4 [Corsinia coriandra]
          Length = 418

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/395 (53%), Positives = 288/395 (72%), Gaps = 2/395 (0%)

Query: 76  SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDML 135
           ++++G+DGIS+  V+LTTFLTP CIL  + S++   +EYMIAF + ES ++  F SLD+L
Sbjct: 11  NFYIGIDGISLFFVILTTFLTPICILVGFYSVKSYKKEYMIAFFICESFLVAVFCSLDLL 70

Query: 136 LFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSI 194
           +FY+FFE+ LIPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI+ + ++  T+  
Sbjct: 71  IFYVFFESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTLMGSLFMLLAILFIFFQTGTTD- 129

Query: 195 IDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKM 254
           + +   ++F    Q  +WIAFF SF++K+PM P H WLP AHV+APTAGSV LAGI+L++
Sbjct: 130 LQILLTTEFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLRL 189

Query: 255 GGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYV 314
           G YG +RF +P+FP A+ YF P I+ LS+IAIIY SL ++ Q D+KK+IAYSS+AHM +V
Sbjct: 190 GTYGFLRFSIPMFPEATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFV 249

Query: 315 TIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAV 374
           TIG+FS    G+EG++  MLSHGLVSSALF CVG +YDR  TR +  YGGLV  MP ++ 
Sbjct: 250 TIGMFSLNIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLVSTMPIFST 309

Query: 375 VMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFG 434
           + + FT+ANM LPGTS  IGEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VVFG
Sbjct: 310 IFLFFTLANMSLPGTSSLIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVFG 369

Query: 435 VSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
             K   + +  DL+ RE  +  P  V  ++ G+YP
Sbjct: 370 NFKPNFILKFSDLNRREVLIFLPFIVGVIWMGVYP 404


>gi|34496408|ref|NP_900623.1| NADH dehydrogenase subunit M [Chromobacterium violaceum ATCC 12472]
 gi|34102261|gb|AAQ58627.1| NADH-ubiquinone oxidoreductase, chain M [Chromobacterium violaceum
           ATCC 12472]
          Length = 499

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 325/478 (67%), Gaps = 12/478 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKG 58
           M+   LS+V + P L    +L +   G  +R+     +A+  +   F+ S+ +++ F+  
Sbjct: 1   MSTNLLSLVIWTPILAGLAVLAT---GGDQRAPLARWLAVAGALAGFLLSIPLFTEFNNL 57

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
               Q  E   WI     +YHLGVDGIS+L VVL +F T   +++ W+ IQ+   +YM A
Sbjct: 58  SGGMQFEEMKPWIASLNINYHLGVDGISMLFVVLNSFTTLLVVIAGWEVIQKRVSQYMAA 117

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL++  ++ GAF +LD +LFY+FFE  LIPM++IIGVWGG  R+YA+ KFFLYT  GS+ 
Sbjct: 118 FLIMSGLINGAFAALDAILFYVFFEGMLIPMYLIIGVWGGPRRVYASIKFFLYTLLGSLL 177

Query: 178 MLFAIVVMCWEK-KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           ML A++ + ++  K+  I+  + ++K   + Q  +++AFF SFA+K+PM+P HTWLP+AH
Sbjct: 178 MLVALIYLYFQAGKSFEILAFHDIAKITLTAQILLFVAFFLSFAVKVPMWPVHTWLPDAH 237

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GS+ LA I LK+G YG +RF LP+ P AS+  +P+I  LSL+A++Y  LV++VQ
Sbjct: 238 VEAPTGGSMVLAAITLKIGAYGFLRFALPILPDASRELSPIIIGLSLVAVVYIGLVALVQ 297

Query: 297 TDIKKLIAYSSIAHMGYVTIGIF----SGMKS-GVEGAMFQMLSHGLVSSALFFCVGVIY 351
           +D+KKL+AYSSI+HMG+VT+G+F    S M    VEGA+ QM+SHG VS+A+FFC+GV+Y
Sbjct: 298 SDMKKLVAYSSISHMGFVTLGLFLFAGSEMNQWAVEGALVQMVSHGFVSAAMFFCIGVMY 357

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+H+R+I  YGG+ + MP +A  MM+F MAN GLP TSGF+GEF+VIM   Q +   A 
Sbjct: 358 DRVHSRNIADYGGVANKMPIFAAFMMLFAMANSGLPATSGFVGEFMVIMGSVQVNFWYAA 417

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           LA+  ++  A Y+LW+Y++V+FG      V +L D++ RE  ++  +A++ +  G+YP
Sbjct: 418 LAATTLIFGAAYTLWMYKRVIFGDVANPHVAELSDVNKREFLVLAILALMVLGMGLYP 475


>gi|221633761|ref|YP_002522987.1| NADH-quinone oxidoreductase subunit m [Thermomicrobium roseum DSM
           5159]
 gi|221157040|gb|ACM06167.1| nadh-quinone oxidoreductase chain m [Thermomicrobium roseum DSM
           5159]
          Length = 524

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 229/521 (43%), Positives = 335/521 (64%), Gaps = 41/521 (7%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           NLP LS++T+ P +G  ++    + G   R+   +AL  S+++F+ S+ +   FD+ +S+
Sbjct: 3   NLPILSLITYSPLVGAAILFL--WGGASPRAARWIALLASSVSFLLSVVMLVAFDRDQST 60

Query: 62  FQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E + W+ +   +Y LGVDGIS  LV LTT LT   +L+SW  I+   REY I  L+
Sbjct: 61  LQFTETFDWLPELGIAYRLGVDGISAPLVGLTTLLTLIAVLASWDPIRHRVREYYITLLL 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L + ++G F+SLD+ LFY+F+E  LIPM +IIGVWG + R+YAA KFFLYT  GS+ ML 
Sbjct: 121 LATGMLGVFVSLDLFLFYVFWEIVLIPMALIIGVWGSANRVYAAVKFFLYTLAGSLLMLV 180

Query: 181 AIVVMCWEK------KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPN 234
            IV +  E       +T  ++ L A  ++  + Q+W ++AFF +FAIK+PM+PFHTWLP+
Sbjct: 181 GIVAIYQEYFRQTGIRTLDVLQL-AQGQYSEAFQFWTFLAFFLAFAIKVPMWPFHTWLPD 239

Query: 235 AHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSM 294
           AHV+APTAGSV LAG++LKMGGYG +RF LPLFP A++ +AP I  LS+IAI+Y +L+++
Sbjct: 240 AHVEAPTAGSVILAGVLLKMGGYGFLRFNLPLFPDATRMWAPAIVVLSVIAILYGALMAL 299

Query: 295 VQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRL 354
           VQ D KKL+AYSS++HMG+VT+GIF   + G+ GAM  MLSHG V+SALF  VGV+Y+R 
Sbjct: 300 VQQDFKKLVAYSSVSHMGFVTLGIFVLNQPGLSGAMVVMLSHGFVTSALFLIVGVLYERA 359

Query: 355 HTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLAS 414
           HTRD+ A+GGL  NMP +A    +FT+A++GLPG SGF+GEFL ++  F+      VL +
Sbjct: 360 HTRDLAAFGGLARNMPVFAAFFGLFTLASLGLPGLSGFVGEFLALLGGFRAYRWAGVLGT 419

Query: 415 FGVVLSALYSLWLYRKVVF-------------------------------GVSKCEKVQQ 443
             V+L+A Y L +Y++V                                 G       + 
Sbjct: 420 IVVILAAWYMLRVYQRVALVRAPGEPPDPDDPERRLALAHGLPPIAGGSDGPHAYPDPRT 479

Query: 444 LKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
             DL+ RE   + P+A+LT++ G+YP+P+ +     L++++
Sbjct: 480 FPDLTWREAVSLLPLALLTIWIGVYPLPLLEMLEPALAALL 520


>gi|254469064|ref|ZP_05082470.1| NADH dehydrogenase i, chain m [beta proteobacterium KB13]
 gi|207087874|gb|EDZ65157.1| NADH dehydrogenase i, chain m [beta proteobacterium KB13]
          Length = 491

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 224/471 (47%), Positives = 322/471 (68%), Gaps = 5/471 (1%)

Query: 6   LSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LSI  + P + G+ ++L    L        G   G   I+F+ +L ++  FDKG S FQ 
Sbjct: 5   LSIAIWTPIIFGIILLLVQDKLSTTLTYRLGNLFGF--ISFLVTLPLYIYFDKGFSGFQF 62

Query: 65  IEYYHWIDYFC-SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            E Y WI++F  +YHLG+DGIS+ LV+LT+F++   I  S  SIQ     Y+ AFL+L  
Sbjct: 63  QEIYPWINHFSINYHLGLDGISLPLVLLTSFISWLVIFISSNSIQRAIGFYISAFLILSG 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIV 183
           ++IG FL+LD +L+Y+F+EA LIPMF++IG+WGG  R+YA  KFFLYT  GS+ ML A +
Sbjct: 123 LMIGVFLALDAILYYVFWEAMLIPMFLLIGIWGGPNRVYATIKFFLYTVLGSLLMLVAFL 182

Query: 184 VMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAG 243
            +  +  + +I+D Y       +IQ  +++AFF +FA+KIPM+P HTWLP+AHV+APT G
Sbjct: 183 YLYNQTASFAILDFYT-KPLSLNIQVLIFLAFFMAFAVKIPMWPVHTWLPDAHVEAPTGG 241

Query: 244 SVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLI 303
           SV LA IMLK+GGY  IRF +P+ P A  +  P +  LSLIAI+Y + V++VQTD+KKLI
Sbjct: 242 SVILAAIMLKLGGYSFIRFAMPISPDALIFLKPFLIGLSLIAIVYIAFVAIVQTDMKKLI 301

Query: 304 AYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYG 363
           AYSSI+HMG+VT+G+F     G EG   QM+SHG +S+ALFF +GV+Y+R+H+R+I  Y 
Sbjct: 302 AYSSISHMGFVTLGLFILNPLGFEGGYVQMISHGFISAALFFAIGVLYERMHSRNISDYK 361

Query: 364 GLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALY 423
           G++++MP +    ++F MAN GLPGTSGF+GEFLVI+   Q+   +A  AS  ++  A Y
Sbjct: 362 GVINSMPIFGSFFVLFAMANSGLPGTSGFVGEFLVILGAMQDHFWIAFFASLTLIFGATY 421

Query: 424 SLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRD 474
           SLWL ++++FG  K +K+  LKDL+ +E  ++  +A++T+  GIYP  I D
Sbjct: 422 SLWLVKRIIFGEVKNKKIAALKDLNGKEFFVMSVLALMTLAIGIYPALITD 472


>gi|73540676|ref|YP_295196.1| NADH dehydrogenase subunit M [Ralstonia eutropha JMP134]
 gi|72118089|gb|AAZ60352.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Ralstonia eutropha JMP134]
          Length = 488

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 223/486 (45%), Positives = 328/486 (67%), Gaps = 11/486 (2%)

Query: 6   LSIVTFLP-FLGVFVILFSSYLGCGR---RSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           LS   +LP F G+ V+   S    G     S FG     S  +FI +L +   FDK  ++
Sbjct: 3   LSFAIWLPIFFGLLVLASGSDRSAGYVRWMSLFG-----SIASFIVTLPLVFHFDKSTAA 57

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI+ F   Y+LGVDGIS+  VVLT F+T   ++S+W+ I E   EYM +FL+
Sbjct: 58  MQFVEKSSWIERFNIQYYLGVDGISMWFVVLTAFITVIVVISAWEVITERVAEYMASFLI 117

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           L  +++G F +LD +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+  L 
Sbjct: 118 LSGVMVGVFCALDGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLLTLV 177

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +  +  T  I+  +  +K   + Q  ++IAFF +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 178 ALLYLYSKTGTFEILQ-WHQAKLSLNEQIALFIAFFMAFAVKVPMWPVHTWLPDAHVEAP 236

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA IMLK+G YG +RF LP+ P AS   A  I  +SLIA+IY  LV++VQ D+K
Sbjct: 237 TGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHSLAAFIITISLIAVIYIGLVALVQADMK 296

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KL+AYSSIAHMG+VT+G F   + G+EG + QM+SHG +S A+F C+GV+YDR+H+R I 
Sbjct: 297 KLVAYSSIAHMGFVTLGFFIFNEIGIEGGIVQMISHGFISGAMFLCIGVLYDRVHSRQIA 356

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            YGG+V+ MP++A + + F MAN GLP TSGF+GEF+VI+   + +  + +LA+  ++  
Sbjct: 357 DYGGVVNTMPKFAALSVFFAMANCGLPATSGFVGEFMVILGSVEFNFWIGLLAATALIFG 416

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YSLW+ ++V+FG    + V++L DL+ RE  M+  +A++T++ G++P P  D     +
Sbjct: 417 AAYSLWMVKRVIFGDIVHQHVRELVDLNKREFLMLGLLAIMTLYMGLHPKPFTDVMHASV 476

Query: 481 SSIIEN 486
            +++ +
Sbjct: 477 VNLLSH 482


>gi|84508542|ref|YP_448706.1| NADH dehydrogenase subunit 4 [Dictyota dichotoma]
 gi|45925710|gb|AAS79091.1| NADH dehydrogenase subunit 4 [Dictyota dichotoma]
          Length = 480

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 221/453 (48%), Positives = 310/453 (68%), Gaps = 11/453 (2%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTF 94
           V+LG +++ F+ SL +W  FD+  S FQ +    W+     +  LGVDGIS+  V+LTT 
Sbjct: 31  VSLGCTSVVFVISLLLWVGFDQSTSKFQFVVDGLWLPVANINVILGVDGISLFFVILTTL 90

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           + P CILSSW SI    + ++I+F+++E ++I  F SLD++LFYIFFE  LIPMF++IGV
Sbjct: 91  IFPLCILSSWFSINVGVKSFLISFMLMEFVLILVFTSLDLVLFYIFFETVLIPMFLVIGV 150

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R + AAY FFLYT FGS+ ML A++ +     TS+  ++ +  +F    Q W+W+
Sbjct: 151 WGSRQRKVRAAYLFFLYTLFGSLLMLIAVIYIYHFSGTSNY-EILSTIEFSEYSQRWLWL 209

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA K+PM PFH WLP AHV+APTAGSV LAGI+LK+G YG +RF   LFP AS Y
Sbjct: 210 AFFASFAAKVPMLPFHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSWGLFPEASVY 269

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P IF LSL+ ++Y SL ++ QTD+K+L+AY+S+AHM  V IG+F+G   GVE A+ Q 
Sbjct: 270 FTPFIFSLSLLGVVYTSLTAIRQTDLKRLVAYTSVAHMNLVVIGLFTGSILGVEAALLQS 329

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHG VSSALF  +GV+YDR H+R +  Y GLVH+MP + +V + FTMAN+GLPGTS F+
Sbjct: 330 LSHGFVSSALFLIIGVLYDRWHSRVVKYYSGLVHSMPVFIIVFLFFTMANLGLPGTSSFV 389

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++S F+ ++T    A+  +VL   YSLWL+ +V +G +K   +    D+SLRE  
Sbjct: 390 GEFLLLLSAFEANSTACFFAATSMVLGGAYSLWLFNRVAYGNAKLIGL----DISLREFV 445

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P+ + T+  GIYP    + F  P+ + + N
Sbjct: 446 LFLPLILGTLIMGIYP----NVFLQPMHAAVSN 474


>gi|332526759|ref|ZP_08402861.1| NADH dehydrogenase (quinone) [Rubrivivax benzoatilyticus JA2]
 gi|332111162|gb|EGJ11194.1| NADH dehydrogenase (quinone) [Rubrivivax benzoatilyticus JA2]
          Length = 491

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 214/466 (45%), Positives = 320/466 (68%), Gaps = 5/466 (1%)

Query: 26  LGCGRRSFFGVALGISTINFIFSLFVW----SVFDKGRSSFQMIEYYHWIDYF-CSYHLG 80
           L  GR S   +A  I+ +  + S  V     + FD G ++ Q  E   WI+ F  +YHLG
Sbjct: 19  LAVGRDSNPHLARWIALVGAVASFLVTIPLITGFDAGTAALQYQELVPWIERFNVNYHLG 78

Query: 81  VDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIF 140
           VDG+S+  V LT F+T   +++ W+ I +    Y+ AFLVL  +++G F + D LLFY+F
Sbjct: 79  VDGLSVWFVPLTAFITVIVVIAGWQVITDRVPLYLGAFLVLSGLMVGVFSAADGLLFYVF 138

Query: 141 FEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAM 200
           FEA+LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ ML A+V + ++   S  I  +  
Sbjct: 139 FEATLIPMYIIIGVWGGARRVYAAFKFFLYTLLGSLLMLVAVVYLYYQSGGSFEIQDWHK 198

Query: 201 SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCI 260
                + Q  +++AFF +F++K+PM+P HTWLP+AHV+APT GSV LA IMLK+G YG +
Sbjct: 199 LPLTLTAQTLLFVAFFAAFSVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFL 258

Query: 261 RFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFS 320
           RF LP+ P A++ +A VI  LSLIA++Y  LV++VQ D+KKL+AYSSIAHMG+VT+G F 
Sbjct: 259 RFSLPIAPDAAREYAWVIITLSLIAVVYIGLVALVQRDMKKLVAYSSIAHMGFVTLGFFI 318

Query: 321 GMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFT 380
             + GV GA+ QM+SHG VS A+F C+GV+YDR+H+R+I AYGG+V+ MP++A   ++F 
Sbjct: 319 FNELGVTGAIVQMISHGFVSGAMFLCIGVLYDRVHSREISAYGGVVNTMPKFAAFAVLFA 378

Query: 381 MANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEK 440
           MAN GLPGT+GF+GE++VI+   +++  VA LA+  ++  A Y+LW+ ++V FG    + 
Sbjct: 379 MANCGLPGTAGFVGEWMVILGAVKHNFWVAGLAATTLIFGAAYTLWMVKRVYFGPVANDH 438

Query: 441 VQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           V++L+D+  RE  M+  +A   ++ G+YP P  +   V +S ++++
Sbjct: 439 VKELQDIDAREFLMLALLAAAVLWMGLYPKPFTEVMDVSVSELLKH 484


>gi|291280345|ref|YP_003497180.1| NADH-quinone oxidoreductase subunit M [Deferribacter desulfuricans
           SSM1]
 gi|290755047|dbj|BAI81424.1| NADH-quinone oxidoreductase, M subunit [Deferribacter desulfuricans
           SSM1]
          Length = 499

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 336/489 (68%), Gaps = 11/489 (2%)

Query: 7   SIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSL-FVWSVFDKGRSSFQMI 65
           +I+T L F  VF  L    L    ++    A   S I FI ++  +W+ FDK  ++ Q +
Sbjct: 4   NILTILIFFPVFAALVIFALWRSGKATMWAAFVASVIEFILTMPLMWN-FDKSTAAMQFV 62

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E Y W+  +  SY++GVDGISIL+V LTT LT   IL+S+K I +  RE+ +A L+LE+ 
Sbjct: 63  EKYSWVKAWGISYYVGVDGISILMVFLTTLLTMISILASFKYIGKRQREFYLAMLILEAA 122

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           ++G F++LD  LFYIF+EA LIPM++IIGVWGG  RIYAA KFFLYT  GS+ M+ AI+ 
Sbjct: 123 IVGVFVALDFFLFYIFWEAMLIPMYLIIGVWGGQRRIYAAIKFFLYTLAGSVLMMLAIIA 182

Query: 185 MCWE------KKTSSIIDLYAMS-KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           + ++      + T  I+ + A S ++    Q  +++AFF  FAIK+PMFPFHTWLP+AHV
Sbjct: 183 LYFKHGQLTGEYTFDILKITAASAQYSVGFQTIVFLAFFLGFAIKVPMFPFHTWLPDAHV 242

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMG YG +RF LP+ P+AS  F P+I  LS+IAIIY +LV+MVQ 
Sbjct: 243 EAPTAGSVILAGVLLKMGTYGFLRFCLPITPVASVKFVPLIAALSVIAIIYGALVAMVQE 302

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSS++HMG+VT+GI++  ++G+EG + QM +HG+++ ALF  +G+IY+R HTR
Sbjct: 303 DVKKLVAYSSVSHMGFVTLGIYALNQAGIEGGILQMFNHGIITGALFLLIGLIYERTHTR 362

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+   +P YA +  +F+  ++GLP   GFIGEFLV++  F++ +  A++A+ GV
Sbjct: 363 LIADYGGIAKYVPVYATIFAIFSFGSIGLPSMGGFIGEFLVLVGSFKSLSNYAIVAASGV 422

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           + +A+Y LW+Y++V F  +   + + ++D+++RE   ++P+ +L  + G+YP        
Sbjct: 423 IFAAVYMLWMYQRVFFQ-TPNSRWEGIEDVNVREFIYLFPLIILVFWTGLYPETFTSYMH 481

Query: 478 VPLSSIIEN 486
             + S++E+
Sbjct: 482 ESVRSLLEH 490


>gi|253998395|ref|YP_003050458.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Methylovorus sp. SIP3-4]
 gi|253985074|gb|ACT49931.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylovorus sp. SIP3-4]
          Length = 492

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/487 (44%), Positives = 329/487 (67%), Gaps = 3/487 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+ P LS+  ++P     ++L +      R + + +AL  S   F+ +L +++ F+    
Sbjct: 1   MDWPILSLSIWVPIFAGVLVLCTGGDQNARLARW-LALFGSIAAFLVTLPLYTHFNMMDG 59

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ  E + WI  F  +YHLGVDG+++ L++LT+F T   +++ W+ I++   +YM AFL
Sbjct: 60  GFQFQEGHRWITSFNINYHLGVDGLAVPLIILTSFTTVIVVIAGWEVIEKRVAQYMAAFL 119

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++  ++IG F +LD +L+Y+F+EA LIPMF++IG+WGG  R+YA  KFFLYTF GS+ ML
Sbjct: 120 IMSGLMIGVFAALDAILYYMFWEAMLIPMFLVIGIWGGPNRVYATIKFFLYTFIGSLLML 179

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A + +  +  +  ++D Y +    F  Q  +++AFF +FA+K+PM+P HTWLP+AHV+A
Sbjct: 180 VAFIYLYHQSNSFELVDYYQL-PLSFKAQILIFLAFFMAFAVKVPMWPVHTWLPDAHVEA 238

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA I LK+GGY  +RF +P+ P A+ Y +  +  LSLIA++Y +LV++VQ D+
Sbjct: 239 PTGGSVVLAAIALKLGGYSFLRFAMPIAPDAAHYLSGFMITLSLIAVVYIALVALVQKDM 298

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSI+HMG+VT+G F     G+EGA+ QM+SHG VSSA+F  VGV+YDR+H+R I
Sbjct: 299 KKLIAYSSISHMGFVTLGFFIFNPLGMEGAIVQMISHGFVSSAMFLSVGVLYDRMHSRQI 358

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGG+V+ MP +A   ++F MAN GLPGTSGF+GEF+VI+   Q +   A LAS  ++L
Sbjct: 359 ADYGGVVNTMPTFAAFAVLFGMANAGLPGTSGFVGEFMVILGALQANFWFAFLASTTLIL 418

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+LW+ ++V +G      V  LKDL+ RE  ++  +AVL + FG+YP PI +     
Sbjct: 419 GAAYTLWMVKRVFYGEIGNAHVAALKDLNRREFFILSVLAVLVIGFGVYPHPITEMTHAT 478

Query: 480 LSSIIEN 486
           +++++ +
Sbjct: 479 VNNLLAH 485


>gi|224824811|ref|ZP_03697918.1| proton-translocating NADH-quinone oxidoreductase, chain M [Lutiella
           nitroferrum 2002]
 gi|224603304|gb|EEG09480.1| proton-translocating NADH-quinone oxidoreductase, chain M [Lutiella
           nitroferrum 2002]
          Length = 497

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 328/490 (66%), Gaps = 13/490 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRSSFQ 63
           LS+V + P +   ++L +   G  +R+     +AL  S   F+ SL +++ F+      Q
Sbjct: 6   LSLVIWTPIVAGLLVLTT---GGDQRAPLARWLALAGSLAGFLVSLPLYTGFNDLNGGMQ 62

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E   WI     +YHLGVDGIS+L +VL +F T   +L+ W+ I++   +YM AFL++ 
Sbjct: 63  FEEMRPWIQALNINYHLGVDGISMLFIVLNSFTTLMVVLAGWEVIEKRVAQYMAAFLIMS 122

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
            ++ G+F SLD +LFY+FFEA LIPM++IIGVWGG  R+YA+ KFFLYT  GS+ ML A 
Sbjct: 123 GLINGSFASLDAMLFYVFFEAMLIPMYLIIGVWGGPRRVYASVKFFLYTLLGSLLMLVAF 182

Query: 183 VVMCWEK-KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
           + M +   KT  I+  + M K   S+Q  +++AFF SFA+K+PM+P HTWLP+AHV+APT
Sbjct: 183 IYMYFHAGKTFEILAFHDM-KIALSVQMLLFVAFFLSFAVKVPMWPVHTWLPDAHVEAPT 241

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
            GS+ LA I LK+G YG +RF LP+ P AS+  A V+  LSL+A++Y  LV++VQ+D+KK
Sbjct: 242 GGSMVLAAITLKLGAYGFLRFALPILPDASRELAWVMVALSLVAVVYIGLVALVQSDMKK 301

Query: 302 LIAYSSIAHMGYVTIGIF----SGMKS-GVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           L+AYSSI+HMG+VT+G+F    + M    VEGA+ QM+SHG VS+A+FFC+GV+YDRLH+
Sbjct: 302 LVAYSSISHMGFVTLGMFMFLGTNMNQWAVEGALVQMVSHGFVSAAMFFCIGVMYDRLHS 361

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I  YGG+ + MP +A  MM+F MAN GLP TSGF+GEF+VI+   Q +   A LA+  
Sbjct: 362 RNIADYGGVANKMPIFAAFMMLFGMANSGLPATSGFVGEFMVILGAVQVNFWYAALAATT 421

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++  A Y+LW+Y++V+FG      V ++KD++ RE  ++  +A+  +  G+YP       
Sbjct: 422 LIFGAAYTLWMYKRVIFGDIGNSHVAEMKDVNKREFLVLAILAITVLGMGLYPQAFVSKM 481

Query: 477 SVPLSSIIEN 486
            + ++ +I +
Sbjct: 482 HLSVNDLIAH 491


>gi|313200472|ref|YP_004039130.1| proton-translocating NADH-quinone oxidoreductase subunit m
           [Methylovorus sp. MP688]
 gi|312439788|gb|ADQ83894.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylovorus sp. MP688]
          Length = 492

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 329/487 (67%), Gaps = 3/487 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+ P LS+  ++P     ++L +      R + + +AL  S   F+ +L +++ F+    
Sbjct: 1   MDWPILSLSIWVPIFAGVLVLCTGGDQNARLARW-LALFGSIAAFLVTLPLYTHFNMMDG 59

Query: 61  SFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            FQ  E + WI  F  +YHLGVDG+++ L++LT+F T   +++ W+ I++   +YM AFL
Sbjct: 60  GFQFQEGHRWITSFNINYHLGVDGLAVPLIILTSFTTVIVVIAGWEVIEKRVAQYMAAFL 119

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++  ++IG F +LD +L+Y+F+EA LIPMF++IG+WGG  R+YA  KFFLYTF GS+ ML
Sbjct: 120 IMSGLMIGVFAALDAILYYMFWEAMLIPMFLVIGIWGGPNRVYATIKFFLYTFIGSLLML 179

Query: 180 FAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            A + +  +  +  ++D Y +    F  Q  +++AFF +FA+K+PM+P HTWLP+AHV+A
Sbjct: 180 VAFIYLYHQSNSFELVDYYQL-PLSFKAQILIFLAFFMAFAVKVPMWPVHTWLPDAHVEA 238

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PT GSV LA I LK+GGY  +RF +P+ P A+ Y +  +  LSLIA++Y +LV++VQ D+
Sbjct: 239 PTGGSVVLAAIALKLGGYSFLRFAMPIAPDAAHYLSGFMITLSLIAVVYIALVALVQKDM 298

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSI+HMG+VT+G F     G+EGA+ QM+SHG VSSA+F  VGV+YDR+H+R I
Sbjct: 299 KKLIAYSSISHMGFVTLGFFIFNPLGMEGAIVQMISHGFVSSAMFLSVGVLYDRMHSRQI 358

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
             YGG+V+ MP +A   ++F MAN GLPGTSGF+GEF+VI+   Q +   A LAS  ++L
Sbjct: 359 ADYGGVVNTMPTFAAFAVLFGMANAGLPGTSGFVGEFMVILGALQANFWFAFLASTTLIL 418

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y+LW+ ++V +G      V  LKDL+ RE  ++  +A+L + FG+YP PI +     
Sbjct: 419 GAAYTLWMVKRVFYGEIGNAHVAALKDLNRREFFILSVLALLVIGFGVYPHPITEMTHAT 478

Query: 480 LSSIIEN 486
           +++++ +
Sbjct: 479 VNNLLAH 485


>gi|292493656|ref|YP_003529095.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosococcus halophilus Nc4]
 gi|291582251|gb|ADE16708.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrosococcus halophilus Nc4]
          Length = 504

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 328/498 (65%), Gaps = 17/498 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
            LP LS+V ++P LG  ++L    +G        +AL +S ++F+ S  +++ FD   ++
Sbjct: 4   GLPLLSLVIWMPILGGLLVL---AMGNRVDRVRWLALLVSGLSFVVSWSLYTGFDTTTAA 60

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q  E   WI+ F   YHLGVDGIS+ L++LTTF T   +++ W+ IQ    +YM AFL+
Sbjct: 61  MQFQEKAAWIEIFKVYYHLGVDGISMPLIILTTFSTVLVVIAGWQVIQHKLGQYMAAFLI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E ++ G F +LD +LFY+FFE  LIP+F+IIG+WGG  RIYA  KFFLYTF GS+F+L 
Sbjct: 121 MEGLMNGVFAALDAVLFYVFFEGMLIPLFLIIGIWGGPNRIYATLKFFLYTFLGSVFLLL 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           A++ +       SI++ +  +      Q  +++AF  +FA+K+PM+P HTWLP+AHV+AP
Sbjct: 181 ALLYLRSITDGFSILEFH-QAPLGMQAQVALFLAFLLAFAVKVPMWPVHTWLPDAHVEAP 239

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T GSV LA I LK+G YG +RF LP+ P AS     +I  LSLIA++Y  LV+MVQ D+K
Sbjct: 240 TGGSVILAAITLKIGAYGFMRFSLPIAPDASLALNWLIITLSLIAVVYIGLVAMVQEDLK 299

Query: 301 KLIAYSSIAHMGYVTIGIF------------SGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           KLIAYSSIAHMG+VT+G+F             G   G+EGA+ QM+SHGLVS+A+F CVG
Sbjct: 300 KLIAYSSIAHMGFVTLGLFIAFVIFARGVEGEGAVMGLEGALVQMISHGLVSAAMFLCVG 359

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           V+YDR+HTR I  YGG+V+ MP +A  M++F+MAN GLPGTSGF+GEFLVI+  FQ    
Sbjct: 360 VLYDRMHTRMIKDYGGVVNTMPVFASFMVLFSMANAGLPGTSGFVGEFLVILGAFQADFW 419

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
            A LAS  ++L A YSLW+ ++VVFG    + V  LKDL+ RE  ++  +A   +  G++
Sbjct: 420 YAFLASMTLILGAAYSLWMVKRVVFGEVANDNVAALKDLNSREFLVLGSLAAAVLLLGVW 479

Query: 469 PVPIRDTFSVPLSSIIEN 486
           P P+ +     +  ++  
Sbjct: 480 PQPLLEVMHASIEHLLSQ 497


>gi|11497457|ref|NP_042247.1| NADH dehydrogenase (ubiquinone), subunit 4 [Prototheca wickerhamii]
 gi|3122533|sp|Q37617|NU4M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
 gi|467848|gb|AAD12635.1| NADH dehydrogenase (ubiquinone), subunit 4 [Prototheca wickerhamii]
          Length = 523

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 233/495 (47%), Positives = 321/495 (64%), Gaps = 32/495 (6%)

Query: 3   LPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           + ++ +V  +P LG   +LF        ++   +AL  S + F+ SL +W  FD   + F
Sbjct: 25  MSYIEMVLAIPLLGAIALLFVP--SWKTQTIRNIALNSSLLTFLISLLLWIEFDSSSALF 82

Query: 63  QMIEYYHWIDYFCS----------------------YHLGVDGISILLVVLTTFLTPFCI 100
           Q      + D  CS                      + LGVDGIS+  ++LTT L P CI
Sbjct: 83  Q------FTDGVCSPNVYSDVTLAKAASSSSFSALNFALGVDGISLFFIILTTLLVPICI 136

Query: 101 LSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER 160
           L SW +I+   +EY IAFLVLE++++  F  LD+LLFYIFFE+ LIPMF+IIGVWG  ER
Sbjct: 137 LVSWNNIEVYVKEYCIAFLVLETLMLTVFSVLDLLLFYIFFESVLIPMFIIIGVWGSRER 196

Query: 161 -IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSF 219
            I AAY+FFLYT FGS+ ML AI+++ ++  T  I  LY +S F  + Q  +W+AFF SF
Sbjct: 197 KIRAAYQFFLYTLFGSVLMLLAILLIYFQTGTLDIEMLY-LSDFSETRQCILWLAFFASF 255

Query: 220 AIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIF 279
           A+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +PLFP A  YF P+I+
Sbjct: 256 AVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPLFPYACIYFTPLIY 315

Query: 280 FLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLV 339
            +S+IAI+Y S  ++ Q D+KK+IAYSS+AHM +VTIG+FS    G+EG++  M+SHGLV
Sbjct: 316 TMSVIAIVYTSCTTIRQIDLKKIIAYSSVAHMNFVTIGLFSQNTQGIEGSILLMISHGLV 375

Query: 340 SSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVI 399
           S ALF CVGV+YDR  TR +  Y G    MP +A++ + FTMAN+ LPGTS F GEFLV 
Sbjct: 376 SPALFLCVGVLYDRHKTRLLRYYSGCGQTMPIFALLFVFFTMANISLPGTSSFPGEFLVF 435

Query: 400 MSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIA 459
           +  +QN++ VA  A+ G+VL A Y+LWL  ++++GVSK + +    D++ RE  M  P+ 
Sbjct: 436 IGSYQNNSFVAFCAATGMVLGAAYALWLCNRLIYGVSKPDFINTWSDVNRREFFMFAPLI 495

Query: 460 VLTVFFGIYPVPIRD 474
              ++ G+YP P  D
Sbjct: 496 AGILWIGVYPEPFLD 510


>gi|227822755|ref|YP_002826727.1| NADH-ubiquinone oxidoreductase chain M3 [Sinorhizobium fredii
           NGR234]
 gi|227341756|gb|ACP25974.1| NADH-ubiquinone oxidoreductase chain M3 [Sinorhizobium fredii
           NGR234]
          Length = 491

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/490 (43%), Positives = 314/490 (64%), Gaps = 11/490 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRR--SFFGVALGISTINFIFSLFVWSVFDKG 58
           M  P LS++ FLP  G  V++      C R   +    ALG +  +F F++ + + FD  
Sbjct: 1   MTFPLLSLIVFLPVAGAAVLM------CLRNDDAVRWTALGFTMADFAFAVAMLAGFDTT 54

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
               Q  E Y W+     +Y LGVDGIS L V LT  L   C+L+SW +I    +E+M+A
Sbjct: 55  THEMQFTERYPWVPAIGITYALGVDGISALFVFLTALLGWICVLASWVAIDRKVKEFMVA 114

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
            L ++++++G F +LD+ LFY+ +EA LIPM++IIGVWGG+ R+YAA+KFFLYT  GS+ 
Sbjct: 115 LLSMQALMLGVFSALDLFLFYVCWEAMLIPMYLIIGVWGGAGRVYAAFKFFLYTLAGSLL 174

Query: 178 MLFAIVVMCWEK-KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
            L  ++V+ +   +T  I+ L A    PF +Q W++ AF  +FA+K+PM P HTWLP+AH
Sbjct: 175 FLIGVIVLYFHGGQTFDILALTA-QDLPFDVQSWLFFAFLIAFAVKVPMVPVHTWLPDAH 233

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           VQAPTAGS+ LAG++LKMG YG +RF LP+ P AS Y++ ++  LS +AI+Y  L+++ Q
Sbjct: 234 VQAPTAGSIILAGVLLKMGAYGFLRFSLPMLPEASVYYSTLMLALSALAIVYGGLLALAQ 293

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSSI+HMG+VT+GIFS    G+EG + QM +HG+ + ALF  VGVIY+R HT
Sbjct: 294 DDLKKLVAYSSISHMGFVTMGIFSLNLRGLEGGILQMFNHGVTTGALFLFVGVIYERTHT 353

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGGL+   P Y   + +FT+++M LPGT+ F+GE LV+   F  +  V   A  G
Sbjct: 354 RSIADYGGLMKVAPVYTGFLALFTLSSMALPGTNSFVGELLVLSGGFAANMAVGTAAVLG 413

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
            +LSA Y L +YRKV  G +      +++D+++RE   + P+AV  ++ G YP P  +  
Sbjct: 414 ALLSAAYLLGMYRKVALGPASVGARYEIRDVNVREMAAILPLAVFVLWVGFYPKPFLNVI 473

Query: 477 SVPLSSIIEN 486
              + +++  
Sbjct: 474 DASVKNLLTE 483


>gi|302035980|ref|YP_003796302.1| NADH-quinone oxidoreductase membrane subunit M [Candidatus
           Nitrospira defluvii]
 gi|300604044|emb|CBK40376.1| NADH-quinone oxidoreductase, membrane subunit M [Candidatus
           Nitrospira defluvii]
          Length = 522

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 222/491 (45%), Positives = 324/491 (65%), Gaps = 10/491 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P+LS++ FLP  G  + L          S   +ALG++  +F+ SL +W +FD   +  Q
Sbjct: 5   PWLSLIVFLPLAGALLCLL-----VKPESARWLALGVTVADFVLSLPLWWLFDSSTAGMQ 59

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +E   WI      Y LG+DGIS  LV++TTFL PFC+  SW +I +  + +M   LV+E
Sbjct: 60  FVERASWITAPPVQYSLGLDGISFPLVLMTTFLMPFCVTVSWTAIDKRVQLFMSMLLVME 119

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + ++G F++LD +LFY+F+EA LIPM+++IGVWGG  R+YAA KFFLYT  GS+ +L AI
Sbjct: 120 TAMLGVFVALDFVLFYVFWEAMLIPMYLLIGVWGGPNRLYAAIKFFLYTLAGSVLLLVAI 179

Query: 183 VVMCWEKKTSSIIDLYAMSK--FPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           + + ++   +   D+ A+S+  +  S+Q W+++AFF +FA+K+PMFPFHTWLP+AHV+AP
Sbjct: 180 LALYFQGGHT--FDILALSRGTYSTSLQMWLFLAFFAAFAVKVPMFPFHTWLPDAHVEAP 237

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA ++LKMG YG +RF LP+ P A+  F   +  LS+IAIIY + +++ QTDIK
Sbjct: 238 TAGSVILASVLLKMGTYGFLRFTLPMLPDATVTFTKPMIALSIIAIIYGAYMALAQTDIK 297

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS++HMG+VT+GIF     G+EGA+ QM++HG+ +  LF CVG+IY+R H+R I 
Sbjct: 298 KLIAYSSVSHMGFVTLGIFVLNIQGIEGAVMQMVNHGITTGGLFLCVGIIYERTHSRQIQ 357

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
              GL   MPRYA+ +M+F ++++GLPGT+ F+GEFLV+   F  S     LA+ GV+L+
Sbjct: 358 DNTGLAGPMPRYALFLMIFALSSLGLPGTNSFVGEFLVLAGTFVWSQFATALAALGVILA 417

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y LWL ++VVFG         L DL+ RE   + P+ VL    GI+P P+       +
Sbjct: 418 AAYILWLMQRVVFGTPAPAHRAHLLDLNARETATLVPLIVLVFALGIFPNPLLSRMHASV 477

Query: 481 SSIIENYTLKT 491
           + ++      T
Sbjct: 478 TQLLAGQKAPT 488


>gi|313768558|ref|YP_004062232.1| NADH dehydrogenase subunit 4 [Plocamiocolax pulvinata]
 gi|312844685|gb|ADR03248.1| NADH dehydrogenase subunit 4 [Plocamiocolax pulvinata]
          Length = 490

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 236/489 (48%), Positives = 336/489 (68%), Gaps = 15/489 (3%)

Query: 6   LSIVTFLPFLGVFVIL---FSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           L +V+ +P +G+FV+L    S+Y  C +     +AL  S ++F+FSL +W  FD+  S F
Sbjct: 10  LIVVSLIPLIGIFVMLPISSSNYFLCRQ-----IALITSCLSFLFSLLIWVKFDESSSFF 64

Query: 63  QMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVL 121
           Q ++ +    YF   Y +G+DGIS+  V+LTT L   CIL SW SI   F+EY+I+FL+L
Sbjct: 65  QFVDTFILFPYFNLHYIIGIDGISLFFVILTTLLILLCILVSWGSINYFFKEYLISFLIL 124

Query: 122 ESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLF 180
           E ++I  F+ LD+LLFY+FFE+ LIPMF+IIGVWG  +R I AAY+ FLYT  GS+ ML 
Sbjct: 125 EFILIQVFIVLDLLLFYVFFESVLIPMFLIIGVWGSKKRKIRAAYQLFLYTLVGSLLMLL 184

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ + +   ++   DL  + ++ F+  +Q  +WIAFF SFA+KIPM PFH WLP AH +
Sbjct: 185 ALLYIYYLAGST---DLQILWEYNFTEKMQIVLWIAFFASFAVKIPMIPFHIWLPEAHAE 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LAGI+LK+GGYG +RF LP+FPLA  YF+P+IF LS++AIIYAS  ++ Q D
Sbjct: 242 APTAGSVVLAGILLKIGGYGFLRFSLPMFPLACIYFSPLIFMLSVVAIIYASFTTLRQID 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KK+IAYSSI+HMG+VTIGI++    G+EG++  MLSHG +SSALFFCVGV+YDR  TR 
Sbjct: 302 LKKIIAYSSISHMGFVTIGIYTLNIEGIEGSLLLMLSHGFISSALFFCVGVLYDRYQTRI 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           +  Y GL+  MP + V   +FT AN+  PGTS FIGE L+++ +FQ +  +  + +FG+V
Sbjct: 362 LKYYSGLIQVMPLFGVYFFIFTFANISFPGTSSFIGELLILIGIFQLNFLLTFIMAFGMV 421

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           LSA YS+WL+ ++ F   K     + +D+S RE  +++P+  L  + G YP P  +    
Sbjct: 422 LSAAYSVWLFNRLHFYTLKLHYFLKFQDISRREFWIIFPLLFLLFWMGFYPNPFLNVVHF 481

Query: 479 PLSSIIENY 487
            + S+IE +
Sbjct: 482 SVISLIEQF 490


>gi|319779210|ref|YP_004130123.1| NADH-ubiquinone oxidoreductase chain M [Taylorella equigenitalis
           MCE9]
 gi|317109234|gb|ADU91980.1| NADH-ubiquinone oxidoreductase chain M [Taylorella equigenitalis
           MCE9]
          Length = 493

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 220/491 (44%), Positives = 331/491 (67%), Gaps = 13/491 (2%)

Query: 2   NLPFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKG 58
           ++P+L++  F+P + G+FV+ F    G   R+ +   + +  + ++F+ ++ + + FD  
Sbjct: 4   SIPWLTLSIFVPVIAGLFVLFF----GSDERAEYTRRMALIGAIVSFVVTIPLIAGFDAS 59

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            S+FQ  E   WI  F   YHLGVDGIS+  ++LT       I++ W+ I+    +YM A
Sbjct: 60  TSNFQFEENIAWISAFNAHYHLGVDGISVWFILLTAITNILVIVAGWEVIKSRISQYMAA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+L  ++IG F SLD LLFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ 
Sbjct: 120 FLILSGLMIGVFASLDGLLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLL 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
            L A + +  +  T    D+      P ++  Q +++ A F +FA+K+PM+P HTWLP+A
Sbjct: 180 TLVAFIYLYSQSGT---FDIAQWQDLPLALTPQLFIFFALFAAFAVKVPMWPVHTWLPDA 236

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APT GS+ LA IMLK+G YG +RF LP+ P ASQ  A ++  LSL AIIY SLV++V
Sbjct: 237 HVEAPTGGSMVLAAIMLKLGAYGFLRFSLPITPDASQEMAWLMITLSLAAIIYISLVAIV 296

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KKLIAYSS+AHMG+VT+G F     G+EGA+ QM+SHG VS+A+F C+GV+YDRLH
Sbjct: 297 QEDMKKLIAYSSVAHMGFVTLGTFLFTSIGLEGAIIQMISHGFVSAAMFMCIGVMYDRLH 356

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           +R I  YGG+++ MP++    ++F+MAN GLPGTSGFIGEF VI++  Q++  + +LA+ 
Sbjct: 357 SRQIKDYGGVINVMPKFVTFFVLFSMANSGLPGTSGFIGEFYVILAAVQHNFWIGLLAAT 416

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
            ++L A YSLW+ ++V +G  +   V+ + D+  RE  ++  +A+ T+F G+YP    D 
Sbjct: 417 SLILGAAYSLWMVKRVAYGPIRNVHVRDMFDIDSREFAILAILALFTIFMGVYPQAFTDV 476

Query: 476 FSVPLSSIIEN 486
               + +++E+
Sbjct: 477 MHASVQNLLEH 487


>gi|319943360|ref|ZP_08017642.1| NADH-quinone oxidoreductase subunit M [Lautropia mirabilis ATCC
           51599]
 gi|319743175|gb|EFV95580.1| NADH-quinone oxidoreductase subunit M [Lautropia mirabilis ATCC
           51599]
          Length = 499

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/491 (43%), Positives = 333/491 (67%), Gaps = 11/491 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKG 58
           +++ +LS   ++P +   ++L    LG  +R+     +AL  S + F  ++ +++ FD+ 
Sbjct: 8   LSMGWLSAAIWVPIISGIIVL---ALGNEQRATLSRWLALLGSLVGFAVTIPLYTGFDRT 64

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            ++ Q +E   WI+     Y LG+DG+S+ LV+LT F+T   +++ W+ I++   +Y+ A
Sbjct: 65  TAALQFVERKPWIESLGIEYSLGIDGLSVWLVLLTAFITIVVVIAGWEVIKDRVHQYLGA 124

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+L  ++IG F + D +LFY+FFEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ 
Sbjct: 125 FLILSGLMIGVFAAADGMLFYVFFEATLIPMYIIIGVWGGPNRVYAAFKFFLYTLLGSLL 184

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
            + AI+ +  +  +  I+   A  + P ++  Q  +++AF  +FA+KIPM+P HTWLP+A
Sbjct: 185 TMVAIIYLYLQSGSFEIL---AWHRLPLTLHEQVLIFVAFLLAFAVKIPMWPVHTWLPDA 241

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           HV+APT GSV LA IMLK+G Y  +R  LP+ P AS   A ++  LSL+A+IY  LV++V
Sbjct: 242 HVEAPTGGSVVLAAIMLKLGAYAFLRLSLPIAPDASHELAWLMITLSLVAVIYIGLVALV 301

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           QTD+KKL+AYSSIAHMG+VT+G F   ++G++GA+ QM+SHG V+ A+F C+GV+YDRLH
Sbjct: 302 QTDMKKLVAYSSIAHMGFVTLGFFMFNETGMQGAVVQMVSHGFVAGAMFLCIGVLYDRLH 361

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           TR I  YGG+++ MP++A + ++F+MAN GLP TSGF+GEFLVI+   Q    + +LA+ 
Sbjct: 362 TRQIADYGGVINRMPKFAALFLLFSMANAGLPATSGFVGEFLVILGAVQFDFWIGLLAAT 421

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
            ++  A YSLW+Y++VVFG      V +++D++ RE  ++  +A L +F GIYP    D 
Sbjct: 422 ALIWGAGYSLWMYKRVVFGPVANPNVDKMEDVNRREFWLLMLMAALVLFMGIYPKFFTDL 481

Query: 476 FSVPLSSIIEN 486
             V +  ++ +
Sbjct: 482 IQVSVEQLLTH 492


>gi|124266608|ref|YP_001020612.1| NADH dehydrogenase (quinone) [Methylibium petroleiphilum PM1]
 gi|124259383|gb|ABM94377.1| NADH dehydrogenase (quinone) [Methylibium petroleiphilum PM1]
          Length = 491

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/466 (45%), Positives = 318/466 (68%), Gaps = 5/466 (1%)

Query: 26  LGCGRRSFFGV----ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLG 80
           L  GR    GV    AL  + ++F  +L + + FD   +S Q  E   WID F   YHLG
Sbjct: 19  LAAGRDEHAGVVRWIALVAAVLSFAVTLPLVTGFDTATASMQFSENLAWIDRFNVRYHLG 78

Query: 81  VDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIF 140
           VDGIS+  V+LT F+T   ++++W+ + E   +YM AFL+L  +++G F +LD LLFY+F
Sbjct: 79  VDGISVWFVLLTAFITVIVVIAAWEVVTERVNQYMGAFLILSGLMVGVFSALDGLLFYVF 138

Query: 141 FEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAM 200
           FEA+LIPM++IIGVWGG  R+YAA+KFFLYT  GS+ ML A++ + ++   S  I  +  
Sbjct: 139 FEATLIPMYIIIGVWGGPRRVYAAFKFFLYTLLGSLLMLIALIYLYYKSGGSFEILEWHT 198

Query: 201 SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCI 260
              P + Q  ++ AFF +FA+K+PM+P HTWLP+AHV+APT GSV LA IMLK+G YG +
Sbjct: 199 LPLPMTAQTLLFFAFFAAFAVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFL 258

Query: 261 RFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFS 320
           RF +P+ P AS  +A  +  LSLIA++Y  LV++VQ D+KKL+AYSSIAHMG+VT+G F 
Sbjct: 259 RFSMPIAPDASHEWAFFVIALSLIAVLYIGLVALVQQDMKKLVAYSSIAHMGFVTLGFFI 318

Query: 321 GMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFT 380
             + GV G + QM+SHG VS A+F C+GV+YDR+H+R+I +YGG+V+ MP++  + + F 
Sbjct: 319 FNELGVSGGIVQMISHGFVSGAMFLCIGVLYDRVHSREIASYGGVVNTMPKFTALAVFFA 378

Query: 381 MANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEK 440
           MAN GLPGT+GF+GE++VI+   + +  + +LA+  ++  A Y+LW+ ++V FG    + 
Sbjct: 379 MANCGLPGTAGFVGEWMVILGAVKFNFWIGLLAATTLIFGAAYTLWMVKRVYFGAVANDH 438

Query: 441 VQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           V++L D++ RE  M+  +A   ++ G+YP P  D   V ++ ++++
Sbjct: 439 VRELTDINGREFFMLSLLAAAVLWMGVYPKPFTDVMQVSVTELLKH 484


>gi|186920129|ref|YP_001874783.1| NADH dehydrogenase subunit 4 [Hemiselmis andersenii]
 gi|186461075|gb|ACC78237.1| NADH dehydrogenase subunit 4 [Hemiselmis andersenii]
          Length = 486

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 232/486 (47%), Positives = 333/486 (68%), Gaps = 9/486 (1%)

Query: 5   FLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           F+S++  +P  G+F++ F         +    AL  S I F +SLF+W +FD   + FQ 
Sbjct: 5   FISVLIIIPLCGIFLLFFIH--ETNAVAIKMTALVFSLITFFYSLFLWILFDHSTARFQF 62

Query: 65  IEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
            EY  W+  Y   + +GVDGIS+L ++LTT L P CILSSW S++++ +EY   FL++ES
Sbjct: 63  TEYVEWLWSYNLYFFIGVDGISLLFILLTTLLIPLCILSSWSSVKKSIKEYYSYFLLMES 122

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAI 182
           ++I  F SLD+++F+IFFE+ LIPM++IIG WG   R I A ++FFLYT  GS+ ML AI
Sbjct: 123 LLICVFSSLDLIIFFIFFESILIPMYLIIGFWGSRTRKIKAGFQFFLYTLIGSVLMLLAI 182

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
            V+ +E  T+   D   +S F FS   Q  +W+AFF SFAIK+PM PFH WLP AHV+AP
Sbjct: 183 FVIYFETGTT---DYQLVSNFTFSDRRQILLWLAFFMSFAIKVPMMPFHIWLPEAHVEAP 239

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           T+GSV LAG++LKMG YG +RF + LFP  S YF P+++ +S+IA+IY SL ++ Q D+K
Sbjct: 240 TSGSVILAGVLLKMGTYGLLRFSIALFPQGSFYFTPLVYTMSVIAVIYTSLTTLRQIDLK 299

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           K+IAYSS+AHMG+VTIG+FS    G+EG++  MLSHG VSSALF C+GV+Y+R HTR I 
Sbjct: 300 KIIAYSSVAHMGFVTIGLFSLNVQGLEGSIVIMLSHGFVSSALFLCIGVLYERHHTRLIK 359

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            Y G+   +P +++    F+MAN+G PGTS F+GEFL ++ VF+++  V  LA+ G+VL 
Sbjct: 360 YYTGVAQIIPLFSIFFFFFSMANLGFPGTSSFVGEFLTLVGVFESNTCVTFLAATGMVLG 419

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YSLWL  +++FG    E + Q  +++ RE  M+ P+A  T+FFG+YP  I D+  + +
Sbjct: 420 AAYSLWLCNRILFGKLNTEYISQYTEINRREFAMLIPLAFCTLFFGVYPELILDSLHMSV 479

Query: 481 SSIIEN 486
           ++I+  
Sbjct: 480 TNILTK 485


>gi|297538944|ref|YP_003674713.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Methylotenera sp. 301]
 gi|297258291|gb|ADI30136.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylotenera sp. 301]
          Length = 508

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 218/482 (45%), Positives = 327/482 (67%), Gaps = 3/482 (0%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS   ++P L    +LF+S       + + VAL      F+ ++ +++ F+     FQ  
Sbjct: 15  LSFSIWVPVLAGIAVLFTSNDNKPDTTRW-VALIGGLAAFLVTIPLYTHFNFADGGFQFQ 73

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E ++WI  F  +YHLG DGI+I L++LT+F T   I+S+W+ I++   +YM +FL++  +
Sbjct: 74  EGFNWIPAFHINYHLGADGIAIPLILLTSFTTVIVIISAWEVIEKRVAQYMASFLIMSGL 133

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           +IG F +LD +L+Y+F+EA LIPMF++IG+WGG  R+YA  KFFLYT  GS+ ML A + 
Sbjct: 134 MIGVFSALDAILYYVFWEAMLIPMFLVIGIWGGPNRVYATVKFFLYTLLGSLLMLVAFIY 193

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           +     +  I+D Y   + P ++Q  +++AFF +FA+KIPM+P HTWLP+AHV+APT GS
Sbjct: 194 LYMNTNSFEIVDFYNY-QMPLNVQVLIFLAFFAAFAVKIPMWPVHTWLPDAHVEAPTGGS 252

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LA I LK+GGY  +RF +P+ P A+ Y +  +  LSLIAI+Y +LV++VQ D+KKLIA
Sbjct: 253 VVLAAIALKLGGYSFLRFAMPIAPDAAHYLSGFMITLSLIAIVYIALVALVQKDMKKLIA 312

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSSI+HMG+VT+G F     G+EGA+ QM+SHG +S+A+F CVGV+YDR+H+R+I +YGG
Sbjct: 313 YSSISHMGFVTLGFFIFNNLGLEGAIVQMVSHGFISAAMFLCVGVLYDRVHSREIKSYGG 372

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           + + MP +A   ++F MAN GLPGTSGF+GEF+VI+   Q +   A LASF ++  A Y+
Sbjct: 373 VANTMPTFAAFAVLFAMANSGLPGTSGFVGEFMVILGAIQENFWYAFLASFTLIFGAAYT 432

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           LW+ ++V +G     KV  LKDL  RE  ++  +AVL +  GIYP P+ D  +  ++ ++
Sbjct: 433 LWMVKRVFYGEIANAKVAALKDLCQREFLILAILAVLVLALGIYPQPLTDMTNATVTQLL 492

Query: 485 EN 486
            +
Sbjct: 493 SH 494


>gi|23464596|ref|NP_696964.1| NADH dehydrogenase subunit 4L [Monosiga brevicollis ATCC 50154]
 gi|23344059|gb|AAN28335.1| NADH dehydrogenase subunit 4L [Monosiga brevicollis]
          Length = 498

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/455 (46%), Positives = 310/455 (68%), Gaps = 13/455 (2%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYH-----LGVDGISILLVV 90
           +ALG S +  + SL +W  FD   S FQ I   +WI+   + +     LG+DGIS++ ++
Sbjct: 36  IALGTSILTLLESLRLWFHFDYSTSKFQYILKLNWINDELTSNSWNIVLGIDGISLVFII 95

Query: 91  LTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFV 150
           LTT L P CILSSW S++   + Y+I+FLV+E ++IG F  LD+  FYI FE  LIPM++
Sbjct: 96  LTTLLIPICILSSWDSVKILVKGYLISFLVIEILLIGVFTILDIFGFYILFEGVLIPMYL 155

Query: 151 IIGVWGGSE-RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQY 209
           IIG+WG  E +I A Y FF YT  GS+ ML  I+ +     T+  + L      P + Q 
Sbjct: 156 IIGIWGSREQKITAGYYFFFYTLIGSVLMLIGILYLYSISGTTDYLTLLGYEIDP-TAQK 214

Query: 210 WMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPL 269
           ++++AFF S A+KIP FPFH WLP AHV+AP AGSV LAGI++K+GGYG IRF +PL P 
Sbjct: 215 YLFLAFFASLAVKIPKFPFHIWLPQAHVEAPVAGSVILAGILIKLGGYGFIRFTIPLLPD 274

Query: 270 ASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGA 329
           AS YFAP++F L ++A+IYASL ++ QTD+K++IAYSS++HMG V++GIF+   +G+ G+
Sbjct: 275 ASHYFAPLVFILGVLAVIYASLTTLRQTDLKRIIAYSSVSHMGLVSLGIFTLTANGIMGS 334

Query: 330 MFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGT 389
           +F  L+HGLVSSALF  V V+YDR HTR +  Y G+   MP Y+ + + FT+AN+ +P +
Sbjct: 335 IFLQLAHGLVSSALFIIVTVLYDRHHTRLVKYYRGMTVTMPIYSFLFLFFTLANIAVPLS 394

Query: 390 SGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFG------VSKCEKVQQ 443
             F+GEFL ++++F+ + TVA+LAS G++LSA YSL+LY +V FG       +    +  
Sbjct: 395 CNFVGEFLCLLAIFEVNTTVAILASLGIILSACYSLFLYNRVCFGSFSTYLSNNSYHLLS 454

Query: 444 LKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           +KD+S RE  +++P+ +LT+  G+YP PI D  ++
Sbjct: 455 IKDVSRREFFVLFPLVILTIILGVYPHPIFDLLNI 489


>gi|284106857|ref|ZP_06386300.1| NADH dehydrogenase subunit M [Candidatus Poribacteria sp. WGA-A3]
 gi|283830036|gb|EFC34312.1| NADH dehydrogenase subunit M [Candidatus Poribacteria sp. WGA-A3]
          Length = 520

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/486 (45%), Positives = 334/486 (68%), Gaps = 9/486 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P+L++V FLP LGV  IL              VALG+S++ F+ SL  W++FD+   + Q
Sbjct: 7   PWLTLVVFLPLLGVAAILLVEEALAKW-----VALGVSSLGFLVSLAPWALFDESTPAMQ 61

Query: 64  MIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +E + WI     +Y +GVDGIS+ LV+LTT LTP C++ SW +IQ   RE+MI+ LV+E
Sbjct: 62  FVETHQWIASPSINYAVGVDGISLPLVLLTTLLTPLCVVVSWTAIQTRVREFMISLLVME 121

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           +  +G F+SLD +LFY+F+E  LIPM+++IG+WGG  R+YAA KFFLYT  GS+ +L AI
Sbjct: 122 TATLGVFVSLDFVLFYVFWETMLIPMYLLIGIWGGPNRVYAAIKFFLYTLAGSVLLLVAI 181

Query: 183 VVMCWEKKTSSIIDLYAMS--KFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           +V+ +     S  D+  +S  ++P  +Q W++ AFF +FA+K+PMFPFHTWLP+AHV+AP
Sbjct: 182 IVLYFYAGAESF-DILTLSDAEYPPWLQAWLFWAFFAAFAVKVPMFPFHTWLPDAHVEAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA ++LK+G YG +RF LP+ P A+Q F  V+ FLS++AIIY + ++  Q D+K
Sbjct: 241 TAGSVMLASVLLKLGAYGFLRFSLPMLPDATQQFTSVVLFLSVVAIIYGAYMAFAQADLK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS++HMG+VT+GIF     G+EGA+ QM++HG+ + ALF CVG++Y+R H+R+I 
Sbjct: 301 KLIAYSSVSHMGFVTLGIFVLNAQGIEGAILQMVNHGITTGALFLCVGIVYERTHSREIV 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
              GL  +MP YA  +++F ++++GLPG + F+GEF V++  F  +  VA +A+ GV+L+
Sbjct: 361 DNSGLATSMPVYATFLVIFALSSVGLPGMNSFVGEFFVLVGAFMWNKAVAAVAALGVILA 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y LW+ ++VV+G        +L D++  E  M+ P+A L  + G+YP P+ D     +
Sbjct: 421 AAYILWMLQRVVYGTPAKHMSSKLYDMNWCEIGMLAPLAFLVFWIGLYPKPLLDVMHASV 480

Query: 481 SSIIEN 486
             +++ 
Sbjct: 481 DHLVQK 486


>gi|88812964|ref|ZP_01128207.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrococcus mobilis Nb-231]
 gi|88789742|gb|EAR20866.1| Proton-translocating NADH-quinone oxidoreductase, chain M
           [Nitrococcus mobilis Nb-231]
          Length = 501

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 223/499 (44%), Positives = 328/499 (65%), Gaps = 18/499 (3%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS++ +LP LG  ++L +     G  + + +ALG   + F+ S  ++  F+ G  + Q +
Sbjct: 2   LSLLIWLPILGGILVLAAGERSQGTTARW-LALGTGGVVFLLSSALYFGFEIGTPAMQFV 60

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E   WI  F   YHLGVDGIS+ L++LTTF T   I++ W+ IQ    +Y+ AFL++E +
Sbjct: 61  ERLAWIPAFEVYYHLGVDGISMPLILLTTFATVLVIIAGWEVIQYKQTQYLAAFLIMEGL 120

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           ++G F +LD +LFY+F+EA L+PMF+IIG+WGG  RIYA  KFFLYTF GS+ ML A++ 
Sbjct: 121 MVGVFSALDAILFYVFWEAMLVPMFLIIGIWGGPNRIYATIKFFLYTFMGSVLMLVALIY 180

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           + ++  +  I+D +  +    S Q  +++AF  +FA+K+PM+P HTWLP+AHV+APT GS
Sbjct: 181 LRYQTDSFGILDFHG-TALALSQQVLIFLAFLVAFAVKVPMWPVHTWLPDAHVEAPTGGS 239

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LA IMLK+G YG +RF LP+ P AS   A ++  LSLIA++Y  LV++VQ D+KKLIA
Sbjct: 240 VILAAIMLKIGAYGFLRFSLPITPAASMELAWLLIALSLIAVVYIGLVAIVQEDMKKLIA 299

Query: 305 YSSIAHMGYVTIGIFS---------------GMKSGVEGAMFQMLSHGLVSSALFFCVGV 349
           YSS+AHMG+VT+G F+               G    +EG + QM+SHG VS ALF CVGV
Sbjct: 300 YSSVAHMGFVTLGFFAIFDIFAHTGGVEGSGGAVMALEGGVVQMISHGFVSGALFLCVGV 359

Query: 350 IYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTV 409
           +YDR+H+R I  YGG+ + MP +A   ++F MAN+GLPGTSGF+GEF+VI++ FQ +   
Sbjct: 360 LYDRVHSRLIKDYGGVANRMPIFAAFFVLFAMANVGLPGTSGFVGEFMVILASFQANFWY 419

Query: 410 AVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           A LA+  ++L A Y+LWL ++VV+G     +V  L DL+ RE  ++  +A   +  GI+P
Sbjct: 420 AALAALTLILGAAYTLWLIKRVVYGEVANAQVAALTDLNAREFIVLGVLAGAVLLLGIWP 479

Query: 470 VPIRDTFSVPLSSIIENYT 488
            P+ +     L  +++  T
Sbjct: 480 APLIEVMEPSLQHLLQQVT 498


>gi|84508619|ref|YP_448666.1| NADH dehydrogenase subunit 4 [Desmarestia viridis]
 gi|45925651|gb|AAS79052.1| NADH dehydrogenase subunit 4 [Desmarestia viridis]
          Length = 482

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 301/454 (66%), Gaps = 15/454 (3%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           ALGI++  F+FSLF+W  FD+  S FQ +    W+     +  LGVDGIS+  ++LTT +
Sbjct: 32  ALGITSAVFVFSLFLWLGFDQSTSKFQFVIDSLWLPLANINLILGVDGISLFFIILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   + + + Y+I+FL +E +++  F +LD+L FYIFFE  LIPMF++IG+W
Sbjct: 92  FPLCLLASWSFDKGSVKSYLISFLSMELVLLLVFTNLDLLFFYIFFETVLIPMFLVIGIW 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMW 212
           G  +R I AAY FFLYT  GS+FML  +V +     T+   D  A+S   FS   Q W+W
Sbjct: 152 GSRQRKIRAAYMFFLYTLLGSLFMLIGVVYIYLFAGTT---DYEALSVVGFSSYDQKWLW 208

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           +AFF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L L PLAS 
Sbjct: 209 LAFFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLLPLASV 268

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF P++F LSL  ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   G+E A+ Q
Sbjct: 269 YFTPLVFSLSLFGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGIEAALLQ 328

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
            LSHG VSSALF  +GV+YDR H+R +  YGGL H MP +  + + FTMAN+GLPGTS F
Sbjct: 329 SLSHGFVSSALFLIIGVLYDRWHSRVVKYYGGLTHTMPIFITIFLFFTMANLGLPGTSSF 388

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRER 452
           +GEFL+++S F+ + T    A+  ++L   YSLWL+ ++ +G  K        DLS RE 
Sbjct: 389 VGEFLLLVSAFEANTTACFFAATSMILGGGYSLWLFNRIAYGNVKIVGF----DLSFREF 444

Query: 453 CMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            +  P+ + T+  GIYP      F  P+ + + N
Sbjct: 445 VLFLPLVIGTLVMGIYP----HIFFSPMHATVSN 474


>gi|976350|gb|AAA75278.1| NADH dehydrogenase subunit 4 [Lactuca sativa]
          Length = 495

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 218/453 (48%), Positives = 302/453 (66%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTF 94
           + L  S I F++S  +   FD   +  Q +E   W+ Y    ++LG+DGIS+  V+LTTF
Sbjct: 40  IGLCASLITFLYSPVLRIQFDPSTAKSQFVESLRWLPYENIHFYLGIDGISLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CIL  W  ++   +EY+ A L+ E ++I  F  LD LLFY+  E+ LIPMF+IIGV
Sbjct: 100 LIPICILVGWSGMRSYGKEYITASLIREFLMIAVFRMLDPLLFYVLPESVLIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+ FLYT  GS+FML AI+++ ++  T+ +  +   ++F    Q ++WI
Sbjct: 160 WGSRQRKIKAAYQLFLYTLLGSVFMLLAILLILFQTGTTDL-QILLTTEFSERRQIFLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSLNIQGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+Y R  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYVRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  DL+  E  
Sbjct: 399 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLHKFSDLNGTEVF 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V+ G+YP    D     +S+++++
Sbjct: 459 IFIPFLVGVVWMGVYPKVFPDCMHTSVSNLVQH 491


>gi|9653250|ref|NP_062496.1| NADH dehydrogenase subunit 4 [Chondrus crispus]
 gi|1352567|sp|P48915|NU4M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
 gi|1334501|emb|CAA87623.1| NADH dehydrogenase (ubiquinone), subunit 4 [Chondrus crispus]
          Length = 492

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 328/474 (69%), Gaps = 8/474 (1%)

Query: 1   MNLPF---LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDK 57
           MNL     L + +  P +GVF++L         +     AL IS + F+FSL +W  F+ 
Sbjct: 1   MNLKLFNPLILTSLTPLIGVFILLLIP--SAKEKLCRNFALWISCLTFLFSLLLWIQFNS 58

Query: 58  GRSSFQMIEYYHWIDYFCSYH-LGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMI 116
           G S FQ    + W  +F  Y+ +G+DGIS+  ++LTT L   CIL SW SIQ N ++Y+I
Sbjct: 59  GTSFFQFSTTFLWFPFFNLYYTIGIDGISLFFILLTTLLIISCILVSWSSIQTNLKDYLI 118

Query: 117 AFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGS 175
            FL+LE ++I  F  LD+LLFYI+FE+ LIPMF+I+GVWG  +R I AAY+FFLYT  GS
Sbjct: 119 CFLILEFLLIQVFSVLDLLLFYIYFESVLIPMFLIVGVWGSRQRKIRAAYQFFLYTLIGS 178

Query: 176 IFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNA 235
           + ML A++ + ++  T+ +  L+ + +F    Q ++W++FF SFA+KIPM PFH WLP A
Sbjct: 179 LLMLLALLNIYFQTGTTDLQILWYI-QFSEISQIFLWLSFFASFAVKIPMIPFHIWLPEA 237

Query: 236 HVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMV 295
           H +APTAGSV LAGI+LKMGGYG +RF LP+FP+AS +F P IF LSL+AIIYASL ++ 
Sbjct: 238 HAEAPTAGSVILAGILLKMGGYGFLRFSLPMFPVASIFFTPFIFTLSLVAIIYASLTTLR 297

Query: 296 QTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLH 355
           Q D+KK+IAYSS++HMG+VTIGIFS    G+EG++  MLSHGLVSSALF C+GV+YDR  
Sbjct: 298 QIDLKKIIAYSSVSHMGFVTIGIFSLNIQGIEGSILLMLSHGLVSSALFLCIGVLYDRYK 357

Query: 356 TRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASF 415
           TR I  Y GL+  MP + V  + FT AN+G PGTS FIGE LV++S FQ + T+ + AS 
Sbjct: 358 TRVIKYYSGLIQVMPLFGVFFLFFTFANLGFPGTSSFIGEVLVLLSSFQINKTLTLFASL 417

Query: 416 GVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           G++  A YS+WL+ +++FG  K       +D+S RE  ++ P+A+L ++ GIYP
Sbjct: 418 GMIFGAAYSIWLFNRIIFGSLKLGYFSSFQDISRREFWILIPLAILILWMGIYP 471


>gi|149909807|ref|ZP_01898458.1| NuoM2 NADH-Ubiquinone/plastoquinone (complex I) oxidoreductase
           [Moritella sp. PE36]
 gi|149807139|gb|EDM67095.1| NuoM2 NADH-Ubiquinone/plastoquinone (complex I) oxidoreductase
           [Moritella sp. PE36]
          Length = 500

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/493 (42%), Positives = 322/493 (65%), Gaps = 8/493 (1%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           ++P LSI+ FLP +   ++ F S    G ++       +  ++F+ + ++  +FD   + 
Sbjct: 13  SVPILSILIFLPAIAALLVPFLS----GNKTVRWFTFTVLFVDFLIATWLLVIFDNSTAQ 68

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   W+     +Y LGVDG+S+L + LT+ L   C+L+SW +I +  +E+MI  L 
Sbjct: 69  MQFVESKPWVPSLGITYKLGVDGVSVLFLFLTSLLGWICVLASWTAIAKRIKEFMICLLA 128

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           ++S+++G F +LD+LLFY+F+EA L+PM+++IG+WGG +RIYAA+KFFLYT  GS+  L 
Sbjct: 129 IQSLMLGVFCALDLLLFYVFWEAMLVPMYLMIGIWGGEDRIYAAFKFFLYTLAGSLIFLV 188

Query: 181 AIVVMCWEK-KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQA 239
            I+V+ +   +T  I+ L  +S + F +Q  ++IAF  +FA+K+PM PFHTWLP+AHVQA
Sbjct: 189 GILVLYFAGGRTFDILTLMDVS-YDFELQRGVFIAFLIAFAVKVPMVPFHTWLPDAHVQA 247

Query: 240 PTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDI 299
           PTAGS+ LAG++LKMG YG IRF LP+ P AS YFAP++  LS +AI+Y   +++ Q DI
Sbjct: 248 PTAGSIILAGVLLKMGAYGFIRFSLPMLPDASHYFAPLMQGLSAVAIVYGGFLALAQQDI 307

Query: 300 KKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDI 359
           KKLIAYSSI+HMG++T+G+F+   +G  GA+ QM +HG+ + ALF  +G++Y+R H+RDI
Sbjct: 308 KKLIAYSSISHMGFITLGLFTFTINGTTGAVIQMFNHGITTGALFLFIGLVYERTHSRDI 367

Query: 360 FAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVL 419
            AYGGL+  +P Y +   +F +++M +PGT+GFIGE LV+   F  +N  A     G +L
Sbjct: 368 PAYGGLLKAVPFYGIFFALFLLSSMAVPGTNGFIGEILVLSGTFGVNNWAATAGVLGALL 427

Query: 420 SALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVP 479
            A Y L +YR+++ G  +     ++ DL+ RE C   P+ +   + G YP P        
Sbjct: 428 GAAYLLGIYRQMLLGPIRIPDAAKMWDLNKRELCCALPLLIFVFWIGFYPKPFLSILQPT 487

Query: 480 LSSIIENYTLKTG 492
           L  ++E  TL  G
Sbjct: 488 LKHLLEQ-TLGAG 499


>gi|258593439|emb|CBE69778.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           (NDH-1, chain M) [NC10 bacterium 'Dutch sediment']
          Length = 554

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/489 (44%), Positives = 312/489 (63%), Gaps = 21/489 (4%)

Query: 1   MNLPFLSIVTFLPFLGVFVI-LFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGR 59
           +  P LS++T+LP +G+ V+ L       G R     AL  +  + + SL++ + FD   
Sbjct: 4   LEFPILSLMTYLPLVGMVVLALLPKESKNGIR---WTALAFTVADLLVSLWIPAYFDSTT 60

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           +  Q +E   WI     +Y  G+DGI++ LV+LTT L+   ++ SW+S+    +EY    
Sbjct: 61  AEMQFVEKVSWIPSIGVTYFFGLDGITLWLVMLTTSLSVITVVCSWESVSMRLKEYYAFM 120

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+LE+ ++G F S+D  LFYIF+E  L+PM+ +IG+WG   R+Y+A KFFLYT FG + M
Sbjct: 121 LMLETGMLGVFFSMDFFLFYIFWEVMLVPMYFLIGIWGSDRRLYSAIKFFLYTLFGGVIM 180

Query: 179 LFAIVVMCW---EKKTSSIIDLYAMSK-------------FPFSIQYWMWIAFFCSFAIK 222
           L  I+ + +    +  +   D++ + K              P S Q  +W+AFF  FAIK
Sbjct: 181 LLGILAVYFYHGAETGTYTFDIFELMKVSYPSTPVVTLLGIPLSFQDLVWLAFFLGFAIK 240

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PMFPFHTWLP+AH  APTAGSV LAG++LKMG YG IRF LP+ P A+Q+F P+I  LS
Sbjct: 241 VPMFPFHTWLPDAHTDAPTAGSVILAGVLLKMGTYGFIRFNLPMLPEATQHFVPMIMTLS 300

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSA 342
           +IAIIY +LV MVQTD+K+LIAYSS++HMG+V +G+F+    GV+GA+ QM++HGL + A
Sbjct: 301 IIAIIYGALVCMVQTDMKRLIAYSSVSHMGFVMLGMFALNFQGVQGAIIQMINHGLSTGA 360

Query: 343 LFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSV 402
           LF  VG+IYDR HTR I  +GGL   MP Y+ +  +   ++MGLPG +GFIGEFL+++  
Sbjct: 361 LFLIVGLIYDRRHTRQISEFGGLSKQMPVYSTLFAIIMFSSMGLPGLNGFIGEFLILVGA 420

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLT 462
           F+ +   A  A  G+VL A Y LWL+++ +FG  +  K   L DLS RE   + PI ++ 
Sbjct: 421 FKVNYVYAAFAVTGIVLGAAYMLWLFQRTMFGALENPKNANLPDLSARELTTLVPIVIMC 480

Query: 463 VFFGIYPVP 471
            + G+YP P
Sbjct: 481 FWIGLYPSP 489


>gi|74317172|ref|YP_314912.1| NADH dehydrogenase subunit M [Thiobacillus denitrificans ATCC
           25259]
 gi|74056667|gb|AAZ97107.1| NADH dehydrogenase I chain M [Thiobacillus denitrificans ATCC
           25259]
          Length = 494

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/433 (46%), Positives = 295/433 (68%), Gaps = 1/433 (0%)

Query: 55  FDKGRSSFQMIEYYHWIDYFCS-YHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFRE 113
           FD   S+ Q +E   WI  F   YHLGVDGIS+ L++L +F+T   +++ W+ IQ+   +
Sbjct: 55  FDNATSAMQFVEKKSWIPAFNVFYHLGVDGISMPLILLNSFVTVLVVIAGWQVIQDKVAQ 114

Query: 114 YMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFF 173
           YM AFL++  ++ GAF +LD +LFY+FFE  LIP+++I+GVWGG  R+YAA+KFFLYT  
Sbjct: 115 YMAAFLIMSGLINGAFAALDGILFYVFFEGMLIPLYLIVGVWGGPNRVYAAFKFFLYTLL 174

Query: 174 GSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLP 233
           GS+ ML +++ + ++   S  I  +  +    + Q  M+ AF  +F +K+PM+P HTWLP
Sbjct: 175 GSLLMLVSLIYLYFQSGGSFDIQSWYTTPLSMTAQTLMFFAFLLAFGVKVPMWPVHTWLP 234

Query: 234 NAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVS 293
           +AHV+APT GSV LA I LK+G YG +RFLLP+ P A+  +A  +  LSLIA+ Y  LV+
Sbjct: 235 DAHVEAPTGGSVVLAAITLKVGAYGLVRFLLPIVPDAAHEYAWFVITLSLIAVAYIGLVA 294

Query: 294 MVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDR 353
           +VQ D+KKLIAYSSIAHMG+VT+G F     G EG + QM+SHG VS+ALF C+GV+YDR
Sbjct: 295 LVQADMKKLIAYSSIAHMGFVTLGFFLFNPLGWEGGLVQMISHGFVSAALFLCIGVMYDR 354

Query: 354 LHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLA 413
           LH+R I  YGGLV+ MP +A   M+F MAN GLP TSGF+GEF+VIM+  + +   A +A
Sbjct: 355 LHSRQIKDYGGLVNRMPVFAAFFMLFAMANSGLPATSGFVGEFMVIMAATEVNFWFAFVA 414

Query: 414 SFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIR 473
           +  ++  A Y+LW+Y++VVFG     +V Q++D++ RE  ++  +A+  +  G+YP P  
Sbjct: 415 ATTLIFGAAYTLWMYKRVVFGSVTNSRVAQMRDVNAREILLLGLLALFVLGMGLYPKPFT 474

Query: 474 DTFSVPLSSIIEN 486
           D     +  ++ +
Sbjct: 475 DVMHASVVDLLAH 487


>gi|302879329|ref|YP_003847893.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Gallionella capsiferriformans ES-2]
 gi|302582118|gb|ADL56129.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Gallionella capsiferriformans ES-2]
          Length = 496

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 221/488 (45%), Positives = 326/488 (66%), Gaps = 10/488 (2%)

Query: 2   NLPFLSIVTFLPFL-GVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKG 58
            LP +S+  +LP L G+ V+      G  + +     L +  S +  + ++ +++ FD  
Sbjct: 4   GLPVISVTIWLPILFGILVL----ATGDDKNAPLARLLALVGSVLGCLVTIPLYTGFDIS 59

Query: 59  RSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
            S+ Q +E + WI  F   YHLGVDGIS+L ++L +F T   +L+ WK I++    YM A
Sbjct: 60  TSNMQFVELHDWITRFNIHYHLGVDGISMLFILLNSFFTVIVVLAGWKVIEKRVAMYMAA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FLV+  +V G F +LD +LFY+F+EA LIPMF+IIG+WGG  RIYA  KFFLYT  GS+ 
Sbjct: 120 FLVMSGIVNGVFAALDSILFYVFWEAMLIPMFIIIGIWGGPNRIYATMKFFLYTLLGSLL 179

Query: 178 MLFAIVVMCWEKKTS-SIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           ML A++ +      S +I+D + ++  P + Q  ++IAFF +FA+K+PMFP HTWLP+AH
Sbjct: 180 MLVALIYLYNLSGGSFAILDFHHLA-IPMTAQILIFIAFFFAFAVKVPMFPVHTWLPDAH 238

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GSV LA IMLK+G YG +RF +P+ P AS   A V+  LSLIAI+Y  LV+++Q
Sbjct: 239 VEAPTGGSVVLAAIMLKVGAYGFLRFSMPITPDASHKLAGVMIALSLIAIVYIGLVALMQ 298

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           +D+KKL+AYSSI+HMG+VT+G+F     G+EGA+ QMLSHG V+ ALF C+GV+YDR+H+
Sbjct: 299 SDMKKLVAYSSISHMGFVTLGLFIFNAYGMEGALLQMLSHGFVAGALFLCIGVLYDRVHS 358

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGG+V+ MP +A   M+F MAN GLPGTS F+GEF+VIM   + +   A  A+  
Sbjct: 359 RQIADYGGVVNKMPVFAAFFMLFAMANSGLPGTSAFVGEFMVIMGTIKVNFWYAFAAAST 418

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++  A Y+LW+Y++V+FG      V++L D++ RE  ++  +A   +  GIYP+P+ +  
Sbjct: 419 LIFGAAYTLWMYKRVIFGAVTNHHVEELTDINAREILIMTILAFFVLAMGIYPLPVSEIL 478

Query: 477 SVPLSSII 484
              ++ ++
Sbjct: 479 HASVNDLL 486


>gi|257095307|ref|YP_003168948.1| NADH dehydrogenase subunit M [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047831|gb|ACV37019.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 494

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/493 (43%), Positives = 320/493 (64%), Gaps = 12/493 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI--STINFIFSLFVWSVFDKGRSS 61
           P LS+  ++P L   V+L +   G  R +     L +  +    + ++ +++ FD    +
Sbjct: 5   PLLSLAIWIPILAGLVVLAT---GSDRNAPLARMLSLLGAVAGLLVTIPLYTGFDMLTPA 61

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            Q +E   WI  F  +YHLGVDGIS+L V+L +F+T   IL+ W+ I     +Y   FL+
Sbjct: 62  MQFVELKTWIPRFNVNYHLGVDGISMLFVILNSFITVTVILAGWQVIDSKVAQYNAGFLI 121

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +  ++ G F +LD LLFY+FFEASLIP+++IIG+WGG  R+YAA+KFFL+T  GS+  L 
Sbjct: 122 MSGLLNGIFSALDGLLFYVFFEASLIPLYLIIGIWGGPRRVYAAFKFFLFTLMGSLLFLI 181

Query: 181 AIVVMCWEKKTS-SIIDLYAM--SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           A++ M  +   S SI+D + M   + P   Q W+++AF  +FA+K+PM+P HTWLP+AHV
Sbjct: 182 ALLYMFIQSGGSFSILDWHQMPLGRTP---QTWLFLAFLIAFAVKVPMWPVHTWLPDAHV 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APT GS+ LA I LK+G YG +RF LP+ P AS   + ++  LSLIAIIY   V++ Q 
Sbjct: 239 EAPTGGSIVLAAIALKLGAYGFLRFSLPIAPDASHQLSGLVIGLSLIAIIYIGFVALAQE 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KKL+AYSSIAHMG+VT+G F     GVEGA+ QM+SHG VS A+FF +GV+YDR H+R
Sbjct: 299 DMKKLVAYSSIAHMGFVTLGFFMFSALGVEGALVQMISHGFVSGAMFFSIGVMYDRAHSR 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  YGG+V+ MP++A   M+F MAN GLP TSGF+GEF+VI++  + +  VA  A+  +
Sbjct: 359 QIADYGGVVNRMPKFAAFFMLFAMANAGLPATSGFVGEFMVILAAVEYNFWVAFAAASTM 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           ++ A Y+LW+Y++VVFG      V +L D++ RE  ++   AV  +  G+YP P  +   
Sbjct: 419 IVGAAYTLWMYKRVVFGAVANHHVAELTDINGREFFILALFAVGALGMGLYPQPFTEVMH 478

Query: 478 VPLSSIIENYTLK 490
             ++ ++ +  L 
Sbjct: 479 SSVNELLRHVALS 491


>gi|321401337|gb|ADW83092.1| NADH dehydrogenase subunit 4 [Pavlova lutheri]
          Length = 478

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 222/448 (49%), Positives = 309/448 (68%), Gaps = 3/448 (0%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLT 96
           ALG +++ F  SL +   FD+  S FQ  EY+ W   F  + LGVDG+S+ L++LTTFL 
Sbjct: 32  ALGSTSLAFFVSLNLIVFFDETFSGFQFKEYFMWTPSF-QFALGVDGLSLYLIILTTFLF 90

Query: 97  PFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWG 156
           P C+L +W +++   +EY IA L+LES +I  F  LD+ LFYI FEA+L+PMF I+GVWG
Sbjct: 91  PVCVLIAWSAVKTYTKEYFIALLLLESFLIAVFTLLDLFLFYIAFEATLLPMFFIVGVWG 150

Query: 157 G-SERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAF 215
             S RI AAY+ FLYT FGS+FML  I+ + W    ++  ++ + + F  S Q ++W+AF
Sbjct: 151 SRSRRINAAYQLFLYTLFGSVFMLIGILYI-WYTTGTTNYEILSQTSFSSSDQIFLWLAF 209

Query: 216 FCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFA 275
           F SFA+KIPM PFH WLP AHV+APTAGSV LAG++LK+GGYG +RF + L P A+ +F+
Sbjct: 210 FLSFAVKIPMVPFHIWLPEAHVEAPTAGSVILAGVLLKLGGYGLLRFSVGLLPFATSFFS 269

Query: 276 PVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLS 335
           P +  LSL+ IIYASL ++ Q D+KK++AYSSIAHMG+VT+GIFS    G+EG++  MLS
Sbjct: 270 PFVISLSLLGIIYASLSTLQQVDLKKIVAYSSIAHMGFVTLGIFSLNIFGLEGSVILMLS 329

Query: 336 HGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGE 395
           HG++SSALF  VGV+YDR HTR +  YGGLV  MP ++   +V ++AN+ LP TS FIGE
Sbjct: 330 HGVISSALFLLVGVLYDRFHTRLVRNYGGLVQTMPLFSTAFLVLSLANLSLPLTSSFIGE 389

Query: 396 FLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMV 455
             V++  FQNS   A+ + F +VL A YS+WL  ++ FG  K        DL+ RE  ++
Sbjct: 390 IFVVLGAFQNSPVSALFSCFSMVLGAAYSIWLANRICFGNVKTTSSTASFDLTRRESFIL 449

Query: 456 YPIAVLTVFFGIYPVPIRDTFSVPLSSI 483
           +P  +LT+F G++P  I  T  V ++S+
Sbjct: 450 FPFIILTLFLGVFPEVILQTLHVSVASL 477


>gi|145932442|ref|YP_001165354.1| NADH dehydrogenase subunit 4 [Phytophthora ramorum]
 gi|110169640|gb|ABG54105.1| NADH dehydrogenase subunit 4 [Phytophthora ramorum]
 gi|188038004|gb|ACD46622.1| NADH dehydrogenase subunit 4 [Phytophthora ramorum]
          Length = 491

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/425 (49%), Positives = 298/425 (70%), Gaps = 5/425 (1%)

Query: 48  SLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKS 106
           SL +W +FDK  S+FQ +    WI  F  +++LG+DGIS+  ++LTTFL P C+L S++ 
Sbjct: 45  SLPLWILFDKSTSNFQYLFKIEWISQFNINFYLGLDGISLFFIILTTFLIPICMLISYEI 104

Query: 107 IQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAY 165
           I +N +EY I + +LE  +I +F  LD+L+FYIFFE+ LIPMF+IIG+WG  ER I A+Y
Sbjct: 105 INKNIKEYFILYFILEFCLIISFSVLDILIFYIFFESVLIPMFLIIGIWGSRERKIKASY 164

Query: 166 KFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPM 225
            FF+YT  GS+FM  AI+ +     T+    LY  S F FS +   ++AFF SFA+K+PM
Sbjct: 165 LFFMYTLAGSLFMFIAIIHLFLTVGTTDYQILY-YSNFNFSYEKLYFLAFFLSFAVKVPM 223

Query: 226 FPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIA 285
            PFH WLP AHV+APTAGSV LAGI+LK+G YG IRFL+PLFP A+ YF P I  L LI+
Sbjct: 224 LPFHVWLPEAHVEAPTAGSVLLAGILLKLGSYGMIRFLVPLFPKAALYFTPYILVLCLIS 283

Query: 286 IIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFF 345
           IIYASL ++ QTD+K++IAY+S+AHM ++ +GIFS    G+EG++ QM+SHGLVSS LFF
Sbjct: 284 IIYASLTAIRQTDLKRIIAYASVAHMNFIILGIFSLTIQGLEGSIIQMISHGLVSSGLFF 343

Query: 346 CVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQN 405
            +G +YDR HTR I  YGGL H MP + + + ++ +ANM +PG+S F+GE L++  VF++
Sbjct: 344 SIGCLYDRYHTRFINYYGGLAHTMPLFCIALFIYVLANMSIPGSSSFVGEILILTGVFED 403

Query: 406 SNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVF- 464
           + T AV A+ G+ L  +YSL  Y ++ +G  +   +Q   DL+ RE  +++ I +  +F 
Sbjct: 404 NTTTAVFATIGMFLGGVYSLLFYNRICYGNIQNIYLQIYYDLTYRE-FLIHLILIANIFL 462

Query: 465 FGIYP 469
            G+YP
Sbjct: 463 LGLYP 467


>gi|145589222|ref|YP_001155819.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047628|gb|ABP34255.1| NADH dehydrogenase subunit M [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 488

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/447 (45%), Positives = 301/447 (67%), Gaps = 2/447 (0%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFC 99
           + I+FI +L +   FD      Q +E   WI  Y  +YHLG+DGIS+  +VLT F+  F 
Sbjct: 37  AVISFIATLPLVLNFDIANPGMQFVEKMSWIPRYDINYHLGIDGISVWFIVLTAFINIFV 96

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           ++++W+ I+    +YM +F++L  ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  
Sbjct: 97  VIAAWEVIETKVSQYMASFMILSGLMIGVFCALDALLFYVFFEATLIPMYIIIGVWGGHN 156

Query: 160 RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSF 219
           RIYAA+KFFLYT  GS+  L A++ +     T  I+  +  ++     Q  ++ AFF +F
Sbjct: 157 RIYAAFKFFLYTLLGSLLTLVAMLYLYNVTNTFDILT-WQNARLDIVEQILLFFAFFMAF 215

Query: 220 AIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIF 279
           A+K+PM+P HTWLP+ HV+APT GSV LA IMLK+G YG +RF LP+ P ASQY  P + 
Sbjct: 216 AVKVPMWPLHTWLPDVHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASQYLGPFVI 275

Query: 280 FLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLV 339
           FLSL+A+IY   V++VQ D+KKL+AYSS+AHMG+VT+G F     G+EG + QM+SHG V
Sbjct: 276 FLSLVAVIYVGAVALVQKDMKKLVAYSSVAHMGFVTLGFFLFSPLGIEGGIVQMISHGFV 335

Query: 340 SSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVI 399
           + A+F  +GV+YDR+HTR I  YGG+VH MP +    ++  MAN GLP TSGF+GEF+VI
Sbjct: 336 AGAMFLSIGVLYDRMHTRQIADYGGVVHRMPAFTAFAVLMAMANCGLPATSGFVGEFMVI 395

Query: 400 MSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIA 459
           ++       + +LA+  ++L A YSLW+ ++V FG      V++LKDL+ RE  M+  ++
Sbjct: 396 LAAVDYDFVIGILAATALILGAAYSLWMVKRVFFGAVNNAHVEELKDLNFREYFMMAVLS 455

Query: 460 VLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  +  G+YP P  D     + +++++
Sbjct: 456 ICVIGMGVYPKPFTDIIHPAVINLLQH 482


>gi|145932349|ref|YP_001165397.1| NADH dehydrogenase subunit 4 [Phytophthora sojae]
 gi|110169592|gb|ABG54058.1| NADH dehydrogenase subunit 4 [Phytophthora sojae]
          Length = 491

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/425 (48%), Positives = 298/425 (70%), Gaps = 5/425 (1%)

Query: 48  SLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKS 106
           SL +W +FDK  S+FQ +    WI  F  +++LG+DGIS+  ++LTTFL P C+L S++ 
Sbjct: 45  SLPLWILFDKSTSNFQYLFKIEWISQFNINFYLGLDGISLFFIILTTFLIPICMLISYEI 104

Query: 107 IQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAY 165
           I +N +EY I + +LE  +I +F  LD+L+FYIFFE+ LIPMF+IIG+WG  ER I A+Y
Sbjct: 105 INKNIKEYFILYFILEFCLIISFSVLDILIFYIFFESVLIPMFLIIGIWGSRERKIKASY 164

Query: 166 KFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPM 225
            FF+YT  GS+FM  AI+ +     T+    LY  S F FS +   ++AFF SFA+K+PM
Sbjct: 165 LFFMYTLTGSLFMFIAIIHLFLTVGTTDYQILY-YSNFNFSYEKLYFLAFFLSFAVKVPM 223

Query: 226 FPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIA 285
            PFH WLP AHV+APTAGSV LAGI+LK+G YG IRFL+PLFP A+ YF P I  L LI+
Sbjct: 224 LPFHVWLPEAHVEAPTAGSVLLAGILLKLGSYGMIRFLVPLFPKATLYFTPYILVLCLIS 283

Query: 286 IIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFF 345
           +IYASL ++ QTD+K++IAY+S+AHM ++ +GIFS    G+EG++ QM+SHGLVSS LFF
Sbjct: 284 VIYASLTAIRQTDLKRIIAYASVAHMNFIILGIFSLTIQGLEGSIIQMISHGLVSSGLFF 343

Query: 346 CVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQN 405
            +G +YDR HTR I  YGGL H MP + + + ++ +ANM +PG+S F+GE L++  +F++
Sbjct: 344 SIGCLYDRYHTRFINYYGGLAHTMPLFCIALFIYVLANMSIPGSSSFVGEILILTGIFED 403

Query: 406 SNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVF- 464
           + T AV A+ G+ L  +YSL  Y ++ +G  +   ++   DL+ RE  +++ I +  +F 
Sbjct: 404 NTTTAVFATIGMFLGGIYSLLFYNRICYGNIQNIYLKIYYDLTYRE-FLIHLILIANIFL 462

Query: 465 FGIYP 469
            G+YP
Sbjct: 463 LGLYP 467


>gi|296117466|ref|ZP_06836053.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295975987|gb|EFG82778.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 505

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/483 (42%), Positives = 316/483 (65%), Gaps = 3/483 (0%)

Query: 5   FLSIVTFLPFLGVFVILFS-SYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
            LS+VT+LP  GV  I+ +         S   VAL  S I F+ S+ +W  FD      Q
Sbjct: 5   LLSLVTYLPLGGVLAIMLTRGTTEAVETSARWVALWTSAIVFVLSVVMWVQFDPTHIGLQ 64

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             +   W   F  SYH GVDGIS++ V+L+TFLTP  I+  WK +    R+YM+A L+LE
Sbjct: 65  FEQRATWASAFGVSYHAGVDGISLMFVLLSTFLTPLAIIGGWKLVNTRVRDYMVAMLLLE 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + +IG F + D++LFY+F+EA+L+P  ++IG+WGG +R++A+ +FFL+TF GS+FML A+
Sbjct: 125 TTLIGLFSAQDLVLFYVFYEATLLPGSLMIGIWGGPKRVWASLQFFLFTFGGSLFMLIAL 184

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           +VM W    ++ I     + F  ++Q W+   F  +F +K+P+FP H WLP+A+ +APT 
Sbjct: 185 LVM-WNVAGTTDIPALQHASFSHAMQGWLLAGFILAFGVKLPLFPLHAWLPDAYTEAPTP 243

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
            SV L+G++ K G YG +RF + +FP A++ FAP I  L ++A+IYA+++++ QTD+K++
Sbjct: 244 ASVMLSGVLSKAGAYGLLRFGVLMFPDAARVFAPYILTLGVVAVIYAAIIALAQTDMKRV 303

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS +HMG + IG+F+    G++GA+FQMLSHG+V +ALFFCV  +  R  TR+I A+
Sbjct: 304 IAYSSFSHMGVIAIGLFTLTPEGIDGAIFQMLSHGIVIAALFFCVSAVSWRAETREISAF 363

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
            G+ H MP  A + M+F MAN+GLPGT  F+GE LV++     S  +A L    ++L A+
Sbjct: 364 AGVAHKMPVLATLTMLFVMANIGLPGTGAFVGELLVMVGAIHVSFWLAFLGGSSMILGAV 423

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           Y L LYR+V+FG      V  L+DL+  E  ++ P+AV+T++ GI+P      F+  +SS
Sbjct: 424 YMLVLYRRVMFGQGAGGMVALLRDLTGPELAVLVPLAVVTLWMGIHPGTFLRVFNPTVSS 483

Query: 483 IIE 485
           +++
Sbjct: 484 LVQ 486


>gi|9695383|ref|NP_037605.1| NADH dehydrogenase subunit 4 [Phytophthora infestans]
 gi|6692636|gb|AAF24779.1|U17009_11 NADH dehydrogenase subunit 4 [Phytophthora infestans]
 gi|58012141|gb|AAW62549.1| NADH dehydrogenase subunit 4 [Phytophthora infestans]
 gi|58201980|gb|AAW67035.1| NADH dehydrogenase subunit 4 [Phytophthora infestans]
 gi|58202027|gb|AAW67081.1| NADH dehydrogenase subunit 4 [Phytophthora infestans]
          Length = 491

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/440 (47%), Positives = 302/440 (68%), Gaps = 5/440 (1%)

Query: 48  SLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKS 106
           SL +W +FDK  S+FQ +    WI  F  +++LG+DGIS+  ++LTTFL P C+L S++ 
Sbjct: 45  SLPLWILFDKSTSNFQYLFKIEWISQFNINFYLGLDGISLFFIILTTFLIPICMLISYEI 104

Query: 107 IQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAY 165
           I +N +EY I + +LE  +I +F  LD+L+FYIFFE+ LIPMF+IIG+WG  ER I A+Y
Sbjct: 105 ITKNIKEYFILYFILEFCLIISFSVLDILIFYIFFESVLIPMFLIIGIWGSRERKIKASY 164

Query: 166 KFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPM 225
            FF+YT  GS+FM  AI+ +     T+    LY  S F FS +   ++AFF SFA+K+PM
Sbjct: 165 LFFMYTLAGSLFMFIAIIHLFLTVGTTDYQILY-YSNFNFSYEKLYFLAFFLSFAVKVPM 223

Query: 226 FPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIA 285
            PFH WLP AHV+APTAGSV LAGI+LK+G YG IRFL+PLFP A+ YF P I  L LI+
Sbjct: 224 LPFHVWLPEAHVEAPTAGSVLLAGILLKLGSYGMIRFLVPLFPKATLYFTPYILVLCLIS 283

Query: 286 IIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFF 345
           +IYASL ++ QTD+K++IAY+S+AHM ++ +GIFS    G+EG++ QM+SHGLVSS LFF
Sbjct: 284 VIYASLTAIRQTDLKRIIAYASVAHMNFIILGIFSLTIQGLEGSIIQMISHGLVSSGLFF 343

Query: 346 CVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQN 405
            +G +YDR HTR I  YGGL H MP + + + ++ +ANM +PG+S F+GE L++  +F++
Sbjct: 344 SIGCLYDRYHTRFINYYGGLAHTMPLFCIALFIYVLANMSIPGSSSFVGEILILTGIFED 403

Query: 406 SNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVF- 464
           + T AV A+ G+ L  +YSL  Y ++ +G  +   ++   DL+ RE  +++ I +  +F 
Sbjct: 404 NTTTAVFATIGMFLGGIYSLLFYNRICYGNIQNIYLKIYYDLTYRE-FLIHLILIANIFL 462

Query: 465 FGIYPVPIRDTFSVPLSSII 484
            G+YP          +S I+
Sbjct: 463 LGLYPKIFESCLHESVSKIL 482


>gi|200004028|ref|YP_002221363.1| NADH dehydrogenase subunit 4 [Blastocystis sp. DMP/02-328]
 gi|198385452|gb|ACH86046.1| NADH dehydrogenase subunit 4 [Blastocystis sp. DMP/02-328]
          Length = 487

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/452 (45%), Positives = 313/452 (69%), Gaps = 3/452 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTF 94
           ++L  +TI F  S+F+  +F+K    FQ +    W+++F  ++ +G+DGIS+  ++LTTF
Sbjct: 33  ISLYSTTITFFISIFLLFLFNKSTIYFQGLYECKWLNFFNINFIIGIDGISLFFILLTTF 92

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CILSS+  I+ NF+ + I FL +ES++I  F  LD++ FY+FFE+ LIPM++I+G 
Sbjct: 93  LFPLCILSSFNYIKFNFKFFYINFLFMESILILVFSCLDIIFFYVFFESVLIPMYLILGF 152

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           +G  ER IYA+Y FF+YTF GS+ ML AI+ + +   T++ + L   +  PF IQ  +WI
Sbjct: 153 FGSRERKIYASYMFFVYTFVGSVLMLLAILFIFYYTGTTNYLVLLTCNFDPF-IQKILWI 211

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM PF+ WLP AHV+APT GSV LAGI+LK+G YG IRF +PLFP A+ Y
Sbjct: 212 AFFLSFAVKVPMLPFYIWLPEAHVEAPTPGSVILAGILLKLGTYGFIRFSIPLFPFANFY 271

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           + P ++ LS++ +IY+S+V++ QTD+K++IAY+SIAHM  + IG+++    G+EG++ QM
Sbjct: 272 YTPFVYTLSILGLIYSSMVAIRQTDLKRIIAYASIAHMNLIMIGLYTNKIYGLEGSLLQM 331

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
            SHGLVS ALF  VG++Y+R HTR I  Y GLV  MP + V+ M+FT+AN+ LP TS FI
Sbjct: 332 FSHGLVSGALFLIVGILYERYHTRLIKYYSGLVQTMPLFTVIFMLFTLANIALPTTSSFI 391

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+ + +F  + T+AV A   ++  ++YSLWL+ +V +G  +   +   +DL+ RE C
Sbjct: 392 GEFLIFLGIFNTNTTIAVFAIISMLFGSIYSLWLFNRVCYGNIQINFISFYQDLNKRELC 451

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIE 485
           M   I ++    G+YP  + D  ++ +S ++ 
Sbjct: 452 MFCIILLVVFLIGLYPTFLLDYLNMSVSFLLN 483


>gi|15150746|ref|NP_150412.1| NADH dehydrogenase subunit 4 [Pylaiella littoralis]
 gi|15147752|emb|CAC50853.1| NADH dehydrogenase subunit 4 [Pylaiella littoralis]
          Length = 482

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/437 (48%), Positives = 299/437 (68%), Gaps = 11/437 (2%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           ALG++++ F+ SLF+W  FD   S FQ +  + W+ +   +  LGVDGIS+  V+LTT +
Sbjct: 32  ALGVTSLVFVCSLFLWLGFDHSTSKFQYVVDWLWVPFANINLVLGVDGISLFFVILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   + + + Y+I+FL +E +++  F +LD+L FY+FFEA LIPMF++IG++
Sbjct: 92  FPLCLLASWSFDKGDVKTYLISFLSMELVLLLVFTNLDLLFFYVFFEAVLIPMFLVIGIY 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMW 212
           G  +R I AAY FFLYT FGS+FML  ++ +     ++   +  A+S   FS   Q W+W
Sbjct: 152 GSRQRKIRAAYMFFLYTLFGSLFMLIGVIYIYLFAGST---NYEALSTVSFSSYDQKWLW 208

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           +AFF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFP AS 
Sbjct: 209 LAFFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPEASL 268

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF P +F LSL+ ++Y  L ++ QTD+K+L AY+S+AHM  V IG+F+G   GVE ++ Q
Sbjct: 269 YFTPFVFSLSLLGVVYTLLTAIRQTDLKRLTAYTSVAHMNLVMIGLFTGTVIGVEASILQ 328

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
            LSHG VSSALF  +GV+YDR H+R I  YGGL H MP + ++ + FTMAN+GLPGTS F
Sbjct: 329 SLSHGFVSSALFLIIGVLYDRFHSRVIKYYGGLTHTMPLFIIIFLFFTMANLGLPGTSSF 388

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRER 452
           +GEFL++ S F+ + T+ + A+  ++L   YSLWL+ ++ +G  K   +    DLS RE 
Sbjct: 389 VGEFLLLASAFEANTTLCLFAATSMILGGGYSLWLFNRIAYGNIKIVGL----DLSFREF 444

Query: 453 CMVYPIAVLTVFFGIYP 469
            +  P+   T+F GIYP
Sbjct: 445 IIFLPLVSGTLFMGIYP 461


>gi|299830472|ref|YP_003734843.1| NADH dehydrogenase subunit 4 [Pythium ultimum]
 gi|269810849|gb|ACZ43878.1| NADH dehydrogenase subunit 4 [Pythium ultimum]
 gi|269812162|gb|ACZ44460.1| NADH dehydrogenase subunit 4 [Pythium ultimum]
          Length = 491

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 285/403 (70%), Gaps = 3/403 (0%)

Query: 51  VWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQE 109
           +W +FDK  S+FQ +    WI  F  +++LG+DGIS+  ++LTTFL P C+L S++ I +
Sbjct: 48  LWILFDKSTSNFQYLFKIDWISQFNINFYLGIDGISLFFIILTTFLIPICMLISYEIINK 107

Query: 110 NFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFF 168
           N +EY I + +LE  +I +F  LD+L+FYIFFE+ LIPMF+IIG+WG  ER I A+Y FF
Sbjct: 108 NVKEYFILYFILEFCLIISFSVLDLLIFYIFFESVLIPMFLIIGIWGSRERKIKASYLFF 167

Query: 169 LYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPF 228
           +YT  GS+FM  AI+ +     T+    LY  S F FS +   W+AFF SFA+K+PM PF
Sbjct: 168 MYTLAGSLFMFVAIIHLFLTVGTTDYQILY-YSNFDFSYEKLYWLAFFLSFAVKVPMLPF 226

Query: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288
           H WLP AHV+APTAGSV LAGI+LK+G YG +RFL+PLFP A+ YF P +  L LI++IY
Sbjct: 227 HVWLPEAHVEAPTAGSVILAGILLKLGSYGMVRFLIPLFPKATVYFTPYVLVLCLISVIY 286

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           ASL ++ QTD+K++IAY+S+AHM ++ +GIFS    G+EG++ QM+SHGL+SS LFF +G
Sbjct: 287 ASLTAIRQTDLKRIIAYASVAHMNFIVLGIFSLTIQGLEGSIIQMISHGLISSGLFFSIG 346

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
            +YDR HTR I  YGGL H MP + + + ++ +ANM +PG+S F+GE L++  VF+++ T
Sbjct: 347 CLYDRYHTRFINYYGGLAHTMPLFCIALFIYVLANMSIPGSSSFVGELLILTGVFEDNTT 406

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRE 451
            A+ A+ G+ L  +YSL  Y ++ +G  +   ++   DL+ RE
Sbjct: 407 TAIFATIGMFLGGVYSLLFYNRICYGNIQNVYLKVYYDLTYRE 449


>gi|319738246|emb|CBJ18022.1| NADH dehydrogenase subunit 4 [Ectocarpus siliculosus]
          Length = 482

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/435 (48%), Positives = 298/435 (68%), Gaps = 7/435 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           AL I+++ F+FSL +W  FD+    FQ +  + W+     +  LG+DGIS+  V+LTT +
Sbjct: 32  ALFITSVVFVFSLLLWLGFDQSTPKFQYVVNWLWLPVANINLVLGIDGISLFFVILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   + + + Y+I+FL +E +++  F +LD+L FYIFFEA LIPMF++IG++
Sbjct: 92  FPLCLLASWSFDKGDIKTYLISFLSMELVLLLVFTNLDLLFFYIFFEAVLIPMFLVIGIY 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           G  +R I AAY FFLYT FGS+FML  ++ +     +++   L  +S F    Q W+W+A
Sbjct: 152 GSRQRKIRAAYMFFLYTLFGSLFMLIGVIYIYLFAGSTNYESLATVS-FSNYDQKWLWLA 210

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFP AS YF
Sbjct: 211 FFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPEASVYF 270

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
            P +F LSL+ ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   GVE A+ Q L
Sbjct: 271 TPFVFSLSLLGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGVEAAILQSL 330

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG VSSALF  +GV+YDR H+R +  YGGL H MP + ++ + FTMAN+GLPGTS FIG
Sbjct: 331 SHGFVSSALFLIIGVLYDRWHSRVVKYYGGLTHTMPIFIIIFLFFTMANLGLPGTSSFIG 390

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           EFL+++S F+ + T    A+  ++L   YSLWL+ ++ +G  K        DLSLRE  +
Sbjct: 391 EFLLLVSAFEANTTACFFAATSMILGGGYSLWLFNRIAYGNVKLVGF----DLSLREFIL 446

Query: 455 VYPIAVLTVFFGIYP 469
             P+ + T+F GIYP
Sbjct: 447 FLPLVIGTLFMGIYP 461


>gi|268053557|ref|YP_003288916.1| NADH dehydrogenase subunit 4 [Saccharina japonica]
 gi|268053596|ref|YP_003288954.1| NADH dehydrogenase subunit 4 [Saccharina religiosa]
 gi|268053635|ref|YP_003288992.1| NADH dehydrogenase subunit 4 [Saccharina ochotensis]
 gi|268053674|ref|YP_003289069.1| NADH dehydrogenase subunit 4 [Saccharina diabolica]
 gi|268053713|ref|YP_003289120.1| NADH dehydrogenase subunit 4 [Saccharina longipedalis]
 gi|262318177|dbj|BAI48502.1| NADH dehydrogenase subunit 4 [Saccharina japonica]
 gi|262318216|dbj|BAI48540.1| NADH dehydrogenase subunit 4 [Saccharina religiosa]
 gi|262318255|dbj|BAI48578.1| NADH dehydrogenase subunit 4 [Saccharina ochotensis]
 gi|262318294|dbj|BAI48616.1| NADH dehydrogenase subunit 4 [Saccharina diabolica]
 gi|262318333|dbj|BAI48654.1| NADH dehydrogenase subunit 4 [Saccharina longipedalis]
          Length = 482

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 297/435 (68%), Gaps = 7/435 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           ALGI++  F+ SLF+W  FD     FQ +    W+     +  LGVDGIS+  V+LTT +
Sbjct: 32  ALGITSAVFVSSLFLWLGFDHSTPKFQFVVDSLWLPIANINLILGVDGISLFFVILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   +   + Y+I+FL +E +++  F +LD+L FYIFFEA LIPMF++IG++
Sbjct: 92  FPLCLLASWSFDKGEVKTYLISFLSMELVLLLVFTNLDLLFFYIFFEAVLIPMFLVIGIY 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           G  ER I AAY FFLYT  GS+FML  IV + +    S+  ++ ++  F    Q W+W+A
Sbjct: 152 GSRERKIRAAYMFFLYTLLGSLFMLIGIVYI-YLFAGSTNYEVLSVINFSTYDQKWLWLA 210

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFPLAS YF
Sbjct: 211 FFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPLASVYF 270

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
            P IF LSL+ ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   GVE A+ Q L
Sbjct: 271 TPFIFSLSLLGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGVEAAILQSL 330

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG VSSALF  +GV+YDR H+R +  YGGL H MP + ++ + FTMAN+GLPGTS FIG
Sbjct: 331 SHGFVSSALFLIIGVLYDRWHSRVVKYYGGLTHTMPIFIIIFLFFTMANLGLPGTSSFIG 390

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           EFL+++S F+ ++T    A+  ++L   YSLWL+ ++ +G  K   +    DLS RE  +
Sbjct: 391 EFLLLVSAFEANSTACFFAATSMILGGGYSLWLFNRIAYGNIKMVGL----DLSFREFMI 446

Query: 455 VYPIAVLTVFFGIYP 469
             P+ + T+F GIYP
Sbjct: 447 FLPLVIGTLFMGIYP 461


>gi|94265861|ref|ZP_01289591.1| Proton-translocating NADH-quinone oxidoreductase, chain M [delta
           proteobacterium MLMS-1]
 gi|93453597|gb|EAT03993.1| Proton-translocating NADH-quinone oxidoreductase, chain M [delta
           proteobacterium MLMS-1]
          Length = 507

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/492 (42%), Positives = 322/492 (65%), Gaps = 8/492 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P+LS + FLP LG  V+L       G  +    AL ++ I    S+ ++ +FD+    +Q
Sbjct: 11  PYLSALVFLPLLGALVMLALP----GDNACRNWALIVTVITACVSMPLFFLFDRSTHLYQ 66

Query: 64  MIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
             E++ WI+ +  +Y LG+DGIS+LLV++TT + P C+L SW+ IQ+  +E+MI  L++E
Sbjct: 67  FGEHHTWIEAWNINYTLGIDGISLLLVLMTTLIMPLCVLGSWRYIQKRVKEFMICLLLME 126

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + ++G F++LD +LFYIF+EA LIPM+++I VWGG  R+YA+ KFFLYT  GS+ +L AI
Sbjct: 127 TAMLGVFMALDFVLFYIFWEAMLIPMYLLIAVWGGPRRMYASIKFFLYTLAGSVMLLVAI 186

Query: 183 VVM--CWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           + +    E +T SI  L   S +  + Q W+++AFF +FAIK+PMFPFHTWLP AHV+AP
Sbjct: 187 IALFLTSEPQTFSIPLLMEQS-YSTTFQIWVFLAFFLAFAIKVPMFPFHTWLPAAHVEAP 245

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSV LA ++LKMG YG +RF LP+ P A+  F P I +LS+I I+Y    ++ Q D+K
Sbjct: 246 TAGSVILASVLLKMGTYGFLRFCLPITPEATHIFMPYILWLSIIGILYGGFTALAQQDMK 305

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSS+ HMG+VT+GIF     G++GA+ QM++HG+ + ALFFCVG++Y+R H+R++ 
Sbjct: 306 KLIAYSSVGHMGFVTLGIFVLNSQGIQGAILQMINHGITTGALFFCVGMLYERTHSRELA 365

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
              G+   MP Y + +  F ++++  PGT+ FIGEF+++   F  S  +A  A  G VL+
Sbjct: 366 LNAGVGRFMPIYVLFLGFFALSSLAFPGTNSFIGEFMILAGSFSYSIIIAAFAIPGAVLA 425

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A Y   L ++VV+G +   + + L DL+LRE  ++ P+ +   + G+ P P  +   V +
Sbjct: 426 AAYMFRLLQRVVWGGTDNPEHRGLLDLNLREVVVLAPLLLFVFWIGLSPAPFLEVMEVSV 485

Query: 481 SSIIENYTLKTG 492
           + ++       G
Sbjct: 486 AHLLTQVGATEG 497


>gi|268164101|ref|YP_003288878.1| NADH dehydrogenase subunit 4 [Saccharina coriacea]
 gi|262318411|dbj|BAI48730.1| NADH dehydrogenase subunit 4 [Saccharina coriacea]
          Length = 482

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 297/435 (68%), Gaps = 7/435 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           ALGI++  F+ SLF+W  FD     FQ +    W+     +  LGVDGIS+  V+LTT +
Sbjct: 32  ALGITSAVFVSSLFLWLGFDHSTPKFQFVVDSLWLPIANINLILGVDGISLFFVILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   +   + Y+I+FL +E +++  F +LD+L FYIFFEA LIPMF++IG++
Sbjct: 92  FPLCLLASWSFDKGEVKTYLISFLGMELVLLLVFTNLDLLFFYIFFEAVLIPMFLVIGIY 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           G  ER I AAY FFLYT  GS+FML  IV +     +++   L  ++  P+  Q W+W+A
Sbjct: 152 GSRERKIRAAYMFFLYTLLGSLFMLIGIVYIYLFAGSTNYEILSVINFSPYD-QKWLWLA 210

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFPLAS YF
Sbjct: 211 FFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPLASVYF 270

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
            P IF LSL+ ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   GVE A+ Q L
Sbjct: 271 TPFIFSLSLLGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGVEAAILQSL 330

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG VSSALF  +GV+YDR H+R +  YGGL H MP + ++ + FTMAN+GLPGTS FIG
Sbjct: 331 SHGFVSSALFLIIGVLYDRWHSRVVKYYGGLTHTMPIFIIIFLFFTMANLGLPGTSSFIG 390

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           EFL+++S F+ ++T    A+  ++L   YSLWL+ ++ +G  K   +    DLS RE  +
Sbjct: 391 EFLLLVSAFEANSTACFFAATSMILGGGYSLWLFNRIAYGNIKMVGL----DLSFREFMI 446

Query: 455 VYPIAVLTVFFGIYP 469
             P+ + T+F GIYP
Sbjct: 447 FLPLVLGTLFMGIYP 461


>gi|84508579|ref|YP_448627.1| NADH dehydrogenase subunit 4 [Fucus vesiculosus]
 gi|39653302|gb|AAR29321.1| NADH dehydrogenase subunit 4 [Fucus vesiculosus]
          Length = 482

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 300/448 (66%), Gaps = 11/448 (2%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFC 99
           +T+ FI SLF+W  FD+    FQ I    W+     +  LGVDGIS+  V+LTT + P C
Sbjct: 36  TTLVFILSLFLWLGFDQSTPKFQFITDSLWLPLANINLILGVDGISLFFVLLTTLIFPLC 95

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           +L+SW   + + + Y+I+FL +E +++  F SLD+L FYIFFEA LIPMF++IG++G  +
Sbjct: 96  LLASWTFNKGDLKTYLISFLSMELVLLLVFTSLDLLFFYIFFEAVLIPMFLVIGIYGSRQ 155

Query: 160 R-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCS 218
           R I AAY FFLYT  GS+FML  +V +     ++S  +  ++ KF    Q W+W+AFF S
Sbjct: 156 RKIRAAYMFFLYTLLGSLFMLVGVVYIYLSVGSTSY-EALSVIKFSSYNQKWLWLAFFAS 214

Query: 219 FAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVI 278
           FA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFP AS YF P I
Sbjct: 215 FAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPEASIYFTPFI 274

Query: 279 FFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGL 338
           F LS++ ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   G+E A+ Q LSHG 
Sbjct: 275 FSLSVLGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGIEAAILQSLSHGF 334

Query: 339 VSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLV 398
           VSSALF  +GV+YDR HTR +  YGGL H MP + ++ + FTMAN+GLPGTS F+GEFL+
Sbjct: 335 VSSALFLIIGVLYDRWHTRGVKYYGGLTHTMPIFIIIFLFFTMANLGLPGTSSFVGEFLL 394

Query: 399 IMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPI 458
            +S F+ + T    A+  ++L  +YSLWL+ ++ +G  K        DLS RE  + +P+
Sbjct: 395 FVSAFEANTTSCFFAATSMILGGVYSLWLFNRIAYGNIKLIG----SDLSYREFVVFFPL 450

Query: 459 AVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
            + T+  GIYP    D F  P+ + + N
Sbjct: 451 VLGTLVMGIYP----DIFFCPMHASVSN 474


>gi|182412577|ref|YP_001817643.1| proton-translocating NADH-quinone oxidoreductase, chain M [Opitutus
           terrae PB90-1]
 gi|177839791|gb|ACB74043.1| proton-translocating NADH-quinone oxidoreductase, chain M [Opitutus
           terrae PB90-1]
          Length = 501

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/473 (45%), Positives = 306/473 (64%), Gaps = 14/473 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG--VALGISTINFIFSLFVWSVFDKGRSS 61
           PFLS++ F P   V V+ F       R   F    ALG+      FSL +   F+    +
Sbjct: 11  PFLSVLIFSPVAAVAVLAFLRNENLQRWWTFAFTTALGL------FSLALLPRFNTDTHA 64

Query: 62  FQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           FQ +E+  W+     +Y LGVDGISILLV LTT +TP C+L+SW  I+   +E+MIA L+
Sbjct: 65  FQFVEHAAWVPALKINYTLGVDGISILLVWLTTLITPLCVLASWNYIKTRVKEFMIALLL 124

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           +E+ ++G F +LD +LF+ F+E+ LIPM ++IGVWGG  RIYA+ KFF+YT  GS+F+L 
Sbjct: 125 METTMVGVFSALDGVLFFAFWESMLIPMALMIGVWGGPRRIYASLKFFVYTMAGSVFLLV 184

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           A++ M  +  T SI D       PFS   Q W++ AFF SFAIK+PMFPFHTWLP AHV+
Sbjct: 185 ALIAMRLQTGTFSIPDTMG---HPFSDGFQAWVFAAFFISFAIKVPMFPFHTWLPAAHVE 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA ++LKMG YG +RF LP+ P A   FAP + +LS+ AI+Y    ++ QTD
Sbjct: 242 APTAGSVLLASVLLKMGAYGFLRFALPITPHAVHTFAPYVMWLSVAAILYGGFAALAQTD 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSS+AHMG+ T+GIF+   +GVEGA   +++HG+ +  LF  VG+IY+RLHTRD
Sbjct: 302 LKKLVAYSSVAHMGFATLGIFALNAAGVEGATLVLINHGVTTGGLFMVVGLIYERLHTRD 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           + A  G+  +MP +A    +F ++++  PGT+ F+GEFLV+   F  S  + V A  G+V
Sbjct: 362 LAAASGIGKHMPVFAFCYGLFCLSSLAFPGTNSFVGEFLVMAGGFSVSKLLVVCAVPGIV 421

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
            +A Y+L + +K+ +G     K   L DL++RE  M  P+ V   + G+ P P
Sbjct: 422 AAAAYNLRMLQKLAWGGVNNPKHPALADLNVREIAMFAPLVVFVFWIGLQPAP 474


>gi|239811627|gb|ACS27114.1| NADH dehydrogenase subunit 4 [Heterosigma akashiwo]
 gi|239811667|gb|ACS27153.1| NADH dehydrogenase subunit 4 [Heterosigma akashiwo]
 gi|288871924|dbj|BAI70610.1| NADH dehydrogenase subunit 4 [Heterosigma akashiwo]
          Length = 491

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 222/454 (48%), Positives = 311/454 (68%), Gaps = 9/454 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHW---IDYFCSYHLGVDGISILLVVLTT 93
           AL +S   F  SLF+W  FD+  + FQ +  + W   ++  C++  GVDGIS+ LV+LTT
Sbjct: 37  ALNLSFFVFFCSLFLWIWFDQSTAKFQFVTSFPWFSSLNINCTF--GVDGISLFLVLLTT 94

Query: 94  FLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIG 153
            L P C+L SW SIQ+  +EY++ FL++E+ +I  F  +D+LLFYIFFE  LIPMFV+IG
Sbjct: 95  LLFPLCLLGSWHSIQKRIKEYVVCFLIMEAFLICVFCVMDLLLFYIFFEGVLIPMFVLIG 154

Query: 154 VWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMW 212
           +WG  ER I AAY FFLYT FGS+FML AI+ + + K  ++  ++ A + F    Q  +W
Sbjct: 155 IWGSRERKIRAAYLFFLYTLFGSLFMLLAILYI-FVKTGTTDYEILAHTTFSSFEQKILW 213

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           +AFF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF LPLFP AS 
Sbjct: 214 LAFFASFATKVPMLPMHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSLPLFPEASY 273

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
           YF P+++ ++ + +IY S  ++ QTD+K++IAY+S+AHM  V +G+FS    G+EGA+ Q
Sbjct: 274 YFTPLVYTMATLGVIYTSFTAIRQTDLKRIIAYASVAHMNLVMMGLFSFNLPGLEGALLQ 333

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
            LSHG VSSALF C+GV+YDR HTR +  Y GLVH MP   V+++ FTMAN+GLPGTS F
Sbjct: 334 SLSHGFVSSALFLCIGVLYDRYHTRMVKYYSGLVHVMPISMVILLFFTMANIGLPGTSSF 393

Query: 393 IGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLK--DLSLR 450
           +GEFL+++ ++Q + TV  L + G++L   YSLWLY ++ +G  K + +   K  D+S  
Sbjct: 394 VGEFLILVGIYQTNTTVTFLGATGMILGGGYSLWLYNRIAYGNLKTQYLGMTKFSDISKN 453

Query: 451 ERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           E   V P+ + T+  GIYP    D   V ++ ++
Sbjct: 454 EFFAVLPLIMGTLVMGIYPEVFLDPMHVSVNHLL 487


>gi|89280740|ref|YP_514653.1| NADH dehydrogenase subunit 4 [Oryza sativa Indica Group]
 gi|194033233|ref|YP_002000570.1| NADH dehydrogenase subunit 4 [Oryza sativa Japonica Group]
 gi|23495394|dbj|BAC19875.1| NADH dehydrogenase subunit 4 [Oryza sativa Japonica Group]
 gi|74100107|gb|AAZ99271.1| NADH dehydrogenase subunit 4 [Oryza sativa Indica Group]
 gi|74100162|gb|AAZ99325.1| NADH dehydrogenase subunit 4 [Oryza sativa Japonica Group]
 gi|74100216|gb|AAZ99378.1| NADH dehydrogenase subunit 4 [Oryza sativa Japonica Group]
 gi|285026179|dbj|BAI68011.1| NADH dehydrogenase subunit 4 [Oryza sativa Indica Group]
          Length = 495

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/453 (47%), Positives = 300/453 (66%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTF 94
           + L +S I F++ L     FD   +  Q +E   W+ Y   + ++G+DG+S+  V+LTTF
Sbjct: 40  IGLCVSLITFLYPLVPRIQFDPSTAKSQFVESLRWLPYENIHLYMGIDGLSLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I     LD LLFY+  E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSFGKEYITAFLIREFLMIAVSCMLDPLLFYVLSESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++  +  T+ +  +   ++F    Q  +WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSVFMLLAILLILLQTGTTDL-QILLTTEFSERRQILLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  DL+ RE  
Sbjct: 399 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLYKFSDLNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFLPFLVGVVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|13449336|ref|NP_085518.1| NADH dehydrogenase subunit 4 [Arabidopsis thaliana]
 gi|6851022|emb|CAA69742.3| NADH dehydrogenase subunit 4 [Arabidopsis thaliana]
          Length = 495

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 223/484 (46%), Positives = 308/484 (63%), Gaps = 7/484 (1%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGR-RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           LS +   P LG   +LF   +   R R    + L  S I F++S      FD   +  Q 
Sbjct: 12  LSGLILCPVLGSITLLF---IPNSRIRPIRLIGLCASLITFLYSPVPRIQFDSSTAKSQF 68

Query: 65  IEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLES 123
           +E   W+ Y   +++LG+DGIS+  V+LTTFL P CI   W  ++   +EY+ AFL+ E 
Sbjct: 69  VESLRWLPYENINFYLGIDGISLFFVILTTFLIPICISVGWSGMRSYGKEYITAFLIREF 128

Query: 124 MVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAI 182
           ++I  F  LD+LLFY+F E+  IPMF+IIGVWG  +R I AAY+FFLYT  GS+FML AI
Sbjct: 129 LMIAVFRMLDLLLFYVFPESVPIPMFIIIGVWGSRQRKIKAAYQFFLYTLLGSLFMLLAI 188

Query: 183 VVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTA 242
           +++ ++  T+ +  +   ++F    Q ++WIA F SFA+K+PM P H WLP AHV+APTA
Sbjct: 189 LLILFQTGTTDL-QISLTTEFSERRQIFLWIASFASFAVKVPMVPVHIWLPEAHVEAPTA 247

Query: 243 GSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKL 302
           GSV LAGI LK G +G +RF +P+FP A+    P I+ LS IAIIY SL +  Q D+KK+
Sbjct: 248 GSVILAGIPLKFGTHGFLRFSIPMFPEATLCSTPFIYTLSAIAIIYTSLTTSRQIDLKKI 307

Query: 303 IAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAY 362
           IAYSS+AHM  VTIG+FS    G+ G++  MLSHGLV SALF CVGV+YDR  TR +  Y
Sbjct: 308 IAYSSVAHMNLVTIGMFSPNIQGIGGSILPMLSHGLVPSALFLCVGVLYDRHKTRLVRYY 367

Query: 363 GGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSAL 422
           GGLV  MP  + +   FT+ANM  PGTS FIGEFL+++  FQ ++ VA LA+ G++L A 
Sbjct: 368 GGLVSTMPNLSTIFFSFTLANMSSPGTSSFIGEFLILVGAFQRNSLVATLAALGMILGAA 427

Query: 423 YSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSS 482
           YSLWLY +VV G  K + + +  D + RE  +  P  V  V  G++P    D     +S+
Sbjct: 428 YSLWLYNRVVSGNLKPDFLHKFSDSNGREVSIFIPFLVGLVRMGVHPKVFPDCMHTSVSN 487

Query: 483 IIEN 486
           ++++
Sbjct: 488 LVQH 491


>gi|253807630|gb|ACT36208.1| NADH dehydrogenase subunit 4 [Helicosporidium sp. ex Simulium
           jonesi]
          Length = 490

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 231/478 (48%), Positives = 322/478 (67%), Gaps = 12/478 (2%)

Query: 6   LSIVTFLPFLGVFVIL-FSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQM 64
           L +    P LG+F+IL    + G   ++   +AL  + + F+ SLF+W  FD   + FQ+
Sbjct: 4   LELTLLFPILGIFLILTMPDWQGTKIKT---IALITTLLTFLTSLFLWLEFDSSTAFFQL 60

Query: 65  IEYYHWI--DYFC----SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
              Y+ +  +YF     +  LG+DGIS+  ++LTT LTP CIL SW +IQ   +EY IAF
Sbjct: 61  TSDYNSLLENYFSFSTLNLSLGIDGISLFFIILTTLLTPICILVSWDNIQNYVKEYCIAF 120

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIF 177
           LVLE  ++  F   D+LLFYIFFE+ LIPMF+IIGVWG  ER I AAY+FFLYT FGS+ 
Sbjct: 121 LVLEVFMLAVFSVTDLLLFYIFFESVLIPMFIIIGVWGSRERKIRAAYQFFLYTLFGSVL 180

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A++++ ++  +  +  LYA +++  S Q  +W+AFF SFA+K+PM P H WLP AHV
Sbjct: 181 MLLALLLIYFQTGSLDLEILYA-TEWSESRQILLWLAFFASFAVKVPMVPVHIWLPEAHV 239

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAGI+LK+G YG +RF LP+FP AS YF P+I+ +S+IAIIY S  ++ Q 
Sbjct: 240 EAPTAGSVILAGILLKLGTYGFLRFSLPMFPYASLYFTPLIYTMSIIAIIYTSCTTLRQI 299

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+KK+IAYSS+AHM +VT+GIFS    G+EG++  M+SHGL+S ALF CVGV+YDR  TR
Sbjct: 300 DLKKIIAYSSVAHMNFVTLGIFSQNIQGIEGSILLMISHGLISPALFLCVGVLYDRYKTR 359

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            +  Y G    MP +A+  + FTM+N+ LPGTS F GEFL++  V+ N+    +LA+ G+
Sbjct: 360 ILRYYSGCGRTMPIFALFFVFFTMSNISLPGTSSFPGEFLILTGVYLNNTIATILAATGM 419

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDT 475
           VL A Y+LWL  ++++GV K E +    DL+ RE  M  P+ +  ++ GI P    DT
Sbjct: 420 VLGAGYALWLCNRLIYGVFKPEFIYLYSDLNRREFMMFIPLIIPILWIGINPEAFIDT 477


>gi|268164062|ref|YP_003288827.1| NADH dehydrogenase subunit 4 [Saccharina angustata]
 gi|262318372|dbj|BAI48692.1| NADH dehydrogenase subunit 4 [Saccharina angustata]
          Length = 482

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 297/435 (68%), Gaps = 7/435 (1%)

Query: 37  ALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFL 95
           ALGI++  F+ SLF+W  FD     FQ +    W+     +  LGVDGIS+  V+LTT +
Sbjct: 32  ALGITSAVFVSSLFLWLGFDHSTPKFQFVVDSLWLPIANINLILGVDGISLFFVILTTLI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
            P C+L+SW   +   + Y+I+FL +E +++  F +LD+L FYIFFEA LIPMF++IG++
Sbjct: 92  FPLCLLASWSFDKGEVKTYLISFLGMELVLLLVFTNLDLLFFYIFFEAVLIPMFLVIGIY 151

Query: 156 GGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           G  ER I AAY FFLYT  GS+FML  IV + +    S+  ++ ++  F    Q W+W+A
Sbjct: 152 GSRERKIRAAYMFFLYTLLGSLFMLIGIVYI-YLFAGSTNYEVLSVINFSSYDQKWLWLA 210

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF SFA K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF L LFPLAS YF
Sbjct: 211 FFASFAAKVPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGSYGFLRFSLGLFPLASVYF 270

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
            P IF LSL+ ++Y SL ++ QTD+K+LIAY+S+AHM  V IG+F+G   GVE A+ Q L
Sbjct: 271 TPFIFSLSLLGVVYTSLTAIRQTDLKRLIAYTSVAHMNLVMIGLFTGTVIGVEAAILQSL 330

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG VSSALF  +GV+YDR H+R +  YGGL H MP + ++ + FTMAN+GLPGTS FIG
Sbjct: 331 SHGFVSSALFLIIGVLYDRWHSRVVKYYGGLTHTMPIFIIIFLFFTMANLGLPGTSSFIG 390

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           EFL+++S F+ ++T    A+  ++L   YSLWL+ ++ +G  K   +    DLS RE  +
Sbjct: 391 EFLLLVSAFEANSTACFFAATSMILGGGYSLWLFNRIAYGNIKMVGL----DLSFREFMI 446

Query: 455 VYPIAVLTVFFGIYP 469
             P+ + T+F GIYP
Sbjct: 447 FLPLVLGTLFMGIYP 461


>gi|253996961|ref|YP_003049025.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Methylotenera mobilis JLW8]
 gi|253983640|gb|ACT48498.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Methylotenera mobilis JLW8]
          Length = 499

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/482 (45%), Positives = 329/482 (68%), Gaps = 3/482 (0%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMI 65
           LS   +LP L   ++LF++       + + +AL  S  +F+ ++ +++ F+     FQ  
Sbjct: 10  LSFSIWLPVLAGVLVLFTANDSKPNLTRW-LALFGSVASFLVTIPLYTHFNFADGGFQFQ 68

Query: 66  EYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESM 124
           E + WI  F   YHLG DGI+I L++LT+F T   ++S+W+ I++   +YM +FL++  +
Sbjct: 69  ERFLWIMSFNIHYHLGADGIAIPLILLTSFTTVIVVISAWEVIEKRVAQYMASFLIMSGL 128

Query: 125 VIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVV 184
           +IG F +LD +L+Y+F+EA LIPMF++IG+WGG  R+YA  KFFLYT  GS+ ML A + 
Sbjct: 129 MIGVFSTLDAILYYVFWEAMLIPMFLVIGIWGGPNRVYATVKFFLYTLLGSLLMLVAFIY 188

Query: 185 MCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGS 244
           M  +  + +I D Y +   P ++Q  +++AFF +FA+KIPM+P HTWLP+AHV+APT GS
Sbjct: 189 MFHQTGSFAISDYYQL-PLPLNVQVLIFLAFFAAFAVKIPMWPVHTWLPDAHVEAPTGGS 247

Query: 245 VFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIA 304
           V LA I LK+GGY  +RF +P+ P A+ Y +  +  LSLIAI+Y +LV++VQ D+KKLIA
Sbjct: 248 VVLAAIALKLGGYSFLRFAMPIAPDAAHYLSGFMITLSLIAIVYIALVALVQKDMKKLIA 307

Query: 305 YSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGG 364
           YSSI+HMG+VT+G F     G+EGA+ QM+SHG +SSA+F CVGV+YDR+H+R I AYGG
Sbjct: 308 YSSISHMGFVTLGFFIFNNLGLEGAVVQMISHGFISSAMFLCVGVLYDRVHSRQIDAYGG 367

Query: 365 LVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYS 424
           + + MP +A   ++F MAN GLPGTSGF+GEF+VI+   Q +   A LASF ++  A Y+
Sbjct: 368 VANTMPAFAAFAVLFAMANSGLPGTSGFVGEFMVILGAIQVNFWYAFLASFTLIFGAAYT 427

Query: 425 LWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           LW+ ++V +G      VQ LKDL+ RE  ++  +A+L +  GIYP P+ D  +  ++ ++
Sbjct: 428 LWMVKRVFYGEVANANVQALKDLNKREFLILAILAILVLAVGIYPQPLTDMTNATVTQLL 487

Query: 485 EN 486
            +
Sbjct: 488 SH 489


>gi|74325174|ref|YP_316594.1| NADH dehydrogenase subunit 4 [Thalassiosira pseudonana]
 gi|74100240|gb|AAZ99401.1| NADH dehydrogenase subunit 4 [Thalassiosira pseudonana]
          Length = 498

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/474 (44%), Positives = 316/474 (66%), Gaps = 9/474 (1%)

Query: 16  GVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF- 74
           G F++LF         +   +AL  S   ++ SLF+W  F+K   SFQ +    WI +  
Sbjct: 23  GTFLLLFVP--SSNHSALKAIALNTSCFLYVISLFLWVFFNKSIGSFQFVSKLLWIPFLN 80

Query: 75  CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDM 134
            ++ LG+DGIS+  ++LTT L   CIL SW S++ N +E++IAFLV+E  +IG F  LD+
Sbjct: 81  LNFSLGIDGISLFFILLTTLLIFLCILISWNSVKTNIKEFLIAFLVMEFFLIGVFSILDL 140

Query: 135 LLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSS 193
           LLFYI+FE+ LIPM++I+G+WG  ER I AAY FFLYT  GS+ ML +I+ + ++  T+ 
Sbjct: 141 LLFYIYFESVLIPMYLIVGIWGSRERKIRAAYFFFLYTLLGSVLMLLSILYIYYQVGTT- 199

Query: 194 IIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIM 251
             D   +  F FS   Q ++W++FF SFA K+PM P H WLP AHV+APTAGSV LAG++
Sbjct: 200 --DYEVLLTFIFSKTEQKFLWLSFFGSFATKVPMVPVHLWLPEAHVEAPTAGSVILAGVL 257

Query: 252 LKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHM 311
           LK+G YG +RF  PLFP AS YFAP+++ LS++ I+Y S  ++ QTD K++IAY+S+AHM
Sbjct: 258 LKLGTYGFLRFSFPLFPEASFYFAPIVYLLSVVGIVYTSFTAIRQTDFKRIIAYTSVAHM 317

Query: 312 GYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPR 371
             V +G+FS    G+EGA+ Q LSHG V+SALF  +GV+Y+R HTR +  YGGLVH MP 
Sbjct: 318 NLVMVGLFSFNTIGLEGAILQSLSHGFVASALFLIIGVVYERHHTRMVKYYGGLVHVMPL 377

Query: 372 YAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKV 431
           Y  + + FTM+N+GLPGT  F+GEFL+++  F+ + +   +++ G+++   YSLWL+ ++
Sbjct: 378 YTFIFLFFTMSNIGLPGTGSFVGEFLILVGSFKTNTSATFISATGMIIGGCYSLWLFNRI 437

Query: 432 VFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIE 485
            +G  K + ++   D++ RE  +  P+   T+  G+YP    ++  + ++ ++E
Sbjct: 438 SYGNLKTQYLKDYIDINKREFFIFLPLIFGTIAIGLYPEIFLNSMHMSVNMLVE 491


>gi|222110098|ref|YP_002552362.1| proton-translocating NADH-quinone oxidoreductase subunit m
           [Acidovorax ebreus TPSY]
 gi|221729542|gb|ACM32362.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Acidovorax ebreus TPSY]
          Length = 491

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 301/435 (69%), Gaps = 5/435 (1%)

Query: 55  FDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFRE 113
           FD G ++ Q +E   WI+ F   YHLGVDGI+   V LT F+T   +++SW+SI E   +
Sbjct: 52  FDNGSAAAQFVEKSMWIERFNVYYHLGVDGIAFWFVPLTAFITVIVVIASWESITERVNQ 111

Query: 114 YMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFF 173
           YM AFL+L  +++G F ++D +LFY+FFEA+LIPM++IIG+WGG  +IYAA+KFFLYT  
Sbjct: 112 YMGAFLILSGLMVGVFSAMDGMLFYVFFEATLIPMYLIIGIWGGPNKIYAAFKFFLYTLL 171

Query: 174 GSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTW 231
           GS+  L A + +    ++    D+    K P S   Q  ++ AFF +FA+K+PM+P HTW
Sbjct: 172 GSLLTLIAFIYLY--NQSGGSFDIATWHKLPLSATAQTLLFFAFFAAFAVKVPMWPVHTW 229

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+ HV+APT GS  LA IMLK+G YG +RF LP+ P AS+ +A ++  LSL+A+IY  L
Sbjct: 230 LPDVHVEAPTGGSAVLAAIMLKLGAYGFLRFSLPIAPDASREWAWLMITLSLVAVIYVGL 289

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V+MVQ D+KKL+AYSS+AHMG+VT+G F     GV G + QM++HG VS A+F C+GV+Y
Sbjct: 290 VAMVQKDMKKLVAYSSVAHMGFVTLGFFVFNDMGVSGGLVQMIAHGFVSGAMFLCIGVLY 349

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+H+R+I +YGG+V+ MP++A   ++FTMAN GLP T+GF+GE++VI++  +    V +
Sbjct: 350 DRVHSREIASYGGVVNTMPKFAAFALLFTMANCGLPATAGFVGEWMVIIAAVKFDFWVGL 409

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
            A+  ++L A YSLW+Y++V  G    + V+ L D+  RE  ++  +A+  ++ G+YP P
Sbjct: 410 GAALALILGASYSLWMYKRVYLGPVTNDNVRGLTDIGGREFLVLGLLAIAVLYMGVYPKP 469

Query: 472 IRDTFSVPLSSIIEN 486
             D   V ++ ++++
Sbjct: 470 FTDVMDVSVAELLKH 484


>gi|300122798|emb|CBK23813.2| unnamed protein product [Blastocystis hominis]
          Length = 487

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/447 (46%), Positives = 309/447 (69%), Gaps = 3/447 (0%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFC 99
           ++I F  SL +  +FDK    FQ +   +W+ +F  ++ +G+DGIS+  ++LTTFL P C
Sbjct: 38  TSITFFISLGLLFLFDKSTIFFQGLYEINWLSFFNLNFIIGIDGISLFFILLTTFLFPIC 97

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           ILSS+  I+ NF+ + I FL++ES+++  F  LD++ FY+FFE+ LIPM++I+G++G  E
Sbjct: 98  ILSSYNYIKFNFKFFYINFLIMESILLLVFSCLDIVFFYVFFESVLIPMYLILGLFGSRE 157

Query: 160 R-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCS 218
           R I A+Y FF+YTF GS+ ML AI+ + +   TS+ I L   +  PF IQ  +WIAFF S
Sbjct: 158 RKILASYMFFIYTFVGSVLMLLAILFIYYYAGTSNYIVLLTYNFEPF-IQKILWIAFFVS 216

Query: 219 FAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVI 278
           FA+K+PM PF+ WLP AHV+APT GSV LAGI+LK+G YG +RF LPLF  A+ Y+ P +
Sbjct: 217 FAVKVPMVPFYIWLPEAHVEAPTPGSVILAGILLKLGTYGFLRFSLPLFTFANFYYTPFV 276

Query: 279 FFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGL 338
           + L+++ +IY+SLV++ QTD+K+++AY+SIAHM  + IG+++    G+EG++ QM SHGL
Sbjct: 277 YTLAVVGLIYSSLVAVRQTDLKRIVAYASIAHMNLIMIGLYTNKIYGLEGSLLQMFSHGL 336

Query: 339 VSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLV 398
           VS ALF  VG++Y+R HTR I  Y GLV  MP +AV+ ++FT+AN+ LP TS F+GEFL+
Sbjct: 337 VSGALFLAVGILYERYHTRLIKYYSGLVQTMPIFAVIFLMFTLANIALPTTSSFVGEFLI 396

Query: 399 IMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPI 458
            + +F  + T+AV A   ++  ++YSLWLY +V +G  +   +   +DL+ RE  M   I
Sbjct: 397 FLGIFNTNTTIAVFAILSMMFGSIYSLWLYNRVCYGNIQVNFIGLYQDLNKREFVMFLLI 456

Query: 459 AVLTVFFGIYPVPIRDTFSVPLSSIIE 485
            VL    GIYP  I D  ++ +S ++ 
Sbjct: 457 LVLVFIIGIYPTFILDYLNMSVSFLLN 483


>gi|200004056|ref|YP_002221390.1| NADH dehydrogenase subunit 4 [Blastocystis sp. NandII]
 gi|198385478|gb|ACH86071.1| NADH dehydrogenase subunit 4 [Blastocystis sp. NandII]
          Length = 487

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/447 (46%), Positives = 308/447 (68%), Gaps = 3/447 (0%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFC 99
           ++I F  S+F+   FDK    FQ +    W+ +F  ++ +G+DGIS+  ++LTTFL P C
Sbjct: 38  TSITFFISVFLLFGFDKSTIYFQGLHEISWLSFFNINFIIGIDGISLFFILLTTFLFPIC 97

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           ILSS+  I+ NF+ + I FL++ES+++  F  LD++ FY+FFE+ LIPM++I+G +G  E
Sbjct: 98  ILSSFNYIKFNFKFFYINFLIMESILLLVFSCLDIVFFYVFFESVLIPMYLILGFFGSRE 157

Query: 160 R-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCS 218
           R I A+Y FF+YTF GS+ ML AI+ + +   TS+ I L   +  PF +Q  +WIAFF S
Sbjct: 158 RKILASYMFFIYTFVGSVLMLLAILFIYFYVGTSNYIVLLTCNFDPF-LQKILWIAFFVS 216

Query: 219 FAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVI 278
           FA+K+PM PF+ WLP AHV+APT GSV LAGI+LK+G YG +RF LPLF  A+ Y+ P I
Sbjct: 217 FAVKVPMIPFYIWLPEAHVEAPTPGSVILAGILLKLGTYGFLRFSLPLFTFANFYYTPFI 276

Query: 279 FFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGL 338
           + LS++ +IY+SLV++ QTD+K+++AY+SIAHM  + IG+++    G+EG++ QM SHGL
Sbjct: 277 YTLSILGLIYSSLVAIRQTDLKRIVAYASIAHMNLIMIGLYTNKIYGIEGSLLQMFSHGL 336

Query: 339 VSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLV 398
           VS ALF  VGV+Y+R HTR I  Y GLV  MP +AV+ ++FT+AN+ LP TS F+GEFL+
Sbjct: 337 VSGALFLIVGVLYERYHTRLIKYYSGLVQTMPLFAVIFLLFTLANIALPTTSSFVGEFLI 396

Query: 399 IMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPI 458
            + +F  ++T+AV A   ++  ++YSLWLY +V +G  +   +   +DL+ RE  M   I
Sbjct: 397 FLGIFNTNSTIAVFAILSMMFGSIYSLWLYNRVCYGNIQINFISLYQDLNKREFVMFCLI 456

Query: 459 AVLTVFFGIYPVPIRDTFSVPLSSIIE 485
            VL    GIYP  + D  ++ +S ++ 
Sbjct: 457 LVLVFLIGIYPTFLLDYLNMSVSFLLN 483


>gi|300311107|ref|YP_003775199.1| transmembrane NADH dehydrogenase I subunit M [Herbaspirillum
           seropedicae SmR1]
 gi|300073892|gb|ADJ63291.1| transmembrane NADH dehydrogenase I (chain M) oxidoreductase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 496

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 219/488 (44%), Positives = 319/488 (65%), Gaps = 10/488 (2%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGI----STINFIFSLFVWSVFDKGR 59
           P LS+  ++P   VF IL    L  GR S  G+A  +    S +  + +  +   FD   
Sbjct: 7   PILSLAIWVPI--VFGILV---LALGRDSNPGLARWLALFGSLVGLVVTFPLIQHFDPLA 61

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
             +Q +E   WID F  SY LG+DGIS+  V LT F+T   +L+ W  IQ+   +YM AF
Sbjct: 62  HGYQFVEKTPWIDRFNISYFLGLDGISLWFVPLTAFITVIVVLAGWVVIQKRVAQYMGAF 121

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  +++G F +LD +LFY FFEA+LIPMF+I+GVWGG  R+YAA+K FLYT  GS+ M
Sbjct: 122 LILSGIMVGVFSALDAMLFYAFFEATLIPMFIIVGVWGGDNRVYAAFKLFLYTLLGSLLM 181

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L A++ + +    S  I  +         Q  ++ AF  +FA+K+PM+P HTWLP+AHVQ
Sbjct: 182 LIALIYLYYVSGGSFEIPTWHQVPLSMLEQKILFFAFLAAFAVKVPMWPVHTWLPDAHVQ 241

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APT GS+ LA IMLK+G YG +RF LP+ P AS   +  + FLSL+A+IY  LV++VQ D
Sbjct: 242 APTGGSIVLAAIMLKLGAYGFLRFSLPILPDASHALSGFMIFLSLVAVIYIGLVALVQQD 301

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKL+AYSSIAHMG+VT+G F      V+G + QM+SHG VS A+F C+GV+YD++HTR+
Sbjct: 302 MKKLVAYSSIAHMGFVTLGFFMFNDMAVQGGIVQMISHGFVSGAMFMCIGVLYDQMHTRE 361

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           I  YGG+V+ MPR+A   ++F++AN GLP TSGF+GEF+VI+   + +  + +LA+  ++
Sbjct: 362 ISQYGGVVNKMPRFAFFFILFSLANCGLPATSGFVGEFMVILGAVKFNFWIGLLAATALI 421

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSV 478
           L A YSLWL ++V+FG      V +L DL+ RE  ++  +A+ T+  G+YP  I D+   
Sbjct: 422 LGAAYSLWLAKRVIFGAVTNHHVAELVDLNGREFLILGLLAIATLVMGVYPGIITDSIQT 481

Query: 479 PLSSIIEN 486
            ++ ++++
Sbjct: 482 SVTDLLKH 489


>gi|115278544|ref|YP_762351.1| NADH dehydrogenase subunit 4 [Sorghum bicolor]
 gi|114309665|gb|ABI60882.1| NADH dehydrogenase subunit 4 [Sorghum bicolor]
          Length = 495

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 300/453 (66%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTF 94
           + L +S I F++       FD   ++ Q +E   W+ Y   + ++G+DG+S+  V+LTTF
Sbjct: 40  IGLCVSLITFLYPPVPRIQFDPSTANSQFVESLRWLPYENIHLYMGIDGLSLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I     LD LLFY+  E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSFGKEYITAFLIREFLMIAVSCMLDPLLFYVLSESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++  +  T+ +  +   ++F    Q  +WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSVFMLLAILLILLQTGTTDL-QILLTTEFSERRQILLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  DL+ RE  
Sbjct: 399 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLYKFSDLNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFLPFLVGVVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|258593425|emb|CBE69764.1| NADH-quinone oxidoreductase chain M (NADH dehydrogenase I, chain M)
           (NDH-1, chain M) [NC10 bacterium 'Dutch sediment']
          Length = 539

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 221/475 (46%), Positives = 323/475 (68%), Gaps = 8/475 (1%)

Query: 4   PFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQ 63
           P LSI+  LP  G   +L +   G        +A+ IS +N + SL V+  FD   +  Q
Sbjct: 7   PILSILIALPLCGA--LLLACVDGMREALIKRLAVAISGLNLLLSLIVYVRFDPAEAGMQ 64

Query: 64  MIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
            +E   WID    SY LGVDGIS+ L++LTTFLTP  IL+S+  I    + YMI  L+L+
Sbjct: 65  FVERAPWIDSIGSSYFLGVDGISLPLLLLTTFLTPIAILASFSGITNRVKAYMICVLLLQ 124

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAI 182
           + +IG F++LD++LFY+F+E  LIPM+ +IGVWGG  R+YA  KF LYT  GS+ ML A+
Sbjct: 125 TGMIGVFVALDLVLFYVFWEGMLIPMYFLIGVWGGHRRVYATVKFVLYTMAGSVLMLLAM 184

Query: 183 VVMCWEKKTSS---IIDLYAM--SKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           + + +  + S+     DL  +     P+  Q  ++ AF  +FAIK+PMFPFHTWLP+AHV
Sbjct: 185 IALAFLHRESTGRLSFDLLELIGGPIPYGTQLLLFAAFALAFAIKVPMFPFHTWLPDAHV 244

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +APTAGSV LAG++LKMG YG +RF LPLFP A+  F P+I  L++I I+Y +LV+MVQ 
Sbjct: 245 EAPTAGSVLLAGVLLKMGTYGFLRFALPLFPEAAIAFTPLISALAVIGILYGALVAMVQD 304

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           D+K+L+AYSS++H+G+V +GIF+     VEG++ QM++HGL + ALF  VG+IY+R HTR
Sbjct: 305 DLKRLVAYSSVSHLGFVMLGIFAMNVQSVEGSILQMVNHGLSTGALFLLVGMIYERRHTR 364

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            I  +GGL   +PR+A+  +V TM+++GLPG +GF+GEFL++   F+     AVLA+ G+
Sbjct: 365 MIEEFGGLSRVLPRFALCFLVVTMSSIGLPGLNGFVGEFLILAGTFRVHKGFAVLATLGI 424

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPI 472
           +L+A+Y LW++++V++G S+  +   L D+S RE  M+ PI +L V+ G+ P P+
Sbjct: 425 ILAAVYMLWMWQRVMWGQSRRAENLTLDDISGREMAMLIPIILLIVWIGLNPNPL 479


>gi|220904921|ref|YP_002480233.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219869220|gb|ACL49555.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 495

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 220/473 (46%), Positives = 317/473 (67%), Gaps = 10/473 (2%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGV-ALGISTINFIFSLFVWSVFDKGR 59
           M++P LS++ F+P LG   ++    L  GR     + AL +  +    SL+  S FDKG 
Sbjct: 1   MSVPVLSLLIFVPVLGGLSLML---LPRGREETIRLGALTVCAVELALSLWALSQFDKGL 57

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
              QM+E   WI+     Y LG+DGIS+L + LT  +T   ++ S+KSI    +E+ ++ 
Sbjct: 58  WQMQMVENRPWIESLNIRYSLGIDGISVLFLPLTALITLMGVVVSFKSITLKVKEFFVSL 117

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+LE  +IG F +LD++LFY+F+EA LIPMF++IGVWGG  RIYA  KFFLYT  GS+ M
Sbjct: 118 LLLEGAMIGVFCALDLMLFYVFWEAMLIPMFLLIGVWGGPRRIYATVKFFLYTLLGSLLM 177

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           L  I+++    K  +  D+ A++   +S  +Q  ++ AFF +FA+K+PM+P HTWLP+AH
Sbjct: 178 LVGIILLY--LKGGNTFDMLALAGQNYSKDLQLLLFWAFFAAFAVKVPMWPVHTWLPDAH 235

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
            +APTAGSV LAG+++KMG YG +R  LP+ P A+      +  LS+IAI+Y +LV + Q
Sbjct: 236 TEAPTAGSVILAGVLIKMGAYGFLRISLPILPYAAWTLLTPMLILSVIAIVYGALVCLAQ 295

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
           TDIK+LIAYSS++HMG+VT+G+F+  + GVEG++ QML+HG+V+ ALF  VG+IYDR HT
Sbjct: 296 TDIKRLIAYSSVSHMGFVTLGLFALTQKGVEGSIIQMLNHGIVTGALFLAVGMIYDRTHT 355

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R I  YGGL   MP  A   +VFT+A +GLPGT+GFIGEFL+++  F+ +   AV+AS G
Sbjct: 356 RQIRDYGGLATTMPVMAGFFLVFTLAAIGLPGTNGFIGEFLILLGGFERAPWAAVVASSG 415

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           ++L A Y LWLY++V F     + V+ L  L  RE  ++  +AVL +  GI+P
Sbjct: 416 LILGAWYMLWLYQRVFFK-QVSDTVRGLPGLDGRELSIMLTMAVLVLAIGIFP 467


>gi|320160251|ref|YP_004173475.1| NADH-quinone oxidoreductase subunit M [Anaerolinea thermophila
           UNI-1]
 gi|319994104|dbj|BAJ62875.1| NADH-quinone oxidoreductase chain M [Anaerolinea thermophila UNI-1]
          Length = 499

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/441 (44%), Positives = 301/441 (68%), Gaps = 7/441 (1%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMI---EYYHWIDYFCSYHLGVDGISILLVVLT 92
           VAL  S + F  SL+  + F  G    Q++    ++   +   ++ +GVDG+ +L+++LT
Sbjct: 33  VALITSLVTFALSLWALAQFRMGEGGLQLVFDQPWFRLAESQVTFAMGVDGLGMLMILLT 92

Query: 93  TFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVII 152
           TFLTP  +LS+W ++QE  + +MI FL+LE+ ++G F + D++LFYIF+E +LIPM+ +I
Sbjct: 93  TFLTPLALLSTWSAVQERVKGFMIFFLLLETGMLGVFTAQDLVLFYIFWEFTLIPMYFLI 152

Query: 153 GVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMW 212
           G+WGG  RIYAA KFFL+T FGS+ ML AI+ +     T S+ DL    +     Q W+W
Sbjct: 153 GIWGGERRIYAAVKFFLFTMFGSVLMLLAILYLGLTAGTFSLSDLVLARQVFAGAQVWLW 212

Query: 213 IAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQ 272
           +AF  +FAIK+PM+P HTWLP+AHV+APTAGSV LAG++LKMG YG +RF LPLFP A+ 
Sbjct: 213 LAFALAFAIKVPMWPLHTWLPDAHVEAPTAGSVILAGVLLKMGSYGFLRFNLPLFPEATL 272

Query: 273 YFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQ 332
             AP +  L++I I+Y ++VS  QTD+KKL+AYSS++H+G+V +GIF+    G+ G++ Q
Sbjct: 273 QLAPYMAVLAVIGILYGAVVSFAQTDVKKLVAYSSVSHLGFVMLGIFALTAQGLAGSILQ 332

Query: 333 MLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGF 392
           M++HGL + ALF  VG++Y+R HTR + AYGG+   +P    VM+  ++++ GLP  +GF
Sbjct: 333 MVNHGLSTGALFLLVGMLYERRHTRQMSAYGGIWKVVPVLGAVMLFISLSSAGLPALNGF 392

Query: 393 IGEFLVIMSVFQNSNT----VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLS 448
           +GEF +++  F +S       A L + GV+L+A+Y L ++ +V  G  K  + Q LKD++
Sbjct: 393 VGEFTILLGSFSSSTLGSPWFAGLGALGVILAAVYLLVMFERVFLGPVKHAENQSLKDMN 452

Query: 449 LRERCMVYPIAVLTVFFGIYP 469
           LRE   + PI ++ ++ G+YP
Sbjct: 453 LREVLTLLPIMIVILWIGLYP 473


>gi|94502713|ref|YP_588294.1| NADH dehydrogenase subunit 4 [Zea mays subsp. mays]
 gi|114151576|ref|YP_740373.1| NADH dehydrogenase subunit 4 [Zea perennis]
 gi|114151608|ref|YP_740452.1| NADH dehydrogenase subunit 4 [Zea luxurians]
 gi|114151642|ref|YP_740400.1| NADH dehydrogenase subunit 4 [Zea mays subsp. parviglumis]
 gi|115278614|ref|YP_762511.1| NADH dehydrogenase subunit 4 [Tripsacum dactyloides]
 gi|40795152|gb|AAR91196.1| NADH dehydrogenase subunit 4 [Zea mays]
 gi|93116050|gb|ABE98683.1| NADH dehydrogenase subunit 4 [Zea mays subsp. mays]
 gi|93116094|gb|ABE98726.1| NADH dehydrogenase subunit 4 [Zea mays subsp. mays]
 gi|93116141|gb|ABE98772.1| NADH dehydrogenase subunit 4 [Zea mays subsp. mays]
 gi|102567910|gb|ABF70827.1| NADH dehydrogenase subunit 4 [Zea perennis]
 gi|102567975|gb|ABF70859.1| NADH dehydrogenase subunit 4 [Zea mays subsp. parviglumis]
 gi|102579643|gb|ABF70923.1| NADH dehydrogenase subunit 4 [Zea mays subsp. mays]
 gi|110287604|gb|ABG65650.1| NADH dehydrogenase subunit 4 [Zea luxurians]
 gi|114432105|gb|ABI74654.1| NADH dehydrogenase subunit 4 [Tripsacum dactyloides]
          Length = 495

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 300/453 (66%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTF 94
           + L +S I F++       FD   ++ Q +E   W+ Y   + ++G+DG+S+  V+LTTF
Sbjct: 40  IGLCVSLITFLYPPVPRIQFDPSTANSQFVESLRWLPYENIHLYMGIDGLSLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I     LD LLFY+  E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSFGKEYITAFLIREFLMIAVSCMLDPLLFYVLSESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++  +  T+ +  +   ++F    Q  +WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSVFMLLAILLILLQTGTTDL-QILLTTEFSERRQILLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIPGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  DL+ RE  
Sbjct: 399 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLYKFSDLNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFLPFLVGVVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|81176524|ref|YP_398409.1| nad4 [Triticum aestivum]
 gi|78675248|dbj|BAE47673.1| nad4 [Triticum aestivum]
 gi|164422219|gb|ABY55192.1| NADH dehydrogenase subunit 4 [Bambusa oldhamii]
 gi|169649060|gb|ACA62621.1| nad4 [Triticum aestivum]
 gi|291498610|gb|ADE08084.1| nad4-1 [Triticum aestivum]
 gi|291498611|gb|ADE08085.1| nad4-2 [Triticum aestivum]
 gi|291498612|gb|ADE08086.1| nad4-3 [Triticum aestivum]
          Length = 495

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 299/453 (66%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTF 94
           + L +S I F++       FD   +  Q +E   W+ Y   + ++G+DG+S+  V+LTTF
Sbjct: 40  IGLCVSLITFLYPPVPRIQFDPSTAKSQFVESLRWLPYENIHLYMGIDGLSLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I     LD LLFY+  E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSFGKEYITAFLIREFLMIAVSCMLDPLLFYVLSESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++  +  T+ +  +   ++F    Q  +WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSVFMLLAILLILLQTGTTDL-QILLTTEFSERRQILLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  DL+ RE  
Sbjct: 399 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLYKFSDLNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFLPFLVGVVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|116624765|ref|YP_826921.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Candidatus Solibacter usitatus Ellin6076]
 gi|116227927|gb|ABJ86636.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 526

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 216/505 (42%), Positives = 317/505 (62%), Gaps = 20/505 (3%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+   L+I+ F P  G+ V+LF    G  +      A  ++   F+ SL + S F  GR 
Sbjct: 1   MDQHLLTIILFTPLAGLAVLLFIP--GKSKDLIRVWANLVAFAGFLISLPLASRFQAGRP 58

Query: 61  SFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
            +Q  E   WI    ++ H+GVDGIS+L+++LTT +    +L SW +IQ+  +EY   F+
Sbjct: 59  GYQFEESSDWIPAIGAHFHIGVDGISMLMIMLTTVMGFIAVLCSWNAIQDRVKEYYAMFM 118

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           +L++ +IG FLSLD  LFY+F+E  L+PM+ IIGVWGG  ++YAA KFFLYT  GS+ ML
Sbjct: 119 LLQAGMIGVFLSLDFFLFYVFWELVLVPMYFIIGVWGGPRKLYAAIKFFLYTLAGSVLML 178

Query: 180 FAIVVMCWEK---------KTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHT 230
             I+ + ++          + S+++ L      P   Q W++ AFF  FAIK+PMFPFHT
Sbjct: 179 LGILTLYFQHFHQFGFYSFEISNLMKL----NLPIGTQEWVFWAFFIGFAIKVPMFPFHT 234

Query: 231 WLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLAS--QYFAPVIFFLSLIAIIY 288
           WLP+AHV+APTAGSV LA ++LKMG YG +RF LPL P AS  +    ++  LSLI IIY
Sbjct: 235 WLPDAHVEAPTAGSVILAAVLLKMGTYGFLRFSLPLLPEASSDRTIVQILATLSLIGIIY 294

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
            +LVS++Q D KKLIAYSS++H+G+ T+GIFS   +G+ G++ Q ++HG+ +  LF  +G
Sbjct: 295 GALVSLMQADWKKLIAYSSVSHLGFCTLGIFSLNPNGIAGSVLQQINHGISTGMLFMVIG 354

Query: 349 VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNT 408
           VIY+R HTR+I  YGGL H MP++A++  +  +++ GLP  +GF+GEF ++   F+ S  
Sbjct: 355 VIYERRHTREIKEYGGLAHVMPKFAIIFAIAMLSSAGLPLLNGFVGEFTIMQGAFEASWV 414

Query: 409 VAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIY 468
            A  A  GV+L A Y LWLY++ + G     K   + D+S RE  M  P+    ++ GIY
Sbjct: 415 WAAFAVTGVILGAAYLLWLYQRTMLGQVTNGKNLTIPDMSAREVAMFVPLIAWAIWIGIY 474

Query: 469 PVPIRDTFSVPLSSIIENYTLKTGY 493
           P P  D    P++ I++   ++ GY
Sbjct: 475 PKPYFDILRQPVTEIVQR--VRPGY 497


>gi|115304392|ref|YP_762696.1| NADH:ubiquinone oxidoreductase subunit 4 [Ustilago maydis]
 gi|121919093|sp|Q0H8X6|NU4M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
 gi|72256222|gb|AAZ67012.1| NADH:ubiquinone oxidoreductase subunit 4 [Ustilago maydis]
          Length = 484

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/484 (42%), Positives = 317/484 (65%), Gaps = 10/484 (2%)

Query: 6   LSIVTFLPFLGVFVILFSSYLGCGRRS---FFGVALGISTINFIFSLFVWSVFDKGRSSF 62
           L+++  +P +G   ++ +   G  R+S      +ALG S INF+ S+ +W  FD   S +
Sbjct: 2   LTLLLIIPLVGA--LMLAPMQGNTRQSESQMKRLALGTSLINFVLSIVLWGEFDSSTSEY 59

Query: 63  QMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLE 122
           Q  + ++ ++ FC  H+GVDGIS+  V+LTTF+TP CILS+W +I+E  + +++ FLVLE
Sbjct: 60  QFTQEFNQVN-FCHLHIGVDGISLYFVLLTTFITPICILSNWDNIKEQLKYFLMCFLVLE 118

Query: 123 SMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGS-ERIYAAYKFFLYTFFGSIFMLFA 181
           +++I  F+ LD+LLFY+FFE+ LIP+F+I+G+WGGS  R+ AA+  FLYT FGS+FML A
Sbjct: 119 TLLIAVFVVLDILLFYVFFESVLIPLFLIVGIWGGSATRVRAAFLLFLYTLFGSLFMLLA 178

Query: 182 IVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPT 241
            +V+ +   ++    + ++S+     Q  +W+A F S AIK P+ PFH WLP AH +AP 
Sbjct: 179 FLVIYYNVGSTDF-QVVSLSEINLESQKLLWLAVFISMAIKTPLLPFHVWLPRAHAEAPL 237

Query: 242 AGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKK 301
           AGSV LAG++LK+  YG +R L+   P A+ YF+P++  +++I +IYASL ++ QTD K 
Sbjct: 238 AGSVILAGLILKLATYGYMRILIQFLPDATSYFSPLVQTIAVITLIYASLATLRQTDFKA 297

Query: 302 LIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCV-GVIYDRLHTRDIF 360
           L+AYSSI HM  V +G+FS    G++GA+   ++HG+VS ALF  V GV+YDR HTR I 
Sbjct: 298 LVAYSSIGHMAVVVLGLFSNTIQGIDGALLLSIAHGVVSPALFILVGGVLYDRYHTRTIR 357

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
            Y G+   MP ++++  VFT+ N  +P ++ + GEFL +   FQ +   AVL S G+VLS
Sbjct: 358 YYRGMTAYMPLFSIMFFVFTIFNAAVPLSANWAGEFLCLAGAFQRNPVFAVLGSTGIVLS 417

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           A YS+WLY ++ FG +  + +    DL+ RE  ++ P+  + V FGI+P  I D+     
Sbjct: 418 AAYSIWLYNRIAFG-AWSKYLNYTTDLTRREFMLLLPLLFVAVVFGIFPNIILDSIHAST 476

Query: 481 SSII 484
           S +I
Sbjct: 477 SGLI 480


>gi|153799794|gb|ABS50628.1| NADH dehydrogenase subunit 4 [Arabidopsis thaliana]
 gi|153799798|gb|ABS50630.1| NADH dehydrogenase subunit 4 [Arabidopsis thaliana]
          Length = 447

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/436 (48%), Positives = 288/436 (66%), Gaps = 3/436 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTF 94
           + L  S I F++S      FD   +  Q +E   W+ Y   +++LG+DGIS+  V+LTTF
Sbjct: 8   IGLCASLITFLYSPVPRIQFDSSTAKSQFVESLRWLPYENINFYLGIDGISLFFVILTTF 67

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I  F  LD+LLFY+F E+  IPMF+IIGV
Sbjct: 68  LIPICISVGWSGMRSYGKEYITAFLIREFLMIAVFRMLDLLLFYVFPESVPIPMFIIIGV 127

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++ ++  T+ +  +   ++F    Q ++WI
Sbjct: 128 WGSRQRKIKAAYQFFLYTLLGSLFMLLAILLILFQTGTTDL-QISLTTEFSERRQIFLWI 186

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           A F SFA+K+PM P H WLP AHV+APTAGSV LAGI LK G +G +RF +P+FP A+  
Sbjct: 187 ASFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGIPLKFGTHGFLRFSIPMFPEATLC 246

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
             P I+ LS IAIIY SL +  Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 247 STPFIYTLSAIAIIYTSLTTSRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILPM 306

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLV SALF CVGV+YDR  TR +  YGGLV  MP  + +   FT+ANM  PGTS FI
Sbjct: 307 LSHGLVPSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNLSTIFFSFTLANMSSPGTSSFI 366

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  D + RE  
Sbjct: 367 GEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLHKFSDSNGREVS 426

Query: 454 MVYPIAVLTVFFGIYP 469
           +  P  V  V  G++P
Sbjct: 427 IFIPFLVGVVRMGVHP 442


>gi|1709382|sp|Q04050|NU4M_BRACM RecName: Full=NADH-ubiquinone oxidoreductase chain 4; AltName:
           Full=NADH dehydrogenase subunit 4
 gi|12770|emb|CAA43207.1| NADH dehydrogenase subunit 4 [Brassica rapa]
 gi|738524|prf||2001250A NADH dehydrogenase:SUBUNIT=4
          Length = 495

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/453 (47%), Positives = 295/453 (65%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTF 94
           + L  S I F++S      FD   +  Q +E   W+ Y   +++LG+DGIS+  V+LTTF
Sbjct: 40  IGLCASLITFLYSPVPRIQFDSSTAKSQFVESLRWLPYENINFYLGIDGISLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I  F  LD+LLFY+F E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSYGKEYITAFLIREFLMIAVFRMLDLLLFYVFPESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++ ++  T+ +  +   ++F    Q ++WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSLFMLLAILLILFQTGTTDL-QISLTTEFSERRQIFLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           A F SFA+K+PM P H WLP AHV+APTAGSV LAGI LK G +G +RF +P+FP A+  
Sbjct: 219 ASFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGIPLKFGTHGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
             P I+ LS IAIIY SL +  Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 STPFIYTLSAIAIIYTSLTTSRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILPM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLV SALF CVGV+YDR  TR +  YGGLV  MP  + +   FT+ANM  PGTS FI
Sbjct: 339 LSHGLVPSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNLSTIFFSFTLANMSSPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEF +++  FQ ++ VA LA+ G++L A YSLWLY +VV G  K + + +  D + RE  
Sbjct: 399 GEFPILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLHKFSDSNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFIPFLVGLVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|171463538|ref|YP_001797651.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193076|gb|ACB44037.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 488

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/435 (45%), Positives = 294/435 (67%), Gaps = 2/435 (0%)

Query: 41  STINFIFSLFVWSVFDKGRSSFQMIEYYHWI-DYFCSYHLGVDGISILLVVLTTFLTPFC 99
           + + FI +L +   FD      Q +E   WI  Y  +Y+LG+DGIS+  +VLT F+    
Sbjct: 37  AVLGFIAALPLILQFDIANPGMQFVEKISWIPRYDINYYLGIDGISVWFIVLTAFINIIV 96

Query: 100 ILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSE 159
           ++++W+ I+    +YM +F++L  ++IG F +LD LLFY+FFEA+LIPM++IIGVWGG  
Sbjct: 97  VIAAWEVIETKVSQYMASFMILSGLMIGVFCALDALLFYVFFEATLIPMYIIIGVWGGHN 156

Query: 160 RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSF 219
           RIYAA+KFFLYT  GS+  L A++ +     T  I+ ++  ++     Q  ++ AFF +F
Sbjct: 157 RIYAAFKFFLYTLLGSLLTLIAMLYLYNVTNTFDIL-VWQNTRLDIVEQILLFAAFFMAF 215

Query: 220 AIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIF 279
           A+K+PM+P HTWLP+ HV+APT GSV LA IMLK+G YG +RF LP+ P ASQY  P + 
Sbjct: 216 AVKVPMWPLHTWLPDVHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASQYLGPFVI 275

Query: 280 FLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLV 339
           FLSL+A++Y   V++VQ D+KKL+AYSS+AHMG+VT+G F     G+EG + QM+SHG V
Sbjct: 276 FLSLVAVMYVGAVALVQKDMKKLVAYSSVAHMGFVTLGFFLFSPLGIEGGIVQMISHGFV 335

Query: 340 SSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVI 399
           + A+F  +GV+YDR+HTR I  YGG+VH MP +    ++  MAN GLP TSGF+GEF+VI
Sbjct: 336 AGAMFLSIGVLYDRMHTRQIADYGGVVHRMPAFTAFAVLMAMANCGLPATSGFVGEFMVI 395

Query: 400 MSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIA 459
           ++       + +LA+  ++L A YSLW+ ++V FG      V++LKDL+ RE  ++  ++
Sbjct: 396 LAAVDYDFVIGILAATALILGAAYSLWMVKRVFFGTINNAHVEELKDLNCREYFLMAVLS 455

Query: 460 VLTVFFGIYPVPIRD 474
           +  +  G+YP P  D
Sbjct: 456 ICIIGMGVYPKPFTD 470


>gi|315465328|emb|CBQ72563.1| NADH:ubiquinone oxidoreductase chain 4 [Sporisorium reilianum]
          Length = 484

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/451 (44%), Positives = 302/451 (66%), Gaps = 5/451 (1%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFL 95
           VALG S INF+ S+ +WS FD   S +Q  + ++ ++ FC  H+GVDGIS+  V+LTTF+
Sbjct: 33  VALGTSLINFVLSILLWSEFDSSTSEYQFTQEFNQVN-FCHLHIGVDGISLYFVLLTTFI 91

Query: 96  TPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVW 155
           TP CILS+W +I++  + +++ FLVLE+++I  F+ LD+LLFY+FFE+ LIP+F+I+G+W
Sbjct: 92  TPICILSNWDNIKQQLKYFLMCFLVLETLLIAVFVVLDILLFYVFFESVLIPLFLIVGIW 151

Query: 156 GGS-ERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           GGS  R+ AA+  FLYT FGS+FML A +V+ +   ++    + ++S+     Q  +W+A
Sbjct: 152 GGSATRVRAAFLLFLYTLFGSLFMLLAFLVIYYNVGSTDF-QVVSLSEINLESQKLLWLA 210

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
            F S AIK P+ PFH WLP AH +AP AGSV LAG++LK+  YG +R L+   P A+ YF
Sbjct: 211 VFISMAIKTPLLPFHVWLPRAHAEAPLAGSVILAGLILKLATYGYMRILIQFLPDATSYF 270

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
           +P++  +++I +IYASL ++ QTD K L+AYSSI HM  V +G+FS    G++GA+   +
Sbjct: 271 SPLVQTIAVITLIYASLATLRQTDFKALVAYSSIGHMAVVVLGLFSNTIQGIDGALLLSI 330

Query: 335 SHGLVSSALFFCV-GVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           +HG+VS ALF  V GV+YDR HTR I  Y G+   MP ++++  VFT+ N  +P ++ + 
Sbjct: 331 AHGVVSPALFILVGGVLYDRYHTRTIRYYRGMTAYMPLFSIMFFVFTIFNAAVPLSANWA 390

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL +   FQ +   AVL S G+VLSA YS+WLY ++ FG    + +    DL+ RE  
Sbjct: 391 GEFLCLAGAFQRNPVFAVLGSTGIVLSAAYSIWLYNRIAFG-GWSKYLNYTTDLTRREFM 449

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSII 484
           ++ P+  + V FGI+P  I D+     S ++
Sbjct: 450 LLLPLLFVAVVFGIFPNIILDSVHASTSGLL 480


>gi|251773155|gb|EES53708.1| NADH dehydrogenase (quinone), chain M [Leptospirillum
           ferrodiazotrophum]
          Length = 468

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/465 (46%), Positives = 310/465 (66%), Gaps = 4/465 (0%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFG-VALGISTINFIFSLFVWSVFDKGR 59
           +++P L+ + F P +   +IL   Y   G        ALGI+ I F+ SL +    +   
Sbjct: 4   LSVPILTFLIFFPVVASLLIL-PFYKKPGTEGVVKWTALGITVIEFLVSLSLLIGNNPHL 62

Query: 60  SSFQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
              Q +E + WI +    Y LG+DGIS++LV++TTFL P  IL+SW  I +N   +MI  
Sbjct: 63  YQMQFVENHLWIPFGNIHYALGIDGISLVLVLMTTFLMPMTILTSWVGISKNLPLFMINL 122

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           LVLE  +IG F + D +LFY+F+EA LIPM++IIGVWGG  RIYAA KFFLYT  GS+ +
Sbjct: 123 LVLEGAMIGVFCATDFVLFYVFWEAMLIPMYLIIGVWGGPNRIYAAIKFFLYTLAGSLLL 182

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQ 238
           L AI+ + +    +  I   +   +  S Q   ++A F +FA+KIPMFPFHTWLP+AHV+
Sbjct: 183 LVAIIALYFVGGHTFDIARLSGQHYGMSFQILAFLAMFVAFAVKIPMFPFHTWLPDAHVE 242

Query: 239 APTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTD 298
           APTAGSV LA IMLKMG YG +RF LP+FP AS +FAP+I  LS+IAII+ + +++ Q D
Sbjct: 243 APTAGSVILASIMLKMGAYGFLRFSLPMFPDASHFFAPMILTLSVIAIIWGAFMALAQED 302

Query: 299 IKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRD 358
           +KKLIAYSS++HMG VT+GIF     G+EGA+ QML+HG+ + ALF C+GV+YDR H+R 
Sbjct: 303 MKKLIAYSSVSHMGVVTLGIFVANTQGIEGALMQMLNHGITTGALFLCIGVLYDRSHSRQ 362

Query: 359 IFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVV 418
           +  YGGL   MP Y+ ++++F ++++ LPGT+ F+GEFLV++  F+    V+ LA+ GV+
Sbjct: 363 LSEYGGLAKQMPVYSTLLVIFALSSLALPGTNSFVGEFLVLIGSFKTHAVVSSLATTGVI 422

Query: 419 LSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTV 463
           LSA+Y L+L  +VV+GV    K   + DL   E   + P+ V+ +
Sbjct: 423 LSAMYLLYLLSRVVWGV-YTPKSYAMPDLRAYEWGSLIPLVVMVI 466


>gi|313768493|ref|YP_004062169.1| NADH dehydrogenase subunit 4 [Gracilariophila oryzoides]
 gi|312844620|gb|ADR03185.1| NADH dehydrogenase subunit 4 [Gracilariophila oryzoides]
          Length = 491

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 301/437 (68%), Gaps = 3/437 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYH-LGVDGISILLVVLTTF 94
           +AL  + + F+FSL +W  FD   S FQ  E + W+     Y+ LG+DGIS+  ++LTT 
Sbjct: 38  IALNTACVTFLFSLVLWIQFDSHTSLFQFSETFDWLPSINLYYTLGIDGISLFFILLTTL 97

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           LT  CIL SW SI+   +EY+I FL+LE  +I  F  LD+L FYIFFE+ LIPMF+I+G+
Sbjct: 98  LTIICILVSWSSIKFLVKEYLICFLLLEFFLIQVFSVLDLLWFYIFFESVLIPMFLIVGI 157

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  ER I AAY+FFLYT  GS+ ML A++ + ++  ++ +  L     F    Q   W+
Sbjct: 158 WGSRERKIRAAYQFFLYTLVGSLLMLIALLTIYFQVGSTDL-QLIGYHNFSEIKQIIFWL 216

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+KIPM PFH WLP AH +APTAGSV LAGI+LKMGGYG +RF +PL P A  Y
Sbjct: 217 AFFASFAVKIPMIPFHIWLPEAHAEAPTAGSVILAGILLKMGGYGFLRFSIPLLPEACIY 276

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P++F LS+IAI+YASL ++ Q D+KK+IAYSS++HMG+VTIGIFS    G+EG++  M
Sbjct: 277 FTPLVFTLSIIAILYASLTTLRQVDLKKIIAYSSVSHMGFVTIGIFSLNLHGIEGSILLM 336

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVG++YDR  TR +  Y GL+  MP + V  + FT AN+G PGTS FI
Sbjct: 337 LSHGLVSSALFLCVGILYDRHKTRILKYYSGLMQVMPIFGVFFLFFTFANLGFPGTSSFI 396

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GE LV++  FQ +  +A  AS G++L A YS+WL+ ++ FG  K    +  +D+S RE  
Sbjct: 397 GELLVLVGAFQLNRILAFFASIGMILGASYSIWLFNRISFGTLKIHYFKLFQDVSRREFW 456

Query: 454 MVYPIAVLTVFFGIYPV 470
           ++ P+  L ++ GIYP+
Sbjct: 457 ILLPLTFLILWMGIYPI 473


>gi|14255|emb|CAA40452.1| NADH-ubiquinone oxidoreductase chain 4 [Triticum aestivum]
 gi|21824|emb|CAA40453.1| NADH-ubiquinone oxidoreductase chain 4 [Triticum aestivum]
          Length = 495

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 298/453 (65%), Gaps = 3/453 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSY-HLGVDGISILLVVLTTF 94
           + L +S I F++       FD   +  Q +E   W+ Y   + ++G+DG+S+  V+LTTF
Sbjct: 40  IGLCVSLITFLYPPVPRIQFDPSTAKSQFVESLRWLPYENIHLYMGIDGLSLFFVILTTF 99

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           L P CI   W  ++   +EY+ AFL+ E ++I     LD LLFY+  E+  IPMF+IIGV
Sbjct: 100 LIPICISVGWSGMRSFGKEYITAFLIREFLMIAVSCMLDPLLFYVLSESVPIPMFIIIGV 159

Query: 155 WGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWI 213
           WG  +R I AAY+FFLYT  GS+FML AI+++  +  T+ +  +   ++F    Q  +WI
Sbjct: 160 WGSRQRKIKAAYQFFLYTLLGSVFMLLAILLILLQTGTTDL-QILLTTEFSERRQILLWI 218

Query: 214 AFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQY 273
           AFF SFA+K+PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +P+FP A+  
Sbjct: 219 AFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLC 278

Query: 274 FAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQM 333
           F P I+ LS IAIIY SL ++ Q D+KK+IAYSS+AHM  VTIG+FS    G+ G++  M
Sbjct: 279 FTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSPNIQGIGGSILLM 338

Query: 334 LSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFI 393
           LSHGLVSSALF CVGV+YDR  TR +  YGGLV  MP ++ +   FT+ANM LPGTS FI
Sbjct: 339 LSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMPNFSTIFFFFTLANMSLPGTSSFI 398

Query: 394 GEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERC 453
           GEFL+++  FQ ++ VA L + G++L A YSLWLY +VV G  K + + +  DL+ RE  
Sbjct: 399 GEFLILVGAFQRNSLVATLRALGMILGAAYSLWLYNRVVSGNLKPDFLYKFSDLNGREVS 458

Query: 454 MVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  P  V  V  G++P    D     +S+++++
Sbjct: 459 IFLPFLVGVVRMGVHPKVFPDCMHTSVSNLVQH 491


>gi|121604342|ref|YP_981671.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Polaromonas naphthalenivorans CJ2]
 gi|120593311|gb|ABM36750.1| NADH dehydrogenase subunit M [Polaromonas naphthalenivorans CJ2]
          Length = 491

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 216/494 (43%), Positives = 326/494 (65%), Gaps = 16/494 (3%)

Query: 5   FLSIVTFLP-FLGVFVILFSSYLGCGRRSFFGVALGISTI----NFIFSLFVWSVFDKGR 59
            LS+  ++P F GV        L  GR S       I+ I    +F+ +L ++  F  G 
Sbjct: 3   LLSLAIWMPIFFGV------GLLALGRESQAHTVRWIALIGAIASFLVTLPLYDGFQLGT 56

Query: 60  SSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAF 118
           S+ Q +E   WI  F  +YHLGVDGIS+  V+LT F+    I++SW+SI     +YM +F
Sbjct: 57  SAMQFVEKSSWIPRFNMNYHLGVDGISLWFVLLTAFINVVVIIASWESITTRVNQYMASF 116

Query: 119 LVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFM 178
           L+L  ++IG F +LD +LFY+FFEA+LIPM++IIG+WGG  +IYAA+KFFLYT  GS+ M
Sbjct: 117 LILSGLMIGVFAALDGMLFYVFFEATLIPMYLIIGIWGGPNKIYAAFKFFLYTLLGSLLM 176

Query: 179 LFAIVVMCWEKKTSSIIDLYAMSKFPFSI--QYWMWIAFFCSFAIKIPMFPFHTWLPNAH 236
           L A++ +    K+    D+ A  K P S   Q  ++ +FF +FA+K+PM+P HTWLP+ H
Sbjct: 177 LVALIFLY--NKSGGSFDILAWHKLPLSATAQTLLFFSFFAAFAVKVPMWPVHTWLPDVH 234

Query: 237 VQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQ 296
           V+APT GS  LA IMLK+G YG +RF +P+ P AS  +A +I  LSLIA+IY  LV++VQ
Sbjct: 235 VEAPTGGSAVLAAIMLKLGAYGFLRFSMPITPDASHEWAGLIIALSLIAVIYVGLVALVQ 294

Query: 297 TDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHT 356
            D+KKL+AYSS+AHMG+VT+G F      V G + QM++HG VS+A+F C+GV+YDR+H+
Sbjct: 295 RDMKKLVAYSSVAHMGFVTLGFFLFNDLTVSGGIVQMIAHGFVSAAMFLCIGVLYDRVHS 354

Query: 357 RDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFG 416
           R+I +YGG+V+ MP++A   ++F MAN GLP T+GF+GE++VI+   +++  +   A+  
Sbjct: 355 REIASYGGVVNTMPKFAAFALLFAMANCGLPATAGFVGEWMVILGAVKSNFWIGAAAATA 414

Query: 417 VVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTF 476
           ++  A Y+LW+Y++V  G    E V+ + D++ RE  M+  +A+ T++ GIYP P  D  
Sbjct: 415 LISGAAYTLWMYKRVYLGPVTNENVKGMLDINNREFLMLGLLAIATLYMGIYPKPFTDVM 474

Query: 477 SVPLSSIIENYTLK 490
           +  ++ ++++  L 
Sbjct: 475 NTSVADLLKHVALS 488


>gi|327195229|ref|YP_004339011.1| NADH dehydrogenase subunit 4 [Coccomyxa sp. C-169]
 gi|325070725|gb|ADY75453.1| NADH dehydrogenase subunit 4 [Coccomyxa sp. C-169]
          Length = 490

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 300/444 (67%), Gaps = 10/444 (2%)

Query: 52  WSVFDKGRSSFQMIEYYHWID--------YFCSYHLGVDGISILLVVLTTFLTPFCILSS 103
           W  FD     FQ +  +  I            S+ +G+DGIS+  +VLTTFL P CIL  
Sbjct: 48  WIQFDNSSGRFQFVNSFALIQPSANGGEYTTLSFVVGLDGISLFFIVLTTFLIPICILVG 107

Query: 104 WKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSER-IY 162
           W +I+ + +EY +AFLVLES++I AF  LD+L FYIFFE+ LIPMF+IIGVWG  ER I 
Sbjct: 108 WTTIKASVKEYCVAFLVLESLLIAAFSVLDLLFFYIFFESVLIPMFLIIGVWGSRERKIR 167

Query: 163 AAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIK 222
           AAY+FFLYT  GS+ ML AI+++  +  T+ +  LYA ++F  + +  +W+AFF SFA+K
Sbjct: 168 AAYQFFLYTLVGSLLMLLAILLIYCQTGTTDLQILYA-TQFSETRELILWLAFFASFAVK 226

Query: 223 IPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLS 282
           +PM P H WLP AHV+APTAGSV LAGI+LK+G YG +RF +PLFP AS +F P+I  LS
Sbjct: 227 VPMLPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPLFPYASIFFTPLIETLS 286

Query: 283 LIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSA 342
           ++AIIY+SL ++ Q D+KK+IAYSS+AHM +VT+G+FS    GVEGA+  ML+HGLVS A
Sbjct: 287 ILAIIYSSLTTLRQVDLKKIIAYSSVAHMNFVTLGLFSLNPQGVEGAVLLMLAHGLVSPA 346

Query: 343 LFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSV 402
           LF  VG +YDR  TR +  YGG   +MP +A++ + FTMAN+ LPGT+ F+GEFLV++  
Sbjct: 347 LFLLVGFLYDRHKTRLLRYYGGCARSMPIFAIMFLFFTMANISLPGTANFVGEFLVLVGA 406

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLT 462
           F+++  VA +A+  +VL A Y+LWL  ++++G  K   +    DLS RE  ++ P     
Sbjct: 407 FRSNTFVATMAASTMVLGAAYALWLCNRLLYGFPKPYYLAAFADLSRREFFLLLPFVASV 466

Query: 463 VFFGIYPVPIRDTFSVPLSSIIEN 486
           +  G+ P    D     +++I++ 
Sbjct: 467 LVMGLMPDVFLDVIRCSVANILQR 490


>gi|121609750|ref|YP_997557.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Verminephrobacter eiseniae EF01-2]
 gi|121554390|gb|ABM58539.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Verminephrobacter eiseniae EF01-2]
          Length = 491

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 301/435 (69%), Gaps = 5/435 (1%)

Query: 55  FDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFRE 113
           F  G ++ Q +E   WI+ F   YHLGVDGIS   V LT F T   +++SW++I E   +
Sbjct: 52  FQPGTAAMQFVEKTAWIERFNVHYHLGVDGISFWFVPLTAFTTVIVVIASWQAITERVNQ 111

Query: 114 YMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFF 173
           YM AFL+L  ++IG F +LD +LFY+FFEA+LIPM++IIG+WGG  +IYAA+KFFLYT  
Sbjct: 112 YMGAFLILSGLMIGVFSALDGILFYVFFEATLIPMYLIIGIWGGPNKIYAAFKFFLYTLL 171

Query: 174 GSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPF--SIQYWMWIAFFCSFAIKIPMFPFHTW 231
           GS+ ML A++ +    ++   +D+    + P   + Q  ++ AFF +FA+K+PM+P HTW
Sbjct: 172 GSLLMLIALIYLY--NQSGGSVDIATWQQLPLGSTAQSLLFFAFFAAFAVKVPMWPVHTW 229

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+ HV+APT GS  LA IMLK+G YG +RF LP+ P A++ +A ++  LSLIA+IY  L
Sbjct: 230 LPDVHVEAPTGGSAVLAAIMLKLGAYGFLRFSLPITPDAAREWAWLMIALSLIAVIYVGL 289

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ D+KKL+AYSS+AHMG+VT+G F   + GV G + QM++HG VS+A+F  +GV+Y
Sbjct: 290 VALVQKDMKKLVAYSSVAHMGFVTLGFFIFNELGVAGGLVQMIAHGFVSAAMFLSIGVLY 349

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           DR+H+RDI AYGG+V+ MP +    ++F MAN GLPGT+GF+GE++VI++  + +  + +
Sbjct: 350 DRVHSRDIAAYGGVVNRMPNFTAFALLFAMANCGLPGTAGFVGEWMVILAAVKTNFWIGL 409

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVP 471
            A+  +VL A Y+LW++++V  G    ++V+ L D+  RE  ++  +A+  +  G+YP P
Sbjct: 410 AAATALVLGAAYTLWMFKRVYLGPVGNDQVRGLSDIGGREFLVLAWLAIAVLALGLYPRP 469

Query: 472 IRDTFSVPLSSIIEN 486
           + D     ++ ++ +
Sbjct: 470 VTDLMGPSVTELLRH 484


>gi|89900298|ref|YP_522769.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Rhodoferax ferrireducens T118]
 gi|89345035|gb|ABD69238.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Rhodoferax ferrireducens T118]
          Length = 491

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/472 (42%), Positives = 316/472 (66%), Gaps = 9/472 (1%)

Query: 26  LGCGR----RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLG 80
           L  GR    R+   VAL  + ++F+ +L +++ F  G ++ Q +E   WI+ F  +YH+G
Sbjct: 19  LALGRDDQARTVRWVALVGAIVSFLVTLPLYAGFKLGTAAMQFVEKAPWIERFNVNYHMG 78

Query: 81  VDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIF 140
           VDGIS+ LV+LT F+    +++ W+ I     +YM AFL+L  + IG F +LD +LFY+F
Sbjct: 79  VDGISLWLVILTAFINVVVVIAGWEVITRRVNQYMGAFLILSGLQIGVFCALDGMLFYVF 138

Query: 141 FEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAM 200
           FEA+L+PM++IIG+WGG  +IYAA+KFFLYT  GS+ ML A++ +    K+    DL   
Sbjct: 139 FEATLVPMYLIIGIWGGPNKIYAAFKFFLYTLLGSLLMLVALIFLY--TKSGGSFDLATW 196

Query: 201 SKFPF--SIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYG 258
            + P   + Q  ++ AF  +FA+K+PM+P HTWLP+ HV+APT GS  LA +MLK+G YG
Sbjct: 197 HQLPLAGTAQTLLFFAFLAAFAVKVPMWPVHTWLPDVHVEAPTGGSAVLAAVMLKLGAYG 256

Query: 259 CIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGI 318
            +RF LP+ P A+  ++ ++  LSLIA++Y  LV++VQTD+KKL+AY+S+AHMG+VT+G 
Sbjct: 257 FLRFSLPIAPDAAHEWSGLMIALSLIAVVYVGLVALVQTDMKKLVAYASVAHMGFVTLGF 316

Query: 319 FSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMV 378
           F     G+ GA+ QM+SHG VS+A+F  +GV+YDR H+R+I +YGG+V+ MP++    ++
Sbjct: 317 FIFNDLGLSGALVQMVSHGFVSAAMFLSIGVLYDRAHSREIASYGGVVNTMPKFTAFALL 376

Query: 379 FTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKC 438
           F MAN GLPGT+GF+GE++VI+   + +  +   A+  +V  A Y+LW+ ++V  G    
Sbjct: 377 FAMANCGLPGTAGFVGEWMVIIGAVKANFWLGFAAASSLVFGAAYTLWMVKRVYLGPVAN 436

Query: 439 EKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLK 490
           + V+ LKD++ RE  M+  +A+  ++ G+YP P  D     ++ ++++  L 
Sbjct: 437 DHVKALKDINAREFLMLSLLAIAVLYMGLYPKPFTDVMDTSVAELLKHVALS 488


>gi|8954372|ref|NP_059361.1| NADH dehydrogenase subunit 4 [Cyanidioschyzon merolae]
 gi|4115785|dbj|BAA36523.1| NADH-ubiquinone oxidoreductase chain 4 [Cyanidioschyzon merolae
           strain 10D]
          Length = 492

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/459 (46%), Positives = 318/459 (69%), Gaps = 5/459 (1%)

Query: 13  PFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWID 72
           P LG  +I+F          FF  +L IS++ F+ ++++W +FD+    FQ +     ++
Sbjct: 18  PLLGCIIIIFIPRNQLVLIRFF--SLIISSLTFLITIYLWILFDESYFYFQFVISKKILN 75

Query: 73  Y-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLS 131
           +    Y LGVDGIS+  ++LT+ L   C L +W + +E  +E++I F ++ES+++ AF +
Sbjct: 76  FELIQYFLGVDGISLFFIILTSLLIFVCFLLNWNANEEYNKEFLILFFMIESLLLNAFST 135

Query: 132 LDMLLFYIFFEASLIPMFVIIGVWGGSER-IYAAYKFFLYTFFGSIFMLFAIVVMCWEKK 190
           +D+LLFYIFFE  LIP+F IIG++G   R I A+Y+FFLYT  GS+ +L AI+++ +E  
Sbjct: 136 IDLLLFYIFFEGVLIPIFTIIGIFGSRTRKIRASYQFFLYTLLGSLLILIAILLIYFETG 195

Query: 191 TSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGI 250
           T++I  LY +  +    Q  +W+AFF SFA+K+PM PFH WLP AH +APT+GS+ LAGI
Sbjct: 196 TTNINFLYNVDFYERK-QLLLWLAFFASFAVKVPMIPFHIWLPEAHAEAPTSGSIILAGI 254

Query: 251 MLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAH 310
           +LK+GGYG +RF LPLFP AS Y++P+I+ LS+IAIIYASL ++ Q D+KK++AYSSIAH
Sbjct: 255 LLKLGGYGFLRFSLPLFPYASFYYSPLIYTLSIIAIIYASLTTLRQVDLKKIVAYSSIAH 314

Query: 311 MGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMP 370
           +GYV +GIFS    G+EG++  +L HG VSSALF CVGV+YDR  TR +  Y GL   +P
Sbjct: 315 IGYVILGIFSFNVQGLEGSLLLILGHGFVSSALFLCVGVLYDRYKTRILKYYSGLTTFIP 374

Query: 371 RYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRK 430
            +AV++  FT+AN+GLPGTS FIGEF++++ + Q S    + ++ G++LSA Y LW Y +
Sbjct: 375 LFAVLLFFFTLANIGLPGTSNFIGEFIILIGLIQTSVIATIFSTSGIILSASYCLWFYNR 434

Query: 431 VVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYP 469
           ++FG  K    + L+D+S +E   + P+ +LT+  G+YP
Sbjct: 435 LIFGNLKENYFKFLQDISKKEFMALIPLVILTLIMGLYP 473


>gi|171058197|ref|YP_001790546.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Leptothrix cholodnii SP-6]
 gi|170775642|gb|ACB33781.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Leptothrix cholodnii SP-6]
          Length = 490

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/452 (45%), Positives = 313/452 (69%), Gaps = 1/452 (0%)

Query: 36  VALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLVVLTTF 94
           +AL  + ++F+ +L +   FD   ++ Q  E   WI+ F   YHLGVDGIS+  V+LT F
Sbjct: 33  IALVGALVSFLITLPLIGSFDTATAAMQFQENLPWIERFNVRYHLGVDGISVWFVLLTAF 92

Query: 95  LTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGV 154
           +T   ++S+W+ I++   +YM AFL+L  +++G F ++D +LFY+FFEA+LIPM++IIG+
Sbjct: 93  ITVIVVISAWEVIEKRVHQYMGAFLILSGLMVGVFSAVDGMLFYVFFEATLIPMYLIIGM 152

Query: 155 WGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIA 214
           WGG+ R+YAA+KFFLYT  GS+ ML A++ + ++   S  I  +       + Q  ++ A
Sbjct: 153 WGGARRVYAAFKFFLYTLAGSLLMLIALIFLYYKSGGSFEILTWHALPLGETPQMLLFFA 212

Query: 215 FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYF 274
           FF +FA+K+PM+P HTWLP+AHV+APT GSV LA IMLK+G YG +RF LP+ P A+  +
Sbjct: 213 FFAAFAVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPIVPDAAMTY 272

Query: 275 APVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQML 334
           AP I  +SL+A+IY  LV++VQ D+KKL+AYSSIAHMG+VT+G F   + G+ G + QM+
Sbjct: 273 APFIITISLVAVIYIGLVALVQKDMKKLVAYSSIAHMGFVTLGFFIFSELGISGGLVQMI 332

Query: 335 SHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIG 394
           SHG VS A+F  +GV+YDR+H+R+I AYGG+V+ MP++    + F MAN GLPGT+GFIG
Sbjct: 333 SHGFVSGAMFLSIGVLYDRVHSREIAAYGGVVNTMPKFTAFAVFFGMANCGLPGTAGFIG 392

Query: 395 EFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCM 454
           E++VI+   + +  + +LA+  ++  A Y+LW+ ++V FG    + V++L D++ RE  M
Sbjct: 393 EWMVILGAVKYNFWIGLLAATALIFGAAYTLWMIKRVYFGDVANDDVRELTDINAREFLM 452

Query: 455 VYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           +  +A+ T+  G+YP P  D     ++ +I +
Sbjct: 453 LALLAIATLAMGLYPKPFTDVMHTSVTELIRH 484


>gi|94968332|ref|YP_590380.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Candidatus Koribacter versatilis Ellin345]
 gi|94550382|gb|ABF40306.1| NADH dehydrogenase subunit M [Candidatus Koribacter versatilis
           Ellin345]
          Length = 521

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 228/479 (47%), Positives = 312/479 (65%), Gaps = 17/479 (3%)

Query: 2   NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSS 61
           N   L++VTFLP LG  ++LF        R F   AL IS + FI SL +   FD  +  
Sbjct: 9   NDHILTLVTFLPGLGAVLLLFFPRRDRDIRWF---ALLISLLTFIASLHLPWHFDYSKGG 65

Query: 62  FQMIEYYHWIDY-FCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
           FQ      WI      YHLG DGISI LVVLTTFL P  +L SW SI+E  +E+ I  L+
Sbjct: 66  FQYELNVPWITTPNIHYHLGADGISIWLVVLTTFLVPLSVLISWTSIKERVKEFFILMLI 125

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LE+ ++G F+SLD+  FY F+EA+LIPM ++IG++G   RIYAA KFF+YT   S+FML 
Sbjct: 126 LETAMLGVFVSLDLFQFYFFWEATLIPMALLIGIYGHERRIYAAVKFFMYTMVASVFMLA 185

Query: 181 AIVVMCW-EKKTSS--------IIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTW 231
           A   M W   KT S         I L  +S F  + Q W+++ FF +FA+K+P+FPFHTW
Sbjct: 186 A---MLWLYSKTGSFDFVEIQQAIQLGNVSGFSHA-QQWLFLGFFIAFAVKVPLFPFHTW 241

Query: 232 LPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASL 291
           LP+AHV+APTAGSV LAG++LKMG YG +RF L LFP A++  AP I  L++I IIY +L
Sbjct: 242 LPDAHVEAPTAGSVLLAGVLLKMGTYGLLRFNLGLFPEAARRNAPWIIALAIIGIIYGAL 301

Query: 292 VSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY 351
           V++VQ ++KKL+AYSS++H+G+  +GIFS    GV G+++QML+HG+ +  LF  +G+IY
Sbjct: 302 VALVQPNMKKLVAYSSVSHLGFCVLGIFSFTAMGVSGSVYQMLNHGVSTGGLFMLLGMIY 361

Query: 352 DRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAV 411
           +R HT +I  YGGL   MP +A   +V T+A+ GLP  +GF+GEFLV+   FQ      +
Sbjct: 362 ERRHTYEIKQYGGLATPMPVFATFFLVITLASAGLPLLNGFVGEFLVLSGAFQAKMIYGI 421

Query: 412 LASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPV 470
           LA+ GV+  A Y LWLY+K  +G    E    L DL+ RER  ++PIAV+++  G+ P+
Sbjct: 422 LAASGVIWGAWYLLWLYQKTFYGDVTVEANNNLSDLNARERLSLWPIAVMSLVMGVVPM 480


>gi|326316111|ref|YP_004233783.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372947|gb|ADX45216.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 491

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 315/459 (68%), Gaps = 5/459 (1%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLV 89
           R+   +AL  S I    +L ++  FD G ++ Q +E   WI+ F   YHLG+DGIS   V
Sbjct: 28  RAVRWIALIGSLIGLAVTLPLYGNFDNGTAAAQFVEKILWIERFNVHYHLGLDGISFWFV 87

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
            LT F+T   +++SW+SI E   +YM AFL+L  ++IG F ++D LLFY+FFEA+LIPM+
Sbjct: 88  PLTAFITVIVVIASWESITERVNQYMGAFLILSGLMIGVFSAMDGLLFYVFFEATLIPMY 147

Query: 150 VIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI-- 207
           +IIG+WGG  +IYAA+KFFLYT  GS+ ML A+V +    ++    D+    + P S   
Sbjct: 148 LIIGIWGGPNKIYAAFKFFLYTLLGSLLMLIALVYLY--NQSGGSFDIATWHQLPLSARA 205

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q  ++ AFF +FA+K+PM+P HTWLP+ HV+APT GS  LA IMLK+G YG +RF +P+ 
Sbjct: 206 QTLLFFAFFAAFAVKVPMWPVHTWLPDVHVEAPTGGSAVLAAIMLKLGAYGFLRFSMPIA 265

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P A++++A ++  LSL+A+IY  LV+MVQ D+KKL+AYSS+AHMG+VT+G F     GV 
Sbjct: 266 PDAARHWAWLMIALSLVAVIYVGLVAMVQKDMKKLVAYSSVAHMGFVTLGFFIFNDLGVS 325

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G + QM++HG VS A+F  +GV+YDR+H+R+I AYGG+V+ MP++A   ++F MAN GLP
Sbjct: 326 GGLVQMIAHGFVSGAMFLSIGVLYDRVHSREIAAYGGVVNTMPKFAAFALLFAMANCGLP 385

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GT+GF+GE++VI+   + +  + +LA+  ++  A Y+LW++++V  G    + V+ L D+
Sbjct: 386 GTAGFVGEWMVILGAVKANFWIGLLAATALIFGAAYTLWMFKRVYLGPVGNDNVRGLLDI 445

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           S RE  ++  +AV  ++ G+YP P  D   V ++ ++++
Sbjct: 446 SAREFLVLGVLAVAVLYMGLYPRPFTDVMDVSVAELLKH 484


>gi|121593389|ref|YP_985285.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Acidovorax sp. JS42]
 gi|120605469|gb|ABM41209.1| NADH dehydrogenase subunit M [Acidovorax sp. JS42]
          Length = 491

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/468 (43%), Positives = 308/468 (65%), Gaps = 9/468 (1%)

Query: 26  LGCGRRSFFGVALGISTIN----FIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLG 80
           L  GR    G    ++ I     F  +L +   FD G ++ Q +E   WI+ F   YHLG
Sbjct: 19  LALGRDEHVGAVRWLALIGALAGFAVTLPLIGGFDNGSAAAQFVEKSMWIERFNVHYHLG 78

Query: 81  VDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIF 140
           VDGI+   V LT F+T   +++SW++I E   +YM AFL+L  +++G F ++D +LFY+F
Sbjct: 79  VDGIAFWFVPLTAFITVIVVIASWEAITERVNQYMAAFLILSGLMVGVFCAMDGMLFYVF 138

Query: 141 FEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAM 200
           FEA+LIPM++IIG+WGG  +IYAA+KFFLYT  GS+  L A + +    ++    D+   
Sbjct: 139 FEATLIPMYLIIGIWGGPNKIYAAFKFFLYTLLGSLLTLVAFIYLY--NQSGGSFDIATW 196

Query: 201 SKFPFS--IQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYG 258
            K P S   Q  ++ AFF +FA+K+PM+P HTWLP+ HV+APT GS  LA IMLK+G YG
Sbjct: 197 HKLPLSGTAQTLLFFAFFAAFAVKVPMWPVHTWLPDVHVEAPTGGSAVLAAIMLKLGAYG 256

Query: 259 CIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGI 318
            +RF LP+ P A+  +A ++  LSL+A+IY  LV+MVQ D+KKL+AYSS+AHMG VT+G 
Sbjct: 257 FLRFSLPIAPDAAHEWAWLMIALSLVAVIYVGLVAMVQKDMKKLVAYSSVAHMGLVTLGF 316

Query: 319 FSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMV 378
           F     GV G + QM++HG VS+A+F C+GV+YDR+H+R+I AYGG+V+ MP++A   ++
Sbjct: 317 FVFNDIGVSGGLVQMIAHGFVSAAMFLCIGVLYDRVHSREIAAYGGVVNTMPKFAAFALL 376

Query: 379 FTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKC 438
           F+MAN GLP T+GF+GE++VI+   +    V + A+  ++L A Y+LW+Y++V  G    
Sbjct: 377 FSMANCGLPATAGFVGEWMVIIGAVKFDFWVGLGAATSLILGASYTLWMYKRVYLGPVTN 436

Query: 439 EKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           + V+ L D+  RE  ++  +A+  ++ GI+P P  D     ++ ++ +
Sbjct: 437 DNVRGLADIGGREFLILGLLAIAVLYMGIHPKPFTDVMDASVAELLRH 484


>gi|148259944|ref|YP_001234071.1| proton-translocating NADH-quinone oxidoreductase, chain M
           [Acidiphilium cryptum JF-5]
 gi|146401625|gb|ABQ30152.1| NADH dehydrogenase subunit M [Acidiphilium cryptum JF-5]
          Length = 505

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/490 (42%), Positives = 309/490 (63%), Gaps = 5/490 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFS--SYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKG 58
           MN   LS++T+LP  G  ++ F+  S      R+   +AL  S +  + ++ +   F+  
Sbjct: 1   MNFHLLSLMTWLPLAGAVLMYFTGDSANPATARNARWIALWTSLLVLVLAVVMVVGFNPS 60

Query: 59  RSSFQMIEYYHWID-YFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIA 117
              FQ ++   WI  Y   Y +GVDGIS+  V L+  LTP  +L+SW+      R+YM A
Sbjct: 61  VHGFQFVDSAEWIPAYGIGYRMGVDGISLFFVALSALLTPVAVLASWRE-SRRVRDYMAA 119

Query: 118 FLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIF 177
           FL+LE+M IG F +LD LLFYIFFE  LIPM++IIGVWGG  RI+AA KFFL+T  GS+ 
Sbjct: 120 FLLLETMTIGMFSALDFLLFYIFFEGVLIPMYLIIGVWGGERRIHAAVKFFLFTLAGSLP 179

Query: 178 MLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHV 237
           ML A+V M     T+ ++ L   +  P + Q W+++AF  SF +K  ++P HTWLP+A+ 
Sbjct: 180 MLLALVWMWHHAGTTDMVQLMHTAIAP-TTQDWLFVAFLLSFGVKAAVWPMHTWLPDAYG 238

Query: 238 QAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQT 297
           +AP  G++ LA ++ KMG YG +RF LP+ P A+ YF P +F L +I I+Y S  ++ QT
Sbjct: 239 EAPLPGTIMLAAVLSKMGAYGFLRFSLPMLPQATAYFEPFMFALGIIGIVYISFAALAQT 298

Query: 298 DIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTR 357
           DIK++IAYSS+AHMG + +GIF+   +G+EGA+FQM+SHGLV +ALF CVG++  R H+ 
Sbjct: 299 DIKRMIAYSSVAHMGLIVVGIFTVTVAGIEGALFQMVSHGLVIAALFLCVGILLARGHSL 358

Query: 358 DIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGV 417
            +   GGL   MP YA  +M+F MAN+GLPGTSGF+GE LV++   Q +  VA+L   G+
Sbjct: 359 RLDQLGGLASRMPVYATFLMLFVMANVGLPGTSGFVGEILVMIGAIQANFWVALLVGSGM 418

Query: 418 VLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFS 477
           +LS +Y L + R+V+F  ++      + D+  RE  M+ P+AVL +  G  P  +   F 
Sbjct: 419 ILSVMYMLVMIRRVLFDKARSVANAVMADIGPREWLMLAPLAVLVIVLGFVPGGLTHIFD 478

Query: 478 VPLSSIIENY 487
             +  ++  +
Sbjct: 479 GAVQDLVHAH 488


>gi|120609962|ref|YP_969640.1| proton-translocating NADH-quinone oxidoreductase subunit M
           [Acidovorax citrulli AAC00-1]
 gi|120588426|gb|ABM31866.1| NADH dehydrogenase subunit M [Acidovorax citrulli AAC00-1]
          Length = 491

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/459 (45%), Positives = 314/459 (68%), Gaps = 5/459 (1%)

Query: 31  RSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYF-CSYHLGVDGISILLV 89
           R+   +AL  S I    +L + S FD G ++ Q +E   WI+ F   YHLG+DGIS   V
Sbjct: 28  RAVRWIALIGSLIGLAVTLPLLSGFDNGTAAAQFVEKLLWIERFNVHYHLGLDGISFWFV 87

Query: 90  VLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMF 149
            LT F+T   +++SW+SI E   +YM AFL+L  ++IG F +LD LLFY+FFEA+LIPM+
Sbjct: 88  PLTAFITVIVVIASWESITERVNQYMGAFLILSGLMIGVFSALDGLLFYVFFEATLIPMY 147

Query: 150 VIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSI-- 207
           +IIG+WGG  +IYAA+KFFLYT  GS+ ML A+V +    ++    D+    + P S   
Sbjct: 148 LIIGIWGGPNKIYAAFKFFLYTLLGSLLMLIALVYLY--NQSGGSFDIATWHQLPLSARA 205

Query: 208 QYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLF 267
           Q  ++ AFF +FA+K+PM+P HTWLP+ HV+APT GS  LA IMLK+G YG +RF +P+ 
Sbjct: 206 QTLLFFAFFAAFAVKVPMWPVHTWLPDVHVEAPTGGSAVLAAIMLKLGAYGFLRFSMPIA 265

Query: 268 PLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVE 327
           P A++++A ++  LSLIA+IY  LV+MVQ D+KKL+AYSS+AHMG+VT+G F     GV 
Sbjct: 266 PDAARHWAWLMIALSLIAVIYVGLVAMVQKDMKKLVAYSSVAHMGFVTLGFFIFNDLGVS 325

Query: 328 GAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLP 387
           G + QM++HG VS A+F  +GV+YDR+H+R+I AYGG+V+ MP++A   ++F MAN GLP
Sbjct: 326 GGLVQMIAHGFVSGAMFLSIGVLYDRVHSREIAAYGGVVNTMPKFAAFALLFAMANCGLP 385

Query: 388 GTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDL 447
           GT+GF+GE++VI+   + +  + + A+  ++  A Y+LW++++V  G    + V+ L D+
Sbjct: 386 GTAGFVGEWMVILGAVKANFWIGLAAATALIFGAAYTLWMFKRVYLGPVGNDNVRGLLDI 445

Query: 448 SLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIEN 486
           S RE  ++  +AV  ++ G+YP P  D   V ++ ++++
Sbjct: 446 SAREFLVLGVLAVAVLYMGLYPRPFTDVMDVSVAELLKH 484


>gi|327398409|ref|YP_004339278.1| proton-translocating NADH-quinone oxidoreductase subunit M [Hippea
           maritima DSM 10411]
 gi|327181038|gb|AEA33219.1| proton-translocating NADH-quinone oxidoreductase, chain M [Hippea
           maritima DSM 10411]
          Length = 521

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/497 (42%), Positives = 328/497 (65%), Gaps = 8/497 (1%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           ++ P L+ +TFLP +G F++   S    G   +  V  G   ++FI SL ++  FD    
Sbjct: 6   LHFPILTTITFLPLVGAFLVTLISEKNEGLIKY--VTFGFLVLDFIISLPLFFYFDPTTY 63

Query: 61  SFQMIEYYHWIDYFC-SYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFL 119
             Q +E   WI      Y++GVDGIS+ LV+LTTFLTP   LS+WK+I +  + + I  L
Sbjct: 64  HMQFVERVPWIKSLGFQYYVGVDGISLFLVLLTTFLTPIAQLSTWKAIDKKVKLFNIVIL 123

Query: 120 VLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFML 179
           ++++ ++G F+SLD+ LFY+F+E  LIPM+++IG+WGG  R++A  KFFLYTF GS+FML
Sbjct: 124 LMQTGMLGVFISLDVFLFYVFWELQLIPMYLMIGIWGGPNRVFATMKFFLYTFAGSVFML 183

Query: 180 FAIVVMCW--EKKTSS-IIDLYAMSK--FPFSIQYWMWIAFFCS