HHsearch alignment of GI: 254780868 and MMDB domain: 1bia_A_65-271

>1bia_A (A:65-271) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli}
Probab=100.00  E-value=0  Score=330.47  Aligned_cols=193  Identities=26%  Similarity=0.376  Sum_probs=173.4

Q ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHCCCHHHHH
Q ss_conf             99970499981648568999999973999978999824467836799853166333-34132235322400021013779
Q gi|254780868|r   10 NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSISKDSLTLLSFAI   88 (252)
Q Consensus        10 ~p~~~~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G~-l~~S~~~~~~~~~~~~~~l~~~~   88 (252)
                      .+.|+++++|++++|||++|++++.++ +++++|+|++||+||||+||+|+||+|+ +++|++++++.+....+.+++++
T Consensus        11 ~~~~~~i~~~~~~~STn~~~~~~~~~~-~~~~~v~A~~QT~GrGr~gr~W~Sp~g~~l~~sl~~~~~~~~~~~~~ls~~~   89 (207)
T 1bia_A           11 QLDGGSVAVLPVIDSTNQYLLDRIGEL-KSGDACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVI   89 (207)
T ss_dssp             TCCSSCEEECSSBSCHHHHHHTTGGGC-CTTCEEEESCBTTC---------CCTTSEEEEEEEEEECC-CCCTHHHHHHH
T ss_pred             CCCCCEEEEEEECCCHHHHHHHHHHCC-CCCCEEEECCCCCCCCCCCCEEECCCCCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             256632899962386799999987538-9998999365777777999830897999789997614677866753344667


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCCCC-CC
Q ss_conf             999999999744542102462146506710221122223323225832676521544444642--233653210023-67
Q gi|254780868|r   89 AVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQRE-GG  165 (252)
Q Consensus        89 ~~ai~~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~--~~~~~~tsL~~~-~~  165 (252)
                      |+|++++|+++.  +.++++|||||||+++||+||||+|.....+...++|||||||+++.+.  .....+|||... +.
T Consensus        90 ~~av~~aL~~~~--~~~~~iKWPNDI~~~~~Ki~GIL~E~~~~~~~~~~~viGiGiNv~~~~~~~~~~~~atsL~~~~~~  167 (207)
T 1bia_A           90 GIVMAEVLRKLG--ADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGI  167 (207)
T ss_dssp             HHHHHHHHHHTT--CTTCEEETTTEEEETTEEEEEEEEEEEC----CEEEEEEEEEECCC-----------CCCTTTTTC
T ss_pred             HHHHHHHHHHHC--CCEEEEEECCCHHCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCCCCCCCHHCCCCHHHHHHHCC
T ss_conf             899999987531--543678844411103445552368853114663203565302334678850000021023344224


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHC
Q ss_conf             78978999877799999999873035564889999987523
Q gi|254780868|r  166 CIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACG  206 (252)
Q Consensus       166 ~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~  206 (252)
                      .++++++++.++.++...+..|.+ .+|++++++|++++.+
T Consensus       168 ~~~~~~l~~~l~~~l~~~~~~~~~-~g~~~~~~~~~~~~~~  207 (207)
T 1bia_A          168 NLDRNTLAAMLIRELRAALELFEQ-EGLAPYLSRWEKLDNF  207 (207)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHH-HTTGGGHHHHHHHBTT
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHHH
T ss_conf             444366677666778999999986-4889999999996413