HHsearch alignment for GI: 254780868 and conserved domain: PRK11886

>PRK11886 biotin--protein ligase; Provisional.
Probab=100.00  E-value=0  Score=432.47  Aligned_cols=234  Identities=31%  Similarity=0.441  Sum_probs=212.6

Q ss_pred             CCEEEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHCCCHHHHHHH
Q ss_conf             97049998164856899999997399997899982446783679985316633-33413223532240002101377999
Q gi|254780868|r   12 YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAV   90 (252)
Q Consensus        12 ~~~~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G-~l~~S~~~~~~~~~~~~~~l~~~~~~   90 (252)
T Consensus        76 ~~~~i~~~~~idSTN~~a~~~~~-~~~~gtvviAe~QT~GRGR~GR~W~Sp~g~~Ly~Si~l~p~~~~~~~~~Ltl~~av  154 (319)
T PRK11886         76 DLGRVFVLPVIDSTNTYLLDRIA-ELKSGDLCLAEYQTAGRGRRGRQWVSPFGGNLYLSLYWRLNQGMAQAMGLSLVVGI  154 (319)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             79858998046858999998861-89998599988647688999790669899988999897679897887563699999


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCC--C-CCCCCCCCCCCCCCCC
Q ss_conf             999999974454210246214650671022112222332322583267652154444464--2-2336532100236778
Q gi|254780868|r   91 AMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP--V-DTPYPVTSLQREGGCI  167 (252)
Q Consensus        91 ai~~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~--~-~~~~~~tsL~~~~~~~  167 (252)
T Consensus       155 Av~~al~~~~--~~~~~IKWPNDIli~gkKi~GIL~E~~~e~~~~~~vViGIGINvn~~~~~~~~~~~a~s~l~~~g~~~  232 (319)
T PRK11886        155 AVAEALRRLG--AIDVGLKWPNDIYLNGRKLAGILVELTGETGDAAHVVIGIGINVAMPDFPEELIDQPWSDLQEAGPTI  232 (319)
T ss_pred             HHHHHHHHHC--CCCCEEECCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9999999835--87621337963022796289980111026788417999977861588885334203233488717989


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCEEEEEEEEEECCCCCEEEECCCCCEEEEEE
Q ss_conf             97899987779999999987303556488999998752389779999799389999998769874899969998999996
Q gi|254780868|r  168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT  247 (252)
Q Consensus       168 ~~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~gk~V~i~~~~~~~~G~~~gId~~G~L~i~~~~G~~~~i~s  247 (252)
T Consensus       233 ~r~~ll~~ll~~l~~~~~~~~~-~g~~~~~~~w~~~~~~~Gk~V~v~~~~~~~~G~a~gId~~G~Liv~~~~g-~~~i~s  310 (319)
T PRK11886        233 DRNQLAAELWKQLRAALELFEQ-EGLAPFLERWKKLDLFLGREVKLIIGQKEIFGIARGIDEQGALLLETDGG-EKPFNG  310 (319)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHCCCCCEEEEEECCEEEEEEEEEECCCCEEEEEECCC-EEEEEE
T ss_conf             9999999999999999999985-49899999999850716987999989989999998899998099998996-899998


Q ss_pred             EEE
Q ss_conf             311
Q gi|254780868|r  248 GDI  250 (252)
Q Consensus       248 GeI  250 (252)
T Consensus       311 GEV  313 (319)
T PRK11886        311 GEI  313 (319)
T ss_pred             EEE
T ss_conf             889