HHSEARCH alignment of GI: 254780868 and SCOP domain: d1x2ga2

Alignment
>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=96.46  E-value=0.018  Score=32.10  Aligned_cols=120  Identities=13%  Similarity=0.038  Sum_probs=71.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEEE----CCCCCCCCCC
Q ss_conf             367998531663333413223532240002101377999999999974454210246214650671----0221122223
Q gi|254780868|r   52 RGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIE  127 (252)
Q Consensus        52 rGr~gr~W~s~~G~l~~S~~~~~~~~~~~~~~l~~~~~~ai~~~l~~~~~~~~~~~iKWPNDi~~~----~kKi~GIL~E  127 (252)
                      |-+.|..=+-.+|++.+|++.+.+..      ......-.+.++++.+   +.++.++=-||++++    +|||+|+=.-
T Consensus        70 R~tGGgaV~hd~g~~~~s~i~~~~~~------~~~~~~~~i~~~l~~l---gi~a~~~~~~~~~~~~~~~gkKi~G~aq~  140 (246)
T d1x2ga2          70 RSSGGGAVFHDLGNTCFTFMAGKPEY------DKTISTSIVLNALNAL---GVSAEASGRNDLVVKTVEGDRKVSGSAYR  140 (246)
T ss_dssp             CSSCCCCEEECTTEEEEEEEEETTTC------CHHHHHHHHHHHHHHT---TCCEEEETTTEEEECCTTCCEEEEEEEEE
T ss_pred             ECCCCCEEEECCCCEEEEEEECCCHH------HHHHHHHHHHHHHHHC---CCCEEECCCCCEEEECCCCCEEEEEEEEE
T ss_conf             76887279967999899997557246------1999999999988861---88336668554367314686179767799


Q ss_pred             CCCCCCCCEEEEEECCCCCCCCCC-----------CC--------CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             323225832676521544444642-----------23--------36532100236778978999877799999999
Q gi|254780868|r  128 TLNLKNGLQAVVVGIGLNVKHCPV-----------DT--------PYPVTSLQREGGCIDLKDIFSLLFQDVARVLD  185 (252)
Q Consensus       128 ~~~~~~~~~~~viGiGiNi~~~~~-----------~~--------~~~~tsL~~~~~~~~~~~l~~~l~~~l~~~~~  185 (252)
                      .. .    ..++.+.-|++...++           ..        ....|+|.+....++.+++.+.|++.+...+.
T Consensus       141 ~~-~----~~~l~hgsi~~~~d~~~~~~~l~~~~~~~~~~~~~s~~~~vt~l~e~~~~i~~e~~~~~l~~~f~~~~~  212 (246)
T d1x2ga2         141 ET-K----DRGFHHGTLLLNADLSRLANYLNPDKKKLAAKGITSVRSRVTNLTELLPGITHEQVCEAITEAFFAHYG  212 (246)
T ss_dssp             EC-S----SEEEEEEEEESSCCSSGGGGGBCCCHHHHHCCC------CBCCGGGTCTTCCHHHHHHHHHHHHHHHHT
T ss_pred             EE-C----CEEEEECEEEECCCHHHHHHHCCCCCCCHHHHCCCCHHHHCCCHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             98-9----999990788656997897765088941113310343266476799967999999999999999999848


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: LplA-like
domain: Two-domain LplA, N-terminal domain
species: Escherichia coli [TaxId: 562]