HHsearch alignment for GI: 254780868 and conserved domain: COG0340

>COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=405.87  Aligned_cols=229  Identities=42%  Similarity=0.667  Sum_probs=214.1

Q ss_pred             EECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHH
Q ss_conf             8164856899999997399997899982446783679985316633-334132235322400021013779999999999
Q gi|254780868|r   19 FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIA   97 (252)
Q Consensus        19 ~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G-~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~~l~   97 (252)
T Consensus         1 ~~~i~STn~~a~~~~~~~~~~~~vvvA~~QTaGRGR~GR~W~Sp~G~~l~~S~~l~~~~~~~~~~~lsl~~g~av~~al~   80 (238)
T COG0340           1 FDEIDSTNTEAKERAASGAPEGTVVVAEEQTAGRGRRGRKWSSPKGGGLYMSLLLRPDLPPAELPSLSLVAGLAVAEALR   80 (238)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98254089999999982899885899851046758899955298998879999987888767635668999999999999


Q ss_pred             HHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCC---CCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             7445421024621465067102211222233232258326765215444446422---3365321002367789789998
Q gi|254780868|r   98 STLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFS  174 (252)
Q Consensus        98 ~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~~---~~~~~tsL~~~~~~~~~~~l~~  174 (252)
T Consensus        81 ~~~---~~~~iKWPNDv~~~~kKl~GIL~E~~~~~~~~~~~viGIGINv~~~~~~~~~i~~~atsL~~~~~~~~r~~l~~  157 (238)
T COG0340          81 KFG---IDVRIKWPNDVLLNGKKLAGILVEAVGDENGLLAVVVGIGINVNNPPPDFEDIGQPATSLQEEGEEIDREELLA  157 (238)
T ss_pred             HHC---CCCCEECCCEEEECCCEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCHHHHCCHHHHHHHHCCCCCHHHHHH
T ss_conf             838---67666088623688960799999874157885489999976006688521122403666776306799999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCEEEEE-EEEEECCCCCEEEECCCCCEEEEEEEEEC
Q ss_conf             777999999998730355648899999875238977999979938999-99987698748999699989999963110
Q gi|254780868|r  175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILG-RFVGVDDFGYLLLEEKKGCVRQIFTGDIF  251 (252)
Q Consensus       175 ~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~gk~V~i~~~~~~~~G-~~~gId~~G~L~i~~~~G~~~~i~sGeI~  251 (252)
T Consensus       158 ~ll~~l~~~~~~~~~~-~~~~i~~~~~~~~~~~g~~V~~~~~~~~~~gg~a~~id~~G~L~l~~~~g~~~~~~~Gev~  234 (238)
T COG0340         158 KLLKELEKYLRQFLRE-GFAPILARWRARSLSLGKEVRLTLGGGVIFGGIAKGIDEDGALLLETDDGEVQTIYSGEVS  234 (238)
T ss_pred             HHHHHHHHHHHHHHHC-CHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEEEEECCCCEEEEEECCCEEEEEECEEEE
T ss_conf             9999999999998644-7057999999975537986999958960875399988789619999589708997331899