BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780868|ref|YP_003065281.1| birA bifunctional protein
[Candidatus Liberibacter asiaticus str. psy62]
         (252 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780868|ref|YP_003065281.1| birA bifunctional protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040545|gb|ACT57341.1| birA bifunctional protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 252

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI
Sbjct: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK
Sbjct: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV
Sbjct: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG
Sbjct: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240

Query: 241 CVRQIFTGDIFT 252
           CVRQIFTGDIFT
Sbjct: 241 CVRQIFTGDIFT 252


>gi|315122711|ref|YP_004063200.1| birA bifunctional protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496113|gb|ADR52712.1| birA bifunctional protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 252

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/251 (78%), Positives = 222/251 (88%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M S+LSEC+  Y+FRYEFFDTI STNDECMKRALSGDLGNLWI+AS QT+GRGR   KW+
Sbjct: 1   MLSDLSECKKLYNFRYEFFDTIVSTNDECMKRALSGDLGNLWIIASRQTSGRGRGGKKWV 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           SDKGNLYASLLLIDSISKDSLTLLSFA++VAM S+IAS LP   DVKIKWPND+LVFQRK
Sbjct: 61  SDKGNLYASLLLIDSISKDSLTLLSFAVSVAMHSIIASILPAEVDVKIKWPNDLLVFQRK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IAGILIETL+LK+GLQA+V+GIGLNV++CP DT YPVTSL++EGGCIDLK I  + FQ++
Sbjct: 121 IAGILIETLDLKSGLQAIVIGIGLNVEYCPKDTSYPVTSLRKEGGCIDLKSILPIFFQEI 180

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           A++L +WKKDTGREEIM LWRCFA GIG+ ITIKL   SI G FVGVDDFGYLLLEEKKG
Sbjct: 181 AKMLAIWKKDTGREEIMKLWRCFAYGIGNPITIKLPQFSISGHFVGVDDFGYLLLEEKKG 240

Query: 241 CVRQIFTGDIF 251
           C R+IFTGDIF
Sbjct: 241 CFRKIFTGDIF 251


>gi|325292648|ref|YP_004278512.1| biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. H13-3]
 gi|325060501|gb|ADY64192.1| biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. H13-3]
          Length = 246

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 116/239 (48%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E      STN EC  RA +GD GNLWI A  QT GRGRR   W+S+ GNLYASLLLI
Sbjct: 6   FRHEAMAETPSTNIECFARARAGDGGNLWITAIRQTGGRGRRGRPWVSEPGNLYASLLLI 65

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    D +  L  A A+A+   I + LP G D ++IKWPND+L+ +RK  GIL+E   L 
Sbjct: 66  DPAPMDRIGSLPLAFALAVYRAIRAVLPTGGDPLEIKWPNDVLIGRRKTCGILMEAELLP 125

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G +A+V+GIG+N+ H P +  YPVT L   G      ++F+ LF++ A VL  W +  G
Sbjct: 126 DGRRAIVIGIGINIAHKPENPLYPVTMLSEHGASCSPDELFAHLFRETADVLQSWDEGRG 185

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              +M  WR  ACGIG+ IT+     SI GRFVG+DD GYLLL+E +G  R I  GD+F
Sbjct: 186 VSGVMAGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDEDEGTRRSIAAGDVF 244


>gi|15888613|ref|NP_354294.1| birA bifunctional protein [Agrobacterium tumefaciens str. C58]
 gi|15156335|gb|AAK87079.1| birA bifunctional protein [Agrobacterium tumefaciens str. C58]
          Length = 256

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/239 (47%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E      STN EC  RA +GD GNLW+ A  QT GRGRR   W+S+ GNLYASLLLI
Sbjct: 16  FRHEAMAETPSTNLECFARARAGDGGNLWVTAIRQTGGRGRRGRPWVSEPGNLYASLLLI 75

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + +  L  A A+A+   I + LP  G  ++IKWPND+L+ +RK  GIL+E   L 
Sbjct: 76  DPAPVERIGSLPLAFALAVYRAIRAVLPTAGEPLEIKWPNDVLIGRRKTCGILMEAELLP 135

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G +A+V+GIG+N+ H P +  YPVT L   G      ++F+ LF++ A VL  W +  G
Sbjct: 136 DGRRAIVIGIGINIAHKPDNPLYPVTMLSEHGASCSPDELFAHLFRETAEVLRNWDEGRG 195

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              IM  WR  ACGIG+ IT+     SI GRFVG+DD GYLLL+E +G  R I  GD+F
Sbjct: 196 VSGIMTGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDEDEGARRSIAAGDVF 254


>gi|218462143|ref|ZP_03502234.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           Kim 5]
          Length = 254

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 152/239 (63%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLL+
Sbjct: 14  FRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLV 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D   +D L  L  A+AVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPRDRLGSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD+W +  G
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDIWDQGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIIPIAAGDVF 252


>gi|209548878|ref|YP_002280795.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534634|gb|ACI54569.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 254

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 151/239 (63%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGDGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L+ L  A+AVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLSSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGERLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD W +  G
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDQWDEGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IAEITARWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGTGRIMPIAAGDVF 252


>gi|218672169|ref|ZP_03521838.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           GR56]
          Length = 254

 Score =  208 bits (529), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  A+AVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAVAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+NV   P +  YPVT L++        ++F+ LF  +A VLD W +  G
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPDELFAHLFAAMADVLDQWDQGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|190891301|ref|YP_001977843.1| biotin--[acetyl-CoA carboxylase] synthetase [Rhizobium etli CIAT
           652]
 gi|190696580|gb|ACE90665.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CIAT 652]
          Length = 254

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEGLSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  AIAVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAIAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD W +  G
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDQWDQGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IAEITARWRAIACGIGEKITVNLPDRSISGQFAGIDDKGLLMLDIGAGRIMPIAAGDVF 252


>gi|222085591|ref|YP_002544121.1| biotin--(acetyl-CoA carboxylase) synthetase protein [Agrobacterium
           radiobacter K84]
 gi|221723039|gb|ACM26195.1| biotin--(acetyl-CoA carboxylase) synthetase protein [Agrobacterium
           radiobacter K84]
          Length = 256

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 155/252 (61%), Gaps = 1/252 (0%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M ++++  ++   FR++     +STN EC++RA +GD GNLW+ A+ QT GRGRR   W+
Sbjct: 2   MATDMNSRKSLADFRHDALSETASTNSECLERARAGDAGNLWVTAARQTGGRGRRGRPWV 61

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQR 119
           S+ GNLYASLLLID    D L  L  A+AV +   +   LP+  + V++KWPNDIL+ ++
Sbjct: 62  SEPGNLYASLLLIDPAPMDRLGSLPLAVAVGVHQAVGGVLPLAAEPVEVKWPNDILIGRK 121

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K  GILIE   L +G  A+V+GIG+NV   P +  YPVT L+ +G  +  +++F+ L+  
Sbjct: 122 KTCGILIEGEALPDGRYALVIGIGINVTFMPDNPMYPVTCLREQGSTVSPEELFAHLYAS 181

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +A  L +W    G  E    WR  ACGIG+ IT+ L   SI G F G+DD G L+L+   
Sbjct: 182 MAEALAVWNSGKGVRETTARWREVACGIGEKITVNLPDRSISGHFAGIDDNGLLMLDAGG 241

Query: 240 GCVRQIFTGDIF 251
           G V  I  GD+F
Sbjct: 242 GKVLPIAAGDVF 253


>gi|86357253|ref|YP_469145.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CFN 42]
 gi|86281355|gb|ABC90418.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           CFN 42]
          Length = 254

 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  A+AVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAVAVAVHQTIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+NV   P +  YPVT L++        ++F+ LF  +A VLD W +  G
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPDELFAHLFAAMADVLDQWDQGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI   WR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IAEITARWRTIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIVPIAAGDVF 252


>gi|116251481|ref|YP_767319.1| biotin transcriptional regulator bifunctional protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256129|emb|CAK07210.1| putative biotin transcriptional regulator bifunctional protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 254

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 152/239 (63%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +G  GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGGGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  AIAVA+   I   LP+  + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAIAVAVHQAIRRVLPLRAEPLEVKWPNDILIGRKKTCGILVEGEGLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+N+   P +  YPVT L+++G     +++F+ LF   A VL++W +  G
Sbjct: 134 DGRYALIVGIGINISVMPDNPLYPVTCLRQQGSAASPEELFAHLFAATAEVLEIWDEGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI  LWR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 IGEITALWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|241204102|ref|YP_002975198.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857992|gb|ACS55659.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 254

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 154/239 (64%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGDGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  AIAVA+   I   LP+G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAIAVAVHQAIRRVLPLGAEPLEVKWPNDILIGRKKTCGILVEGEGLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G  A++VGIG+N+   P +  YPVT L+++G     +++F+ LF   A VL++W +  G
Sbjct: 134 DGRYALIVGIGINISVMPDNPLYPVTCLRQQGSAASPEELFAHLFAAAAEVLEIWDQGRG 193

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             EI  LWR  ACGIG+ IT+ L   SI G+F G+DD G L+L+   G +  I  GD+F
Sbjct: 194 VGEITTLWRAIACGIGEKITVNLPDRSISGQFAGIDDNGLLMLDTGAGRIMPIAAGDVF 252


>gi|227821633|ref|YP_002825603.1| biotin transcriptional regulator bifunctional protein
           [Sinorhizobium fredii NGR234]
 gi|227340632|gb|ACP24850.1| biotin transcriptional regulator bifunctional protein
           [Sinorhizobium fredii NGR234]
          Length = 255

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 147/243 (60%), Gaps = 1/243 (0%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +P  FR+       STN EC+ RA  GD GNLWI A+ QT GRGRR  +W S+ GNLYAS
Sbjct: 11  SPDDFRHIALAETVSTNSECLARAREGDPGNLWITAARQTGGRGRRGREWFSEPGNLYAS 70

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT-DVKIKWPNDILVFQRKIAGILIET 128
           LLLID    + L  L  A AVA+   I   +P G+ +V IKWPNDIL+  RK  GIL+E 
Sbjct: 71  LLLIDPAPVEHLHSLPLAAAVAVHRAIRRVMPPGSPEVAIKWPNDILIDGRKTCGILLEA 130

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             L +G  A+V+G G+NV   P    YPVTSL++EG  I  +++F+ LF  +A  L +W 
Sbjct: 131 EGLPDGRHALVIGCGVNVAVMPETGLYPVTSLRQEGATISAEELFAHLFVTMAEALSIWN 190

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +  G   +++ WR  A GIG+ IT+ L   S+ GRF+G+D  G LLL+   G    I  G
Sbjct: 191 RGAGIAAVIDQWRAAAKGIGEAITVNLPDRSLSGRFIGIDVDGRLLLDTGSGAPLAIAAG 250

Query: 249 DIF 251
           D+F
Sbjct: 251 DVF 253


>gi|90417829|ref|ZP_01225741.1| biotin--acetyl-CoA-carboxylase ligase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337501|gb|EAS51152.1| biotin--acetyl-CoA-carboxylase ligase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 262

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 139/237 (58%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R    D +SSTN   ++ A +GD G LW+ A  Q+AGRGRR   W+S++GNLYAS LLID
Sbjct: 10  RRLTLDEVSSTNTVALEAARAGDPGPLWVTAERQSAGRGRRGRNWVSERGNLYASWLLID 69

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                 L+ L    ++ +R+ +A  +  G  V +KWPND+L+  RK  GIL+E+  L +G
Sbjct: 70  PAPLTQLSNLPLVASLGVRNGLARLVAEGDTVAVKWPNDVLIKGRKTVGILLESERLPDG 129

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             AVVVG G+NV H P DTPYPVTSL  EG   DL+ +F  +  ++ RVL ++    G  
Sbjct: 130 RMAVVVGCGINVAHVPDDTPYPVTSLALEGATHDLEAVFGAVAAEMERVLAIFAGGRGFS 189

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I N W   A G+G    + L+   + GRF  +D+ G LLL +  G V  +  GD+F
Sbjct: 190 AIRNEWLAHAVGVGQPCRVNLADAVLTGRFEALDEHGLLLLRDAAGRVTAVSAGDLF 246


>gi|222148289|ref|YP_002549246.1| birA bifunctional protein [Agrobacterium vitis S4]
 gi|221735277|gb|ACM36240.1| birA bifunctional protein [Agrobacterium vitis S4]
          Length = 262

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 144/240 (60%), Gaps = 1/240 (0%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           +FR+   D + STN +C+ RA  GD G+LWI A+ QT GRGRR   W S+ GNLY+SLLL
Sbjct: 14  AFRHIALDEVDSTNQQCLIRARDGDPGDLWITANRQTGGRGRRGRPWASEPGNLYSSLLL 73

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNL 131
           ID      L  L  A+AVA+   I   LP G   ++IKWPND+L+ + K +GIL+E    
Sbjct: 74  IDPAPLADLPSLPLAVAVAVHDAIGIVLPSGAPPLEIKWPNDVLIGRAKTSGILLEAERT 133

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +G  A+V+GIG+N++  P +TPYP  SL   G  +   ++F+ LF  +A  L LW +  
Sbjct: 134 PDGRNALVIGIGINLRFKPTETPYPTASLAEHGAAVTPDELFTHLFAAMADALALWDRGR 193

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G + +M  WR  ACGI + IT+ L   SI G F G+DD G LLL+     +  +  GD+F
Sbjct: 194 GVKAVMQRWRQVACGIDEKITVNLPDRSISGVFSGIDDKGILLLDRGSLGITPVAAGDVF 253


>gi|6690793|gb|AAF24346.1|AF201721_1 BirA [Sinorhizobium meliloti]
          Length = 257

 Score =  191 bits (485), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 145/244 (59%), Gaps = 1/244 (0%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
            +P  FR+       STN EC+ RA  GD GNLWI A  QT GRGRR   W S+ GNLYA
Sbjct: 12  SSPEDFRHVALAETVSTNSECLLRAREGDPGNLWITAVRQTGGRGRRGRAWFSEPGNLYA 71

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIE 127
           SLLLID    D L  L  A AVA+   I   +P G  +  IKWPNDIL+  RK  GIL+E
Sbjct: 72  SLLLIDPAPVDRLHALPLAAAVAVHRAIRRVMPPGGAEAAIKWPNDILIDGRKTCGILLE 131

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              L +G +A+V+G G+NV   P D  YPVTSL+REG  I  +++F+ LF  +A  L +W
Sbjct: 132 GEVLADGRRALVIGCGINVAVMPEDALYPVTSLRREGATISPEELFAHLFVTMAETLAVW 191

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   I++ WR  A GIG+ IT+ L   S+ GRF G+D  G LLL+   G  + I  
Sbjct: 192 DRGAGVAAIIDQWRAAAKGIGEAITVNLPDRSLSGRFAGIDRDGRLLLDTGSGPPQTIAA 251

Query: 248 GDIF 251
           GD+F
Sbjct: 252 GDVF 255


>gi|15965033|ref|NP_385386.1| biotin--[acetyl-CoA-carboxylase] synthetase protein [Sinorhizobium
           meliloti 1021]
 gi|307301105|ref|ZP_07580874.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti
           BL225C]
 gi|307317839|ref|ZP_07597277.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti AK83]
 gi|15074212|emb|CAC45859.1| Probable biotin--[acetyl-CoA-carboxylase] synthetase [Sinorhizobium
           meliloti 1021]
 gi|306896601|gb|EFN27349.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti AK83]
 gi|306904060|gb|EFN34646.1| biotin/acetyl-CoA-carboxylase ligase [Sinorhizobium meliloti
           BL225C]
          Length = 255

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 145/244 (59%), Gaps = 1/244 (0%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
            +P  FR+       STN EC+ RA  GD GNLWI A  QT GRGRR   W S+ GNLYA
Sbjct: 10  SSPEDFRHVALAETVSTNSECLLRAREGDPGNLWITAVRQTGGRGRRGRAWFSEPGNLYA 69

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIE 127
           SLLLID    D L  L  A AVA+   I   +P G  +  IKWPNDIL+  RK  GIL+E
Sbjct: 70  SLLLIDPAPVDRLHALPLAAAVAVHRAIRRVMPPGGAEAAIKWPNDILIDGRKTCGILLE 129

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              L +G +A+V+G G+NV   P D  YPVTSL+REG  I  +++F+ LF  +A  L +W
Sbjct: 130 GEVLADGRRALVIGCGINVAVMPEDALYPVTSLRREGATISPEELFAHLFVTMAETLAVW 189

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   I++ WR  A GIG+ IT+ L   S+ GRF G+D  G LLL+   G  + I  
Sbjct: 190 DRGAGVAAIIDQWRAAAKGIGEAITVNLPDRSLSGRFAGIDRDGRLLLDTGSGPPQTIAA 249

Query: 248 GDIF 251
           GD+F
Sbjct: 250 GDVF 253


>gi|150396127|ref|YP_001326594.1| biotin--acetyl-CoA-carboxylase ligase [Sinorhizobium medicae
           WSM419]
 gi|150027642|gb|ABR59759.1| biotin--acetyl-CoA-carboxylase ligase [Sinorhizobium medicae
           WSM419]
          Length = 255

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 143/239 (59%), Gaps = 1/239 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+       STN EC+ RA  GD GNLWI A+ QT GRGRR   W S+ GNLYASLLLI
Sbjct: 15  FRHVALAEAVSTNSECLLRAREGDAGNLWITATRQTGGRGRRGRAWFSEPGNLYASLLLI 74

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETLNLK 132
           D    D L  L  A AVA+   I   +P G  +  IKWPNDIL+  RK  GIL+E   L 
Sbjct: 75  DPAPTDRLHALPLAAAVAVHRAIRRVMPPGGAEAAIKWPNDILIDGRKTCGILLEGETLP 134

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           +G +A+V+G G+NV   P +  YPVTSL++EG  +  +++F+ LF  +A  L +W +  G
Sbjct: 135 DGRRALVIGCGINVAVMPEEALYPVTSLRQEGATVSPEELFAHLFVTMAETLAVWDRGAG 194

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              ++  WR  A GIG+ IT+ L   S+ GRF G+D  G L+L+   G  + I  GD+F
Sbjct: 195 VGAVIEQWRAAAKGIGEAITVNLPNRSLSGRFAGIDRDGRLILDTGSGPPQTIAAGDVF 253


>gi|307942133|ref|ZP_07657484.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseibium sp. TrichSKD4]
 gi|307774419|gb|EFO33629.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseibium sp. TrichSKD4]
          Length = 258

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 136/250 (54%), Gaps = 4/250 (1%)

Query: 6   SECQNPYS----FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
           +E QNP      FR E    + STN    +RA +GDLG++W+ A+ QTAGRGRR   W S
Sbjct: 4   TEDQNPAPGAPGFRVERHGAVPSTNTLAFERARAGDLGHIWMTATEQTAGRGRRGRHWAS 63

Query: 62  DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
           ++GNL+ASLLLI+    + L  L    AVA+   I          K+KWPND+LV   K+
Sbjct: 64  NQGNLFASLLLINPAPTNRLPELPMVAAVALSKAIDLATGGYHLAKLKWPNDLLVSGAKL 123

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           +GIL+E   L +   AVV+G G+N    P D  YP T L   G  +  +D+F  L   +A
Sbjct: 124 SGILLEAETLVDNRTAVVLGFGVNCVTHPHDALYPCTDLAALGYRVSAEDLFHHLASSLA 183

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
             L  W    G  +I + W   A  +   +T++    ++ G+F  +DD G+L+L+   G 
Sbjct: 184 DELATWNSSNGFSQIRSGWLERAAHLRQQVTVRNGDEAVTGQFHNLDDRGHLVLKLDNGS 243

Query: 242 VRQIFTGDIF 251
           ++ IF GD+F
Sbjct: 244 LKTIFAGDVF 253


>gi|115524544|ref|YP_781455.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisA53]
 gi|115518491|gb|ABJ06475.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisA53]
          Length = 270

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 136/262 (51%), Gaps = 13/262 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L       + R  +FD + STN E M +A  G+ G +W V   QTAGRGRR   WI
Sbjct: 1   MTVALGPKAQAAATRLAYFDRLGSTNAEAMAQARGGETGPIWFVTLEQTAGRGRRQRPWI 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAS-----------TLPVGTDVKIK 109
           + +GNL +SLL +  ++      L FA  +A+   + +            LP+  D ++K
Sbjct: 61  APRGNLASSLLEVLDVAPGVAATLGFAAGLALEQALQTLTAQTATRRGIALPI--DYRLK 118

Query: 110 WPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDL 169
           WPND+L   +K+AGIL+E  +  +G  AVVVGIG NV   P DTPYP TSL+  G  +  
Sbjct: 119 WPNDVLANGQKLAGILLEAESTADGRLAVVVGIGTNVVAAPTDTPYPATSLRALGLDVTA 178

Query: 170 KDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDD 229
           +D+F+ L         +W +  G  EI   W   A G+G  ++I+    +I G F  +DD
Sbjct: 179 EDVFAALSDAWTEYRGIWDQGRGFAEIRKAWLQRAAGLGAPVSIRSGATAIEGLFDSIDD 238

Query: 230 FGYLLLEEKKGCVRQIFTGDIF 251
            G L++   +G +  I  GD+ 
Sbjct: 239 TGCLMIRTPQGRLIPIAAGDVH 260


>gi|254504283|ref|ZP_05116434.1| biotin-(acetyl-CoA-carboxylase) ligase [Labrenzia alexandrii
           DFL-11]
 gi|222440354|gb|EEE47033.1| biotin-(acetyl-CoA-carboxylase) ligase [Labrenzia alexandrii
           DFL-11]
          Length = 261

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 131/238 (55%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F YE ++T+ STN  C++RA+SG  GNLWI A  QTAGRGRR   W S +GNL+AS+L+I
Sbjct: 20  FLYEAYETVGSTNALCLERAVSGHPGNLWIRAGVQTAGRGRRGRAWTSPQGNLFASVLMI 79

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D      +  L    AVA+   +         V +KWPND+LV   K++GIL+E   LK+
Sbjct: 80  DPAPLARIGELPLLSAVALAEAVDKAAGTLQLVSLKWPNDLLVDGAKLSGILLEAETLKD 139

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G  A V+G G+N    P    Y  T L+  G  +    +F+ L + +A+ L +W +  G 
Sbjct: 140 GRLAAVMGFGVNCVSHPDPAMYQATDLRGLGFQVSADSLFAALAETLAKYLAIWHQPDGF 199

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + I   W   A  +G  IT++ +   I G F  +D  G+L+L    G  R ++ GD+F
Sbjct: 200 DRIRRQWLKRAAHLGQKITVRAAQEEITGIFDDLDASGHLVLRLDNGQKRTVYAGDVF 257


>gi|254469106|ref|ZP_05082511.1| biotin-(acetyl-CoA-carboxylase) ligase [Pseudovibrio sp. JE062]
 gi|211960941|gb|EEA96136.1| biotin-(acetyl-CoA-carboxylase) ligase [Pseudovibrio sp. JE062]
          Length = 246

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 130/238 (54%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F +E +D I STN   +++A  G  GNLW+ +  Q  GRGRR  +W S+ GNL+AS+LL 
Sbjct: 7   FCFEHYDQIGSTNTYGLQKARDGHPGNLWVRSDIQVTGRGRRGREWTSESGNLFASVLLR 66

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +  + +  L F  A+A+   I          ++KWPND+L+  +K++GIL+E+ +  N
Sbjct: 67  VDVQNEKIVQLPFVAALALGEAIERATGAHNLAQLKWPNDVLIDGQKVSGILLESESGPN 126

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G   +V G G+NV H P    Y VT L+  G   D   +F  L Q  AR L+ WK  +G 
Sbjct: 127 GELCLVCGFGVNVSHHPDLGDYAVTDLRSMGYMCDPSQVFDALAQSFARWLETWKAASGF 186

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           EEI + W   A G G  I ++LS     G F+ +D  G L+++   G  R +  GD+F
Sbjct: 187 EEIRSAWLRRAVGRGKPIRVRLSNEEFSGVFIDIDQMGRLIVKMDHGGERLVTAGDVF 244


>gi|90423919|ref|YP_532289.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB18]
 gi|90105933|gb|ABD87970.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB18]
          Length = 267

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 135/244 (55%), Gaps = 6/244 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FD+I STN E M RA  G+ G +W+V + QTAGRGRR   WI+ +GNL +S+L +
Sbjct: 14  YRVAAFDSIGSTNAEAMARARQGEAGPIWLVTTEQTAGRGRRQRSWIAPRGNLASSVLEV 73

Query: 74  DSISKDSLTLLSFAIAVAM----RSVIASTLPVGT--DVKIKWPNDILVFQRKIAGILIE 127
             ++  +   L FA  +A+    R++ A  +  G   D ++KWPND+L    K+AGIL+E
Sbjct: 74  MEVAPGTAATLGFAAGLALQAALRTLTAQAVGEGPAIDYRLKWPNDVLAGSHKLAGILLE 133

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              + +G  AVVVGIG NV   P DTPYP  SL+  G  +  + +F+ L    A    +W
Sbjct: 134 AEEVADGRLAVVVGIGTNVVAAPGDTPYPAASLKALGLDVTAEQLFAALSDHWASYRAIW 193

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G  EI   W   A G+G  ++I+    ++ G F  +DD G L++   +G    I  
Sbjct: 194 DLGRGFAEIRRQWLQHAAGLGGTVSIRSGATTVEGLFDSIDDTGCLIVRTPEGRQIPIAA 253

Query: 248 GDIF 251
           GD++
Sbjct: 254 GDVY 257


>gi|114707383|ref|ZP_01440280.1| probable biotin--[acetyl-coa-carboxylase] synthetase protein
           [Fulvimarina pelagi HTCC2506]
 gi|114537264|gb|EAU40391.1| probable biotin--[acetyl-coa-carboxylase] synthetase protein
           [Fulvimarina pelagi HTCC2506]
          Length = 247

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 132/238 (55%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   F  +SSTN   ++ A SGD G+LWI    Q  GRGR   KW+S+ GNLYAS L I
Sbjct: 8   YRRLSFAAVSSTNTLALEAARSGDPGDLWITGERQLEGRGRMGRKWVSEAGNLYASWLGI 67

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D      L  L F +++A+R+ +   +      ++KWPNDIL+  +K+ GIL+E+  L +
Sbjct: 68  DVAPPAELAKLPFVVSLAIRNAVQRFVEPPASAQMKWPNDILIDGKKLVGILLESSRLPS 127

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           G QA+++G G+N+ H P D PY VTSLQ EG     + +F +L ++  R L  +    G 
Sbjct: 128 GRQALILGCGINIAHKPSDAPYGVTSLQDEGYRSGPEPVFEVLAEEWHRQLLRFDGGAGF 187

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I + W   A G+    T++L   ++ G F  +D  G L+L    G  R I  GD+F
Sbjct: 188 AHIRSDWLEHAVGLSRPCTVRLPDRTLEGIFETLDADGRLILRFADGTRRPISAGDVF 245


>gi|161618780|ref|YP_001592667.1| biotin--acetyl-CoA-carboxylase ligase [Brucella canis ATCC 23365]
 gi|260566620|ref|ZP_05837090.1| biotin-protein ligase [Brucella suis bv. 4 str. 40]
 gi|161335591|gb|ABX61896.1| biotin--acetyl-CoA-carboxylase ligase [Brucella canis ATCC 23365]
 gi|260156138|gb|EEW91218.1| biotin-protein ligase [Brucella suis bv. 4 str. 40]
          Length = 265

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 138/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+  + ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACHFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|163868359|ref|YP_001609568.1| birA bifunctional protein [Bartonella tribocorum CIP 105476]
 gi|161018015|emb|CAK01573.1| birA bifunctional protein [Bartonella tribocorum CIP 105476]
          Length = 269

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 139/252 (55%), Gaps = 6/252 (2%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++++ STN    ++A +G  G LWIVA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQKQGYTVESYESVDSTNLIAQRKAQTGHQGYLWIVAQEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           NLY+SLLLID I   +   L F    ++A A++  I         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLIDDIVHQTAAQLGFVAGVSVAEAIKQFIKDEKQSNNIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +G+L+E L L +   A+V+GIG+NVK+   D PYP +SLQ  G  ++ + +F++L +  
Sbjct: 127 SSGVLLEILQLPSQQYALVIGIGINVKYNYEDAPYPTSSLQNIGLHVEAEQLFTVLTESF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD-DFGYLLLEEKK 239
           +R   LWK+  G E I N W  ++  +G  + +      I G F G+D DF   ++++K 
Sbjct: 187 SRNYLLWKQPKGCEIIRNKWLLYSAHLGKHVKVVNDEKIIEGIFDGLDCDFN-CIIKQKN 245

Query: 240 GCVRQIFTGDIF 251
           G    I  GD+ 
Sbjct: 246 GQTAIITAGDVH 257


>gi|153009737|ref|YP_001370952.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum anthropi ATCC
           49188]
 gi|151561625|gb|ABS15123.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum anthropi ATCC
           49188]
          Length = 265

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 138/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+T+ STN   ++RA SGD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEDYRLETFETVGSTNAVALERAASGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPLTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PY  TSLQ  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYAATSLQALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    I GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLQRAHGLGQNVTMQVEGRIIEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|218516162|ref|ZP_03513002.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           8C-3]
          Length = 228

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 114/177 (64%), Gaps = 1/177 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEGLSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L  L  AIAVA+   I   LP G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLGSLPLAIAVAVHQAIRQVLPPGAEPLEVKWPNDILIGRKKTCGILVEGEQLP 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           +G  A++VGIG+NV   P +  YPVT L++       +++F+ LF  +A VLD W +
Sbjct: 134 DGRYALIVGIGINVSVMPDNPLYPVTCLRQHASAASPEELFAHLFAAMADVLDQWDQ 190


>gi|240850597|ref|YP_002971997.1| biotin-protein ligase BirA [Bartonella grahamii as4aup]
 gi|240267720|gb|ACS51308.1| biotin-protein ligase BirA [Bartonella grahamii as4aup]
          Length = 269

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 138/251 (54%), Gaps = 4/251 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E +D++ STN    ++A +G  GNLWIVA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQEQGYTIEAYDSVDSTNLIAQRKAQTGHQGNLWIVAQEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           NLY+SLLLID I   +   L F    ++A A++ +I         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLIDDIVHQTAAQLGFVAGISVAEAIKQLIKDEKQTNNIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +G+L+E L L +   A+V+GIG+NVK+   + PYP +SL+  G  I+ + +F++L +  
Sbjct: 127 SSGVLLEILKLSSQQYALVIGIGINVKYNYENAPYPTSSLKNIGLHIEAEQLFTVLTECF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G E I   W  ++  +G  + +      I G F G+D     ++++K G
Sbjct: 187 SKNYLLWKQPKGCEIIRKKWLLYSAHLGKYVKVVNDEKVIEGVFDGLDSDFNCIIKQKNG 246

Query: 241 CVRQIFTGDIF 251
               I  GD+ 
Sbjct: 247 QTAIITAGDVH 257


>gi|256031417|ref|ZP_05445031.1| biotin--protein ligase [Brucella pinnipedialis M292/94/1]
 gi|265988506|ref|ZP_06101063.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M292/94/1]
 gi|264660703|gb|EEZ30964.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M292/94/1]
          Length = 265

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPAAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|91977341|ref|YP_570000.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB5]
 gi|91683797|gb|ABE40099.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           BisB5]
          Length = 269

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 8/259 (3%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L        +R   FD I STN E + +A +G+ G +W V + QTAGRGRR   WI
Sbjct: 1   MALQLGPRAQAAGYRLAAFDAIGSTNSEALAQARAGERGPMWFVTTEQTAGRGRRQRAWI 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVI------ASTLPVGTDV--KIKWPN 112
           + +GNL A++L + ++       L FA  +A+ + +      A     G D   ++KWPN
Sbjct: 61  APRGNLAATVLEVLAVPPGVAATLGFAAGLALETALQQVSFEARARAGGADFGFRLKWPN 120

Query: 113 DILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI 172
           D+L   +K+ GIL+E  ++     AVVVGIG NV   P DTPYP  SL   G  +  +D+
Sbjct: 121 DVLAGGKKLTGILLEAESVGADRLAVVVGIGTNVVAAPDDTPYPAASLHGLGIHVSAEDL 180

Query: 173 FSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGY 232
           F+ L    A    +W +  G  EI   W   A G+G  ++++    +I G F  +D+ G 
Sbjct: 181 FAALSDAWAETRAVWNEGRGFGEIRRQWLARAAGLGGPVSVQSGSTTIDGIFDTIDETGC 240

Query: 233 LLLEEKKGCVRQIFTGDIF 251
           L++    G    +  GD++
Sbjct: 241 LIVRTSDGRRVPVSAGDVY 259


>gi|225627313|ref|ZP_03785350.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ceti str. Cudo]
 gi|225617318|gb|EEH14363.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ceti str. Cudo]
          Length = 300

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 40  LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 99

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 100 NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 159

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 160 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 219

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 220 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 279

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 280 GSRVAVTAGDVY 291


>gi|23501703|ref|NP_697830.1| biotin--protein ligase [Brucella suis 1330]
 gi|254701584|ref|ZP_05163412.1| biotin--protein ligase [Brucella suis bv. 5 str. 513]
 gi|254704131|ref|ZP_05165959.1| biotin--protein ligase [Brucella suis bv. 3 str. 686]
 gi|254706968|ref|ZP_05168796.1| biotin--protein ligase [Brucella pinnipedialis M163/99/10]
 gi|254709924|ref|ZP_05171735.1| biotin--protein ligase [Brucella pinnipedialis B2/94]
 gi|254713925|ref|ZP_05175736.1| biotin--protein ligase [Brucella ceti M644/93/1]
 gi|254717017|ref|ZP_05178828.1| biotin--protein ligase [Brucella ceti M13/05/1]
 gi|256060928|ref|ZP_05451086.1| biotin--protein ligase [Brucella neotomae 5K33]
 gi|256159538|ref|ZP_05457306.1| biotin--protein ligase [Brucella ceti M490/95/1]
 gi|256254825|ref|ZP_05460361.1| biotin--protein ligase [Brucella ceti B1/94]
 gi|256369248|ref|YP_003106756.1| biotin--protein ligase [Brucella microti CCM 4915]
 gi|260168551|ref|ZP_05755362.1| biotin--protein ligase [Brucella sp. F5/99]
 gi|261218824|ref|ZP_05933105.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M13/05/1]
 gi|261222006|ref|ZP_05936287.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti B1/94]
 gi|261314431|ref|ZP_05953628.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261317470|ref|ZP_05956667.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis B2/94]
 gi|261321677|ref|ZP_05960874.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M644/93/1]
 gi|261324928|ref|ZP_05964125.1| biotin-acetyl-CoA-carboxylase ligase [Brucella neotomae 5K33]
 gi|261752137|ref|ZP_05995846.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 5 str. 513]
 gi|261754797|ref|ZP_05998506.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 3 str. 686]
 gi|261758024|ref|ZP_06001733.1| biotin-protein ligase [Brucella sp. F5/99]
 gi|265997970|ref|ZP_06110527.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M490/95/1]
 gi|294852173|ref|ZP_06792846.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella sp. NVSL 07-0026]
 gi|23347626|gb|AAN29745.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis 1330]
 gi|255999408|gb|ACU47807.1| biotin--protein ligase [Brucella microti CCM 4915]
 gi|260920590|gb|EEX87243.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti B1/94]
 gi|260923913|gb|EEX90481.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M13/05/1]
 gi|261294367|gb|EEX97863.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M644/93/1]
 gi|261296693|gb|EEY00190.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis B2/94]
 gi|261300908|gb|EEY04405.1| biotin-acetyl-CoA-carboxylase ligase [Brucella neotomae 5K33]
 gi|261303457|gb|EEY06954.1| biotin-acetyl-CoA-carboxylase ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261738008|gb|EEY26004.1| biotin-protein ligase [Brucella sp. F5/99]
 gi|261741890|gb|EEY29816.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 5 str. 513]
 gi|261744550|gb|EEY32476.1| biotin-acetyl-CoA-carboxylase ligase [Brucella suis bv. 3 str. 686]
 gi|262552438|gb|EEZ08428.1| biotin-acetyl-CoA-carboxylase ligase [Brucella ceti M490/95/1]
 gi|294820762|gb|EFG37761.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella sp. NVSL 07-0026]
          Length = 265

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|217979063|ref|YP_002363210.1| biotin/acetyl-CoA-carboxylase ligase [Methylocella silvestris BL2]
 gi|217504439|gb|ACK51848.1| biotin/acetyl-CoA-carboxylase ligase [Methylocella silvestris BL2]
          Length = 259

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 132/252 (52%), Gaps = 3/252 (1%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M S+L+       FR      + STNDE + RA +GD G LW+VA  QT GRGR    W 
Sbjct: 1   MLSHLARSVEASGFRLSVHGELGSTNDEALARARAGDPGRLWVVAERQTNGRGRLGRSWT 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S+ GNL+ASLLLID         L F  ++A+   +   L     +KIKWPNDIL    K
Sbjct: 61  SEPGNLFASLLLIDPAPLARAPELGFVASLALAIALRRLLDEDPALKIKWPNDILYKDAK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQD 179
           IAG+L+E++ L  G+   V GIG+N    P DT YP + L    G  +  + + + L +D
Sbjct: 121 IAGVLLESVTLGAGV-GCVAGIGVNCATHPSDTLYPASDLGAIAGRALTPETVLAALAED 179

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +A  L +W ++ G   I   W   A G+G+ I +     +  G F G+D  G L+L+   
Sbjct: 180 MAHWLAVWAQEGGFVLIRAEWLKRAGGLGEPIKVSRGEVATEGVFRGIDAAGRLILDGAA 239

Query: 240 GCVRQIFTGDIF 251
           G +  I  GD+F
Sbjct: 240 GEI-LIEAGDVF 250


>gi|254718925|ref|ZP_05180736.1| biotin--protein ligase [Brucella sp. 83/13]
 gi|265983912|ref|ZP_06096647.1| biotin-acetyl-CoA-carboxylase ligase [Brucella sp. 83/13]
 gi|306838227|ref|ZP_07471079.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. NF 2653]
 gi|264662504|gb|EEZ32765.1| biotin-acetyl-CoA-carboxylase ligase [Brucella sp. 83/13]
 gi|306406671|gb|EFM62898.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. NF 2653]
          Length = 265

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRIVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|306841946|ref|ZP_07474624.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO2]
 gi|306287979|gb|EFM59387.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO2]
          Length = 265

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKRQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRIVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|306843753|ref|ZP_07476352.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO1]
 gi|306275944|gb|EFM57657.1| biotin--acetyl-CoA-carboxylase ligase [Brucella sp. BO1]
          Length = 265

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 137/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW++   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLITKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|163843089|ref|YP_001627493.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis ATCC 23445]
 gi|163673812|gb|ABY37923.1| biotin--acetyl-CoA-carboxylase ligase [Brucella suis ATCC 23445]
          Length = 265

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAGTGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|148560586|ref|YP_001258794.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ovis ATCC 25840]
 gi|148371843|gb|ABQ61822.1| biotin--acetyl-CoA-carboxylase ligase [Brucella ovis ATCC 25840]
          Length = 265

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD +
Sbjct: 245 GSRVAVTAGDAY 256


>gi|163759526|ref|ZP_02166611.1| birA bifunctional protein [Hoeflea phototrophica DFL-43]
 gi|162283123|gb|EDQ33409.1| birA bifunctional protein [Hoeflea phototrophica DFL-43]
          Length = 254

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 138/243 (56%), Gaps = 1/243 (0%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           N   FR+     ++ST+ ECM+RA +GD G LW+ A+ QT GRGRR   W+S+ GNLYAS
Sbjct: 2   NVNGFRHIELGDVASTSIECMERARAGDPGGLWVTANRQTGGRGRRGRPWVSELGNLYAS 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIET 128
           LLLID     ++  L  A+ VA+   +A+ LP    + +IKWPND+L+   K AGILIE+
Sbjct: 62  LLLIDPAPWAAMASLPLAVTVAVYDAVAAVLPGDQANFRIKWPNDLLISGGKTAGILIES 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
             L +G  AVV+G GLN+ H P    Y  T L+  G  +  +D+F+ L   +   L  W 
Sbjct: 122 ETLPDGRMAVVIGCGLNIAHRPDAGLYKATCLREHGSAVTPQDLFAKLVVSMDARLAQWD 181

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +  G   I   W   A GIG+ +T+ L    I G F G+D  G L+L    G  + I +G
Sbjct: 182 QGRGLGSIRQAWIDRADGIGNPVTVNLPDQQIHGLFEGIDGEGRLMLAADDGTRQLIASG 241

Query: 249 DIF 251
           D+F
Sbjct: 242 DVF 244


>gi|182679338|ref|YP_001833484.1| biotin--acetyl-CoA-carboxylase ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635221|gb|ACB95995.1| biotin--acetyl-CoA-carboxylase ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 264

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 132/245 (53%), Gaps = 7/245 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           +FR   F+ + STNDE + RA +GD G LWIVA  Q+ GRGR    W S  GNLYASLLL
Sbjct: 9   AFRLAHFEKLGSTNDEALARARAGDPGRLWIVADEQSGGRGRLGRTWSSPAGNLYASLLL 68

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           +D      L+ L F   VA+   + + +     + IKWPND+L  + K+ GIL+E+  L 
Sbjct: 69  LDPAPPLHLSELGFVAGVALAESVRALVDADPRLGIKWPNDLLFAEAKLGGILLESTPLP 128

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC------IDLKDIFSLLFQDVARVLDL 186
            G +A V+GIG+N +  P +TPYP T+L + G        I  + +F  L   +AR L++
Sbjct: 129 GGGRACVIGIGVNCRSHPDNTPYPATALVKIGDAALAEKPIGPEHVFRALSASLARWLEV 188

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W       +I   W  +A  IG  I I    G I G F  +D  G L+L   +G  + I 
Sbjct: 189 WAGGKEFGQIRVEWLKYAAHIGRTIQIVRPNGRIEGIFKSIDAQGRLILTGPQG-EKVIE 247

Query: 247 TGDIF 251
            GD+F
Sbjct: 248 AGDVF 252


>gi|154248538|ref|YP_001419496.1| biotin--acetyl-CoA-carboxylase ligase [Xanthobacter autotrophicus
           Py2]
 gi|154162623|gb|ABS69839.1| biotin--acetyl-CoA-carboxylase ligase [Xanthobacter autotrophicus
           Py2]
          Length = 255

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 130/247 (52%), Gaps = 11/247 (4%)

Query: 15  RYEF---------FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN 65
            YEF         F  I STN E M R    +   +W+VA  QTAGRGRR   W S+ GN
Sbjct: 3   HYEFQGSTVPIVRFTQIGSTNAEGMARLGRSETFPVWLVADIQTAGRGRRGRPWTSELGN 62

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMR-SVIASTLPVGTD-VKIKWPNDILVFQRKIAG 123
           L+ASL+L +     +L  L F   +A+R +V+A+   +  D +++KWPND+L+   K+AG
Sbjct: 63  LFASLVLPNPAPVANLAQLCFVAGLALRDAVLAAAPQIRPDALRLKWPNDLLLDGGKVAG 122

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
           IL+E     +G  A V+G G+N  H P D PY  TSL+  G       +   L   +A  
Sbjct: 123 ILVEGGADPSGRPAAVIGFGVNCLHHPDDLPYRATSLEESGAPTAPDRLLEALDLAMAVR 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L+ W    G   I + W  +A G+GD +++K+    ++GRF  +D  G ++L  K G   
Sbjct: 183 LNQWNAGAGFPAIRSDWMRYALGMGDQVSVKIGEREVVGRFENIDTRGAMMLRRKDGIAE 242

Query: 244 QIFTGDI 250
            I  GD+
Sbjct: 243 IITAGDV 249


>gi|17987427|ref|NP_540061.1| biotin--protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|17983119|gb|AAL52325.1| biotin operon repressor / biotin-[acetyl-CoA-carboxylase]
           synthetase [Brucella melitensis bv. 1 str. 16M]
          Length = 287

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 27  LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 86

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 87  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 146

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 147 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDPPYPATSLRALGSKCDAETLFAALSDA 206

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 207 WSVNYRVWNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 266

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 267 GSRVAVTAGDVY 278


>gi|316933907|ref|YP_004108889.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           DX-1]
 gi|315601621|gb|ADU44156.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           DX-1]
          Length = 268

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 132/255 (51%), Gaps = 8/255 (3%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            L        +R   FD++ STN E + RA +G+ G  W V + QTAGRGRR   W++ +
Sbjct: 5   QLGSKATAAGYRLAAFDSVGSTNAEALARARAGEAGPAWFVTTEQTAGRGRRQRAWVAPR 64

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVA-----MRSVIASTLPVGTDV--KIKWPNDILV 116
           GNL +S+L +  +   +   L FA  +A      +  + +    GTD   ++KWPND+L 
Sbjct: 65  GNLASSVLEVMRVPPGTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLA 124

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
             +K+AGIL+E  N+ + L AVVVGIG NV   P DTPYP  SL   G  +  +D+F+ L
Sbjct: 125 SGKKLAGILLEAENVGDRL-AVVVGIGTNVVAAPTDTPYPAVSLHDLGIAVSAEDLFAAL 183

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
                 +  +W    G  EI   W   A G+G+ ++I      + G F  +DD G L++ 
Sbjct: 184 SDAWTELRGIWDGGRGFAEIRRRWLERAAGLGEPVSITSGDSVLEGVFDSIDDTGCLIVR 243

Query: 237 EKKGCVRQIFTGDIF 251
              G    +  GD++
Sbjct: 244 TTDGRRVPVSAGDVY 258


>gi|225852332|ref|YP_002732565.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis ATCC
           23457]
 gi|256044495|ref|ZP_05447399.1| biotin--protein ligase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113351|ref|ZP_05454209.1| biotin--protein ligase [Brucella melitensis bv. 3 str. Ether]
 gi|256264169|ref|ZP_05466701.1| biotin-protein ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|260563849|ref|ZP_05834335.1| biotin-protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|265990919|ref|ZP_06103476.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265994757|ref|ZP_06107314.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 3
           str. Ether]
 gi|225640697|gb|ACO00611.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis ATCC
           23457]
 gi|260153865|gb|EEW88957.1| biotin-protein ligase [Brucella melitensis bv. 1 str. 16M]
 gi|262765870|gb|EEZ11659.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 3
           str. Ether]
 gi|263001703|gb|EEZ14278.1| biotin-acetyl-CoA-carboxylase ligase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263094387|gb|EEZ18232.1| biotin-protein ligase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408839|gb|ADZ65904.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis M28]
 gi|326538555|gb|ADZ86770.1| biotin--acetyl-CoA-carboxylase ligase [Brucella melitensis M5-90]
          Length = 265

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDPPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|237815252|ref|ZP_04594250.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus str. 2308
           A]
 gi|237790089|gb|EEP64299.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus str. 2308
           A]
          Length = 300

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 40  LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 99

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 100 NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 159

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 160 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 219

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 220 WSVNYRVWNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 279

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 280 GSRVAVTAGDVY 291


>gi|319898896|ref|YP_004158989.1| birA bifunctional protein [Bartonella clarridgeiae 73]
 gi|319402860|emb|CBI76411.1| birA bifunctional protein [Bartonella clarridgeiae 73]
          Length = 267

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 134/251 (53%), Gaps = 4/251 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++++ STN    ++A +G  G LWIVA+ QT GR RR   W S KG
Sbjct: 5   LSDFAQKQGYDIEAYESVDSTNLVAQQKAHAGHHGYLWIVANEQTQGRARRGRIWSSPKG 64

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILVFQRK 120
           NLY+SLLLID I   +   LSF   V+M    +  I +   +   V +KWPNDIL+   K
Sbjct: 65  NLYSSLLLIDDIIHQTAAQLSFVAGVSMVEAIKQFIKNEKQINNLVSLKWPNDILLKGAK 124

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
             GIL+E   L +   A+V+GIG+NV+H   D PYP +S++  G  +D K +F++L Q  
Sbjct: 125 SCGILLELFKLTSQKYALVIGIGMNVEHHYEDAPYPTSSIKNIGLNVDRKQLFTVLTQYF 184

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           A    LWK+  G + I   W  +   +G  I +      I G F G+D     ++++  G
Sbjct: 185 AENYLLWKQSNGCDIISKKWLLYCSHVGQHIKVINDKRIIEGTFDGLDCNFNCIVKQTNG 244

Query: 241 CVRQIFTGDIF 251
               I +GD+ 
Sbjct: 245 QQTIITSGDVH 255


>gi|62289765|ref|YP_221558.1| biotin--protein ligase [Brucella abortus bv. 1 str. 9-941]
 gi|82699693|ref|YP_414267.1| biotin protein ligase [Brucella melitensis biovar Abortus 2308]
 gi|189024010|ref|YP_001934778.1| biotin--protein ligase [Brucella abortus S19]
 gi|254689072|ref|ZP_05152326.1| biotin--protein ligase [Brucella abortus bv. 6 str. 870]
 gi|254697206|ref|ZP_05159034.1| biotin--protein ligase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730102|ref|ZP_05188680.1| biotin--protein ligase [Brucella abortus bv. 4 str. 292]
 gi|256257321|ref|ZP_05462857.1| biotin--protein ligase [Brucella abortus bv. 9 str. C68]
 gi|260545485|ref|ZP_05821226.1| biotin-protein ligase [Brucella abortus NCTC 8038]
 gi|260754570|ref|ZP_05866918.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 6 str.
           870]
 gi|260757791|ref|ZP_05870139.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 4 str.
           292]
 gi|260761616|ref|ZP_05873959.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883597|ref|ZP_05895211.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 9 str.
           C68]
 gi|297248170|ref|ZP_06931888.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella abortus bv. 5 str.
           B3196]
 gi|62195897|gb|AAX74197.1| biotin--acetyl-CoA-carboxylase ligase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615794|emb|CAJ10792.1| Biotin protein ligase, C-terminal:Biotin/lipoate A/B protein ligase
           domain:Biotin--acetyl-CoA-carboxylase ligase [Brucella
           melitensis biovar Abortus 2308]
 gi|189019582|gb|ACD72304.1| biotin--protein ligase [Brucella abortus S19]
 gi|260096892|gb|EEW80767.1| biotin-protein ligase [Brucella abortus NCTC 8038]
 gi|260668109|gb|EEX55049.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 4 str.
           292]
 gi|260672048|gb|EEX58869.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674678|gb|EEX61499.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 6 str.
           870]
 gi|260873125|gb|EEX80194.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 9 str.
           C68]
 gi|297175339|gb|EFH34686.1| biotin-[acetyl-CoA-carboxylase] ligase [Brucella abortus bv. 5 str.
           B3196]
          Length = 265

 Score =  152 bits (383), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|239831700|ref|ZP_04680029.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum intermedium LMG
           3301]
 gi|239823967|gb|EEQ95535.1| biotin--acetyl-CoA-carboxylase ligase [Ochrobactrum intermedium LMG
           3301]
          Length = 265

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 138/252 (54%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+T+ STN   ++RA +GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAKNEGYRLESFETVGSTNAVALERAAAGDPGRLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++LLL++S    +   L F    ++A A+ ++ A+T P V   + +KWPND+L+   
Sbjct: 65  NLASTLLLVESYEMKTAATLGFVAGLSLADALDAIFAATGPAVPPTIGLKWPNDVLLNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K++GIL+E+  +  GL AV +GIG NV   P D PY  TSL+  G   D + +F+ L   
Sbjct: 125 KLSGILLESSIMGKGLFAVAIGIGTNVVAFPDDLPYAATSLRSLGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +  G ++I   W   A G+G  +T+++    + G F  +D+    ++ E  
Sbjct: 185 WSVNYRVWNEGRGLDDIRKRWLERAHGLGQRVTMQVEGRIVEGHFDTIDEACRFVIREDD 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|39936001|ref|NP_948277.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           CGA009]
 gi|39649855|emb|CAE28377.1| putative biotin-protein ligase birA [Rhodopseudomonas palustris
           CGA009]
          Length = 268

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 131/240 (54%), Gaps = 8/240 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+  STN E +  A +G+ G +W V + QTAGRGRR   WI+ +GNL +S+L +  +  
Sbjct: 20  FDSTGSTNAEALASARAGEAGPMWFVTTEQTAGRGRRQRAWIAPRGNLASSVLEVMRVPP 79

Query: 79  DSLTLLSFAIAVA-----MRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNL 131
            +   L FA  +A      +  + +    GTD   ++KWPND+L   +K+AGIL+E  N+
Sbjct: 80  GTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLASGKKLAGILLEVENV 139

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            + L AVVVGIG NV   P DTPYP  SL   G  +  +D+F+ L      +L +W    
Sbjct: 140 GDRL-AVVVGIGTNVIAAPTDTPYPAVSLHDLGISVTAEDLFAALSDAWTELLGIWDNGR 198

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   W   A G+G+ ++I+    ++ G F  +DD G L++    G    +  GD++
Sbjct: 199 GFPEIRRRWLERAAGLGEPVSIRSGDSALEGVFDSIDDTGCLIVRTTDGRRVPVSAGDVY 258


>gi|110633390|ref|YP_673598.1| biotin--acetyl-CoA-carboxylase ligase [Mesorhizobium sp. BNC1]
 gi|110284374|gb|ABG62433.1| biotin--acetyl-CoA-carboxylase ligase [Chelativorans sp. BNC1]
          Length = 274

 Score =  151 bits (381), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 128/253 (50%), Gaps = 15/253 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R E  +++ STN   ++RA+SGD G LW+V+  QT+GRGRR   W +  GNL A+LLL 
Sbjct: 13  YRLEAHESVGSTNVLALERAVSGDPGKLWVVSKNQTSGRGRRGRTWETPAGNLAATLLLA 72

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTD----------VKIKWPNDILVFQ 118
           D I   +   L F   +++   +    P     +G D           ++KWPND+L   
Sbjct: 73  DRIEPGAAATLGFVAGLSLSDALRQAAPSARLGIGIDGGEGKAERTRFELKWPNDVLADG 132

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
            K+AGIL+E+  L  G  AV +GIG+N+   PVDTPYP  SLQ  G   D + +F  L  
Sbjct: 133 AKLAGILLESSVLGEGRFAVAIGIGVNIVSHPVDTPYPAISLQGLGADCDAERLFEALSA 192

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
                  LW+   G   I + W   A G+G  ++++     + G F  +D+    ++ E 
Sbjct: 193 AWVENFALWQGPRGMSAIRDRWLENAAGLGSTVSVRADGRVVRGIFETIDEQCRFVVRED 252

Query: 239 KGCVRQIFTGDIF 251
            G    I  GD+ 
Sbjct: 253 NGSRLLIAAGDVH 265


>gi|254693555|ref|ZP_05155383.1| biotin--protein ligase [Brucella abortus bv. 3 str. Tulya]
 gi|261213820|ref|ZP_05928101.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260915427|gb|EEX82288.1| biotin-acetyl-CoA-carboxylase ligase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 265

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 136/252 (53%), Gaps = 5/252 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS       +R E F+ + STN   ++RA  GD G LW+V   Q +GRGRR   W + +G
Sbjct: 5   LSPVAANEGYRLETFEAVGSTNAVALERAAGGDPGKLWLVTKKQESGRGRRGRAWSTPEG 64

Query: 65  NLYASLLLIDSISKDSLTLLSF----AIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQR 119
           NL ++L+L++S    +   L F    ++A A+ +V A+T P V   + +KWPND+LV   
Sbjct: 65  NLASTLILVESYEMKTAATLGFVAGLSLADALDAVFAATGPAVPPTIGLKWPNDVLVNGA 124

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           K+ GIL+E+  L   L AV +GIG NV   P D PYP TSL+  G   D + +F+ L   
Sbjct: 125 KLTGILLESSILAKNLFAVAIGIGTNVVAFPDDLPYPATSLRALGSKCDAETLFAALSDA 184

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
            +    +W +    ++I   W   A G+G  +T+++    + GRF  +D+    ++ E +
Sbjct: 185 WSVNYRVWNEGRCLDDIRKRWLKRAHGLGQHVTMQVEGRVVEGRFETIDEACRFVIREDE 244

Query: 240 GCVRQIFTGDIF 251
           G    +  GD++
Sbjct: 245 GSRVAVTAGDVY 256


>gi|319404245|emb|CBI77838.1| birA bifunctional protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 267

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 136/256 (53%), Gaps = 6/256 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MVYVLSDFAKKQGYDIESYESVDSTNLVAQQKAHSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M    +  I +       + +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIHQTAAQLSFVAGVSMLEAVKQFIKNEKQANDIISLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L     A+V+GIG+NV++   D PYP +S++  G  ID + +F+ L
Sbjct: 121 KGAKSCGILLELFKLTPQKYALVIGIGMNVEYHYEDAPYPTSSIKNIGLNIDKEQLFTAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD-DFGYLLL 235
            Q  A    LWK+  G + I   W  +   +G  IT+      I G F G+D DF   ++
Sbjct: 181 TQYFAENYLLWKQPYGCDTIRKKWLLYCSHLGQHITVNSDERIIEGIFDGLDCDFN-CIV 239

Query: 236 EEKKGCVRQIFTGDIF 251
           ++K G    I +GD+ 
Sbjct: 240 KQKNGQRAIITSGDVH 255


>gi|13471392|ref|NP_102958.1| biotin--protein ligase [Mesorhizobium loti MAFF303099]
 gi|14022134|dbj|BAB48744.1| biotin-protein ligase; BirA [Mesorhizobium loti MAFF303099]
          Length = 273

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 131/264 (49%), Gaps = 13/264 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  D++ STN   +  A +GD G LW+V+  Q +GRGRR   W+
Sbjct: 1   MAFRLAPTSLSEGFRLEAHDSVGSTNTVALDHARAGDPGRLWVVSKKQESGRGRRGRAWV 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP-----VGTD--------VK 107
           S +GNL A+LL+I          L F   +++   + + +P     VG D         +
Sbjct: 61  SPEGNLAATLLVITGGELRLAATLGFVAGLSLADALDAVVPKGRVAVGLDGASQGQNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L+ G  AV VGIG+NV   P D PYP TSLQ  G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAILEGGRFAVAVGIGVNVVAHPKDLPYPATSLQALGATC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   +   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGLSAVRRRWLARAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDIF 251
           D+    ++ + +G V  I  GD+ 
Sbjct: 241 DEDCRFVIRDDEGTVLTIAAGDVH 264


>gi|319405684|emb|CBI79307.1| birA bifunctional protein [Bartonella sp. AR 15-3]
          Length = 267

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 136/256 (53%), Gaps = 6/256 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           MF  LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MFYVLSDFAQKQGYDIETYESVDSTNLVAQRKAYSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M    +  I +       V +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIDQTAAQLSFVAGVSMLEAIKQFIKNEKQANNIVSLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L +   A+V+GIG+NV++   D PYP +S++  G  ID K++F  L
Sbjct: 121 KGAKSCGILLELFKLTSQKYALVIGIGMNVEYHYEDAPYPTSSIKNIGLSIDKKELFMAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD-DFGYLLL 235
            Q  A    LWK+  G + I   W      +G  I +      I G F G+D DF   ++
Sbjct: 181 TQCFAENYLLWKQPCGCDIIRKKWLLSCSHLGQPIKVISDERIIEGIFDGLDCDFN-CIV 239

Query: 236 EEKKGCVRQIFTGDIF 251
           ++K G    I +GD+ 
Sbjct: 240 KQKNGQQVIITSGDVH 255


>gi|192291656|ref|YP_001992261.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           TIE-1]
 gi|192285405|gb|ACF01786.1| biotin/acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           TIE-1]
          Length = 268

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 131/240 (54%), Gaps = 8/240 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+  STN E +  A +G+ G +W V + QTAGRGRR   WI+ +GNL +S+L +  +  
Sbjct: 20  FDSTGSTNAEALISARAGEAGPMWFVTTEQTAGRGRRQRAWIAPRGNLASSVLEVMRVPP 79

Query: 79  DSLTLLSFAIAVA-----MRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNL 131
            +   L FA  +A      +  + +    GTD   ++KWPND+L   +K+AGIL+E  N+
Sbjct: 80  GTAATLGFAAGLALEAALQQVSLEARARSGTDFGFRLKWPNDVLASGKKLAGILLEAENV 139

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            + L AVVVGIG NV   P DTPYP  SL+  G  +  +D+F+ L      +  +W    
Sbjct: 140 GDRL-AVVVGIGTNVVAAPTDTPYPAVSLRDLGISVTAEDLFAALSDAWTELRGIWDDGR 198

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G  EI   W   A G+G+ ++I+    ++ G F  +DD G L++    G    +  GD++
Sbjct: 199 GFPEIRRRWLERAAGLGEPVSIRSGDSALEGVFDSIDDTGCLIVRTTDGRRVPVSAGDVY 258


>gi|296444808|ref|ZP_06886771.1| biotin/acetyl-CoA-carboxylase ligase [Methylosinus trichosporium
           OB3b]
 gi|296257756|gb|EFH04820.1| biotin/acetyl-CoA-carboxylase ligase [Methylosinus trichosporium
           OB3b]
          Length = 267

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 122/239 (51%), Gaps = 3/239 (1%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R   F+TI STNDE  +RA +GD G LWIVA+ QT GRGR    W S +GNL+ASLLL  
Sbjct: 16  RLAAFETIDSTNDEARRRAEAGDPGPLWIVAARQTKGRGRLGRSWSSLEGNLHASLLLSG 75

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
             +      L F   +A  + +         + +KWPND+L+   K+AG+L+E     + 
Sbjct: 76  FGAPAIAPQLGFVAGLATIAALIEITGAPHRLALKWPNDVLLDGAKLAGVLLEGAQPAHP 135

Query: 135 LQ--AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
               A ++G+G+N    P   PYP + L R     +   +F+ L   +   L LW    G
Sbjct: 136 AAPFACIIGVGVNCAAAPEGLPYPASDLSRLSAPTNAGALFACLSDHMEETLQLWSSGAG 195

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              +   W  +A G+G+ I  +L   ++ GRF  +D  G L++   +G  R I  GDIF
Sbjct: 196 FPALRERWLTYAAGLGEEIEARLPGETLRGRFETIDRDGRLII-SAEGGRRAIEAGDIF 253


>gi|319407253|emb|CBI80892.1| birA bifunctional protein [Bartonella sp. 1-1C]
          Length = 267

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 136/256 (53%), Gaps = 6/256 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A SG  G LWIVA+ QT GR RR   W 
Sbjct: 1   MVYVLSDFAQKQGYDIESYESVDSTNLVAQQKAHSGHHGYLWIVANEQTQGRARRGRIWS 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILV 116
           S KGNLY+SLLLID I   +   LSF   V+M    +  I +       + +KWPNDIL+
Sbjct: 61  SPKGNLYSSLLLIDDIIHQTAAQLSFVAGVSMLEAVKQFIKNEKQPNDIISLKWPNDILL 120

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K  GIL+E   L     A+V+GIG+NV++   D PYP +S++  G  ID + +F+ L
Sbjct: 121 KGAKSCGILLELFKLTPLKYALVIGIGMNVEYHYEDAPYPTSSIRNIGLNIDKEQLFTAL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD-DFGYLLL 235
            Q  A    LWK+  G + I   W  +   +G  IT+      I G F G+D DF   ++
Sbjct: 181 TQYFAENYLLWKQPCGCDIIRKKWLLYCSHLGQHITVNSDERIIEGIFDGLDCDFN-CIV 239

Query: 236 EEKKGCVRQIFTGDIF 251
           ++K G    I +GD+ 
Sbjct: 240 QQKNGQRAIITSGDVH 255


>gi|209885066|ref|YP_002288923.1| biotin-[acetyl-CoA-carboxylase] ligase [Oligotropha carboxidovorans
           OM5]
 gi|209873262|gb|ACI93058.1| biotin-[acetyl-CoA-carboxylase] ligase [Oligotropha carboxidovorans
           OM5]
          Length = 259

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 119/238 (50%), Gaps = 2/238 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   F++  STN E   R   G+ G LW+  + QTAG GRR   WIS  GNL  S++  
Sbjct: 14  YRLASFESAGSTNAEARARVRDGERGPLWLATAHQTAGHGRRQRAWISPPGNLACSVIET 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
               +     L FA  +A+ + +          ++KWPND+L  + K+AGILIE     +
Sbjct: 74  IETDQAHAATLGFAAGLALETALRRVCGEAASFQLKWPNDVLAGEAKLAGILIEAEQSPD 133

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           GL A VVG+G+N+   P DTPYP TSL   G   D   +F+ L    A    LW    G 
Sbjct: 134 GL-AAVVGMGVNIVVAPDDTPYPATSLAALGITADAPALFAALSDAWAEWFALWDHGRGF 192

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I   W   A G+G  + ++     + G F  +D+ G+L+L  + G   +I  GD++
Sbjct: 193 AAIRAQWLTRAAGLGAPLKVRQGERLVEGYFETIDEGGHLVL-SRDGQQTRIAAGDVY 249


>gi|92117729|ref|YP_577458.1| biotin--acetyl-CoA-carboxylase ligase [Nitrobacter hamburgensis
           X14]
 gi|91800623|gb|ABE62998.1| Biotin--acetyl-CoA-carboxylase ligase [Nitrobacter hamburgensis
           X14]
          Length = 270

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FD+I STN E + RA +G+ G +W+  + QTAGRGRR   W+S +GNL +S+L +
Sbjct: 14  YRIAAFDSIGSTNAEALMRARAGETGPIWLATTEQTAGRGRRQRAWVSPRGNLASSILEV 73

Query: 74  DSISKDSLTLLSFAIA---------VAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
              S      LSFA           V++ + + S         +KWPND+L   +K+AGI
Sbjct: 74  IDTSPAVAATLSFAAGLALEAALQTVSLEARMRSPGSENATFHLKWPNDVLAGGKKLAGI 133

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L+E   + +   AVVVGIG NV   P   PYP  SL+  G  I   D+F  L +      
Sbjct: 134 LLEAETVAHDRLAVVVGIGTNVVAAPEGIPYPAVSLRDLGIDIGAADLFRALTEAWVEFR 193

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W    G  +I  LW   A G+G  ++++    +I G F  +D+ G L++    G    
Sbjct: 194 QIWDGGRGFGDIRRLWLDRAAGVGQAVSVRSGASTISGLFDTIDEDGCLIVATSDGKRMA 253

Query: 245 IFTGDIF 251
           +  GD++
Sbjct: 254 VSAGDVY 260


>gi|49474191|ref|YP_032233.1| biotin-protein ligase birA [Bartonella quintana str. Toulouse]
 gi|49239695|emb|CAF26070.1| Biotin-protein ligase birA [Bartonella quintana str. Toulouse]
          Length = 269

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 130/250 (52%), Gaps = 4/250 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++ + STN    +RA +G  G LWIVA  Q+ G  RR   W S KG
Sbjct: 7   LSDFAQKQGYAVESYENVDSTNLIAQRRAYAGHRGYLWIVAQEQSQGMARRGRTWYSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP----VGTDVKIKWPNDILVFQRK 120
           NLY SLLLID I   +   LSF   V+M   I   +       + V +KWPNDIL+ + K
Sbjct: 67  NLYCSLLLIDDIVHQTAAQLSFVAGVSMVEAIKQFVKDENQANSIVSLKWPNDILLKESK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +GIL+E   L     A+V+GIG+NV     D PYP +SL+  G  ++ + +F++L +  
Sbjct: 127 SSGILLEIFKLTFQQYALVIGIGMNVNCHYEDAPYPTSSLKNIGLHVETEQLFTVLTEYF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G + I   W  ++  +G  I I      I G F G+D     ++++K G
Sbjct: 187 SKNYLLWKQPGGCDIIRKKWLLYSAHVGQHIKIINDKKVIEGIFDGLDSAFNCIIKQKNG 246

Query: 241 CVRQIFTGDI 250
               I  GD+
Sbjct: 247 QQVTITAGDV 256


>gi|288958975|ref|YP_003449316.1| biotin-[acetyl-CoA-carboxylase] ligase [Azospirillum sp. B510]
 gi|288911283|dbj|BAI72772.1| biotin-[acetyl-CoA-carboxylase] ligase [Azospirillum sp. B510]
          Length = 266

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 130/244 (53%), Gaps = 4/244 (1%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  F+ + FD++ STNDE    + SG      + A  Q +GRGRR   W S +GNLY++ 
Sbjct: 15  PPGFQVKAFDSVGSTNDEAKALSRSGAPEGTIVWARRQESGRGRRGRAWTSPEGNLYSTT 74

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   ++      +SF  A+A+     S LP  + V+ KWPND+LV  RK++GIL+E+  
Sbjct: 75  ILRPGLAPAEAAQISFVAALAIAETAESVLPDPSGVRCKWPNDVLVHDRKLSGILLESEP 134

Query: 131 LKNGLQA-VVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWK 188
             +G  A VV+G+G+N++H P    Y  TSL  EG   +    +  +    +A    LW+
Sbjct: 135 AADGTVAWVVLGVGINLRHFPATADYGATSLIAEGAPAMGPAALLEVYAGHLANWYGLWR 194

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ-IFT 247
              G   + + W   A G+G  I ++L+  +I G F  +D  G LLL+   G  RQ I  
Sbjct: 195 AH-GFGPVRDAWMARAKGLGGPILVRLADRTIPGIFADLDSDGVLLLDPTDGGPRQRIAA 253

Query: 248 GDIF 251
           GD+F
Sbjct: 254 GDVF 257


>gi|121602388|ref|YP_989084.1| biotin-[acetyl-CoA-carboxylase] ligase [Bartonella bacilliformis
           KC583]
 gi|120614565|gb|ABM45166.1| biotin-[acetyl-CoA-carboxylase] ligase [Bartonella bacilliformis
           KC583]
          Length = 266

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 133/255 (52%), Gaps = 7/255 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           + SN ++ Q    +  E ++++ STN    ++A +G  G LWIVA  Q  GR RR   W 
Sbjct: 3   VLSNFAQKQG---YGVESYESVDSTNLVAQQKAQAGHPGYLWIVAEEQIQGRARRGRSWS 59

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILV 116
           S KGNLY SLLLID+I+  +   L F   V+M    +  I         + +KWPNDIL+
Sbjct: 60  SPKGNLYTSLLLIDNITHQTAAHLGFVAGVSMVEAVKEFIKDQHKSEDIISLKWPNDILL 119

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL 176
              K +GIL+E   L     A+V+GIG+NV+    D PYP +S+++ G  ID K +F +L
Sbjct: 120 EGAKSSGILLELFELSPQKYALVIGIGMNVESHYKDAPYPTSSMKKIGLHIDKKQLFKVL 179

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            +  A+   LWK+  G + I   W  ++   G  I +      I G F G+D     +++
Sbjct: 180 TKFFAKNYLLWKQPKGYDVIRKKWLLYSAHFGQHIKVTDGSKIIEGIFDGLDCNFNCIVK 239

Query: 237 EKKGCVRQIFTGDIF 251
           ++ G    I  GD+ 
Sbjct: 240 QENGQEAIITAGDVH 254


>gi|148255899|ref|YP_001240484.1| putative biotin--(acetyl-CoA-carboxylase) synthetase
           [Bradyrhizobium sp. BTAi1]
 gi|146408072|gb|ABQ36578.1| putative Biotin--(acetyl-CoA-carboxylase) synthetase
           [Bradyrhizobium sp. BTAi1]
          Length = 269

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 123/242 (50%), Gaps = 10/242 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD   STN E +  A  G     W V + QTAGRGRR   W++ +GNL +S+L + +++ 
Sbjct: 19  FDQAGSTNIEALAAARQGARAPCWFVTTEQTAGRGRRQRPWVAPRGNLASSVLEVLNVAP 78

Query: 79  DSLTLLSFAIAVAMR---------SVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                L FA  +A+          +V+ S      D  +KWPND+L   RKI G+L+E  
Sbjct: 79  VVAATLGFAACLAIENALRQVSREAVLRSGGSSALDFAVKWPNDVLAGGRKIVGMLLEAE 138

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            +  GL AVV GIG NV   P DTP P  SL+  G  +  +D+FS L +       +W +
Sbjct: 139 QVAGGL-AVVAGIGTNVVAAPTDTPTPAVSLRDLGVEVSAEDLFSALSESWVEYFGIWNE 197

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G  +I  LW   A G+G  + I+  +  I G F  +D+ G +L+   +G +  I  GD
Sbjct: 198 GRGFADIRRLWLERAAGLGQPVAIRSGHAIIEGIFDTIDEQGCMLVRTAEGRLEPITAGD 257

Query: 250 IF 251
           + 
Sbjct: 258 VH 259


>gi|85717015|ref|ZP_01047977.1| biotin--protein ligase [Nitrobacter sp. Nb-311A]
 gi|85696139|gb|EAQ34035.1| biotin--protein ligase [Nitrobacter sp. Nb-311A]
          Length = 270

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 127/247 (51%), Gaps = 9/247 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FD I STN E + RA +G+ G +W+VA+ QTAGRGRR   WIS  GNL  S+L +
Sbjct: 14  YRLAVFDRIGSTNAEALMRARAGETGPIWLVAAEQTAGRGRRQRSWISPPGNLACSVLEV 73

Query: 74  DSISKDSLTLLSFAI---------AVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
             IS      LSFA          +V++ + + S         +KWPND+L   +K+AGI
Sbjct: 74  IDISPAVAATLSFAAGLALEAALRSVSLEARMRSPGSENVTFHLKWPNDVLADGKKLAGI 133

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L+E   +++   AVVVGIG NV   P   PYP  +L+  G  I  +D+F  L        
Sbjct: 134 LLEAEIVEHDRLAVVVGIGANVVAAPEGMPYPAVALRDLGIDIGAEDLFRALTDAWTEFR 193

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W +  G   I  LW   A G+G  ++I+    +I G F  +D  G L++    G    
Sbjct: 194 TIWDEGRGFGGIRRLWLDRAAGVGQHVSIRSDSSTISGLFDTIDKNGCLIVATSDGKRVA 253

Query: 245 IFTGDIF 251
           +  GD++
Sbjct: 254 VSAGDVY 260


>gi|319782996|ref|YP_004142472.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168884|gb|ADV12422.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 273

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 128/264 (48%), Gaps = 13/264 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  +++ STN   +  A +GD G LW+V+  Q +GRGRR   W 
Sbjct: 1   MAFRLAPTSASEGFRLEAHESVGSTNALALDHARAGDSGKLWVVSKKQESGRGRRGRVWA 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-------------TDVK 107
           + +GNL A+LL+I          L F   +A+   + + +P G                +
Sbjct: 61  TPEGNLAATLLVITKAELRLAATLGFVAGLALADALDAVVPKGRIAIGLDGGSEGKNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L+ G   V VGIG+NV   P D PYP TSL+  G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAILEGGRFGVAVGIGVNVVAYPEDLPYPATSLRALGAAC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   +   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGVAAVRRRWLDRAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDIF 251
           D+    ++ + +G VR I  GD+ 
Sbjct: 241 DEDCRFVIRDDEGSVRTIAAGDVH 264


>gi|304391416|ref|ZP_07373358.1| biotin-(acetyl-CoA-carboxylase) ligase [Ahrensia sp. R2A130]
 gi|303295645|gb|EFL90003.1| biotin-(acetyl-CoA-carboxylase) ligase [Ahrensia sp. R2A130]
          Length = 229

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 121/223 (54%), Gaps = 3/223 (1%)

Query: 30  MKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIA 89
           M  A  GD G LW+ A  Q  G+ RR   W+S++GNLYASLLL+D    D++  L    +
Sbjct: 1   MDAAQGGDAGQLWVTAKRQLQGKARRGRAWVSEEGNLYASLLLVDPAPADAIGQLPLVAS 60

Query: 90  VAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKH 148
           VA+ R+V+A+     T + IKWPND+L+  +K++G+L+E   +      +V+G G+N  H
Sbjct: 61  VALHRAVVAAVPEAKTRLTIKWPNDLLLDGKKLSGMLLEAAQIGE-RHNIVIGCGINCGH 119

Query: 149 CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIG 208
            P +  YP TS+      ++   +F  L +++A  L  W +  G   I + W   A G+G
Sbjct: 120 HPGEGLYPSTSVAESIAPLEPAALFPHLAREMADALHRWNRGAGFAAIRDDWLSRAAGLG 179

Query: 209 DLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             IT + S     G F  +D+ GYL+L  + G  R I   DIF
Sbjct: 180 QPITARFSNHEKSGIFDSLDEDGYLVLRGQNGTQR-ISAADIF 221


>gi|75676064|ref|YP_318485.1| biotin--protein ligase [Nitrobacter winogradskyi Nb-255]
 gi|74420934|gb|ABA05133.1| Biotin--acetyl-CoA-carboxylase ligase [Nitrobacter winogradskyi
           Nb-255]
          Length = 270

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FD I STN E + RA +G+ G +W+VA+ QTAG GRR   WIS +GNL  S+L +
Sbjct: 14  YRLAVFDRIGSTNAEALARARAGETGPIWLVAAEQTAGHGRRQRSWISPRGNLACSVLEV 73

Query: 74  DSISKDSLTLLSFAIA---------VAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
              S      LSFA           V++ + + S         +KWPND+L    K+AG+
Sbjct: 74  IDTSPAVAATLSFAAGLALEAALRTVSLEARMRSPGSENVTFHLKWPNDVLAGGGKLAGV 133

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L+E   +     AVVVG G NV   P   PYP  SL+  G  I  +D+F  L    A   
Sbjct: 134 LLEAETVAPDRLAVVVGTGANVAAAPEGMPYPAASLRDIGIDIGAEDLFGALTDAWAEFR 193

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +W K  G  EI  LW   A G+G  ++I+    +I G F  +D  G L++    G    
Sbjct: 194 IVWDKGRGFGEIRRLWLERAAGVGQHVSIRSDSSTISGLFDTIDKDGCLIVVTSDGRRVA 253

Query: 245 IFTGDIF 251
           +  GD++
Sbjct: 254 VSAGDVY 260


>gi|260462246|ref|ZP_05810490.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium opportunistum
           WSM2075]
 gi|259032106|gb|EEW33373.1| biotin/acetyl-CoA-carboxylase ligase [Mesorhizobium opportunistum
           WSM2075]
          Length = 273

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 125/264 (47%), Gaps = 13/264 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L+       FR E  D++ STN   +  A +GD G LW+V+  Q +GRGRR   W 
Sbjct: 1   MAFRLAPTSASEGFRLEAHDSVGSTNALALDHARAGDPGRLWVVSKKQESGRGRRGRVWA 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-------------TDVK 107
           + +GNL A+LL++          L F   +A+   + + +P G                +
Sbjct: 61  TPEGNLAATLLVLTGGELRLAATLGFVAGLALADALDAVVPKGRIAIGLDGASQGQNRFE 120

Query: 108 IKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI 167
           +KWPND+L    K+AGIL+E+  L  G  AV VGIG+NV   P D PYP TSL   G   
Sbjct: 121 LKWPNDVLASGAKLAGILLESAVLDGGRFAVAVGIGVNVVAHPQDLPYPATSLHALGAAC 180

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D + +F  L    +    LW +  G   I   W   A G+G  + +++    + G F  +
Sbjct: 181 DAETLFLALSDAWSENARLWDEGRGLAAIRRRWLARAAGLGGEVAVRIDGNVVRGVFETI 240

Query: 228 DDFGYLLLEEKKGCVRQIFTGDIF 251
           D+    ++ +  G V  I  GD+ 
Sbjct: 241 DEDCRFVIRDDDGSVLTIAAGDVH 264


>gi|319408593|emb|CBI82248.1| birA bifunctional protein [Bartonella schoenbuchensis R1]
          Length = 265

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 133/253 (52%), Gaps = 2/253 (0%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+      +  E ++++ STN    ++A +G  G LWIVA  QT GR RR   W 
Sbjct: 1   MVYALSDFALKQGYVLESYESVDSTNLIAQQKANAGHRGYLWIVAEKQTQGRARRGRTWY 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQ 118
           S KGNLY+SLLLID I   + + LSF   V++   I   +    D  V +KWPNDIL+  
Sbjct: 61  SPKGNLYSSLLLIDDIVCQTASQLSFVAGVSIVEAIRHFIKDKKDSIVNLKWPNDILLKG 120

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
            K +GIL+E   L     A+V+GIG+NVKH   D PY  +S++  G  ID +++F +L +
Sbjct: 121 IKSSGILLELFTLTPQKYALVIGIGVNVKHHFKDAPYLTSSIKNIGLDIDKEELFMVLTK 180

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
             A    LWK+  G   I   W  ++  +G  I I        G F G+D     ++++K
Sbjct: 181 CFAENYLLWKQSEGSSIIHKKWLLYSAHLGQPIKIINGEKLTEGIFDGLDHDFNCIVKQK 240

Query: 239 KGCVRQIFTGDIF 251
            G    I  GD++
Sbjct: 241 DGQKAIITAGDVY 253


>gi|49475644|ref|YP_033685.1| biotin-protein ligase birA [Bartonella henselae str. Houston-1]
 gi|49238451|emb|CAF27679.1| Biotin-protein ligase birA [Bartonella henselae str. Houston-1]
          Length = 269

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 132/251 (52%), Gaps = 4/251 (1%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+      +  E ++ + STN    ++A +G  G LW+VA  Q+ GR RR   W S KG
Sbjct: 7   LSDFAQKQGYAVESYEIVDSTNYIAQQKAHAGHHGYLWVVAKEQSQGRARRGRTWSSPKG 66

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVA----MRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           NLY+SLLL++ I   +   L F   V+    ++  I         V +KWPNDIL+   K
Sbjct: 67  NLYSSLLLVEDIVHQTAAQLGFVAGVSVVETIKQFIKDEKQTSDIVSLKWPNDILLRGAK 126

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
            +GIL+E   L +   A+V+GIG+NVK+   D PYP +SL+  G  I+ + +F++L +  
Sbjct: 127 SSGILLEIFKLPSQQYALVIGIGINVKYHYEDAPYPTSSLKNIGLDIETEQLFTVLTEYF 186

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++   LWK+  G + I   W  ++   G  + I      I G F G+D+    ++++K G
Sbjct: 187 SKNYLLWKQLGGCDRIREKWLLYSAHSGQYVKIVNDEKIIEGIFDGLDNDFNCVIKQKNG 246

Query: 241 CVRQIFTGDIF 251
               I  GD+ 
Sbjct: 247 QQAVITAGDVH 257


>gi|146341099|ref|YP_001206147.1| putative biotin--[acetyl-CoA-carboxylase] synthetase
           [Bradyrhizobium sp. ORS278]
 gi|146193905|emb|CAL77922.1| putative Biotin--[acetyl-CoA-carboxylase] synthetase
           (Biotin--protein ligase), birA-like protein
           [Bradyrhizobium sp. ORS278]
          Length = 269

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 123/242 (50%), Gaps = 10/242 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD   STN E +  A +G     W V + QTAGRGRR   WI+ +GNL +S+L +  +  
Sbjct: 19  FDQAGSTNVEALVAARNGAKAPCWFVTTEQTAGRGRRHRPWIAPRGNLASSVLEVLDVIP 78

Query: 79  DSLTLLSFAI---------AVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                L FA           V++ +V+ S      D+ +KWPND+L   RKI G+L+E  
Sbjct: 79  AVAATLGFAACLAIENALRQVSLEAVLRSGGSPALDLAVKWPNDVLAGGRKIVGMLLEAE 138

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +GL AVV GIG NV   P DTP P  SL+  G  +  +D+F+ L  +      +W  
Sbjct: 139 QVASGL-AVVAGIGTNVVAAPTDTPTPAVSLRDLGVEVSAEDLFTALSDNWVEYFGIWNA 197

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G  +I  LW   A G+G  + I+  +  I G F  +D+ G +L+   +G +  I  GD
Sbjct: 198 GRGFGDIRKLWLERAAGLGQPVAIRSGHAIIEGIFDTIDEQGCMLVRTAEGRLEPITAGD 257

Query: 250 IF 251
           + 
Sbjct: 258 VH 259


>gi|299135018|ref|ZP_07028209.1| biotin/acetyl-CoA-carboxylase ligase [Afipia sp. 1NLS2]
 gi|298589995|gb|EFI50199.1| biotin/acetyl-CoA-carboxylase ligase [Afipia sp. 1NLS2]
          Length = 259

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 121/238 (50%), Gaps = 2/238 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R   FDT++STN E + R  +G+ G LW+  + QTAG GRR   WIS  GNL  S++  
Sbjct: 14  YRLVSFDTLNSTNAEALTRLRAGERGPLWLATAHQTAGHGRRQRAWISPPGNLACSVVET 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +        L FA  +A+ + +          ++KWPND+L  + K+AGILIE     +
Sbjct: 74  LTADHAGAATLGFAAGLALETALRQVSGDAALFRLKWPNDVLANEAKLAGILIEAEATPD 133

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            L A VVG+GLNV   P  TPYP TSL+  G   D + +F+ L    A    +W    G 
Sbjct: 134 SL-AAVVGMGLNVVAAPEGTPYPATSLKALGLVTDAETLFAALTDAWAEWFSIWDHGRGF 192

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           E I   W   A G+G  I ++     I G F  +D+ G L++    G    +  GD++
Sbjct: 193 EAIRTQWLARAAGLGAAIQVRQGDRVIDGTFETIDEAGRLVVSHGGGAT-TVAAGDVY 249


>gi|188580271|ref|YP_001923716.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium populi
           BJ001]
 gi|179343769|gb|ACB79181.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium populi
           BJ001]
          Length = 281

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 127/274 (46%), Gaps = 24/274 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAHGGEAGPLWVTTRRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVI-----------------ASTLPV 102
           S +GNL ASLLL +  ++ + +  L F   VA+   I                    LP 
Sbjct: 61  SPEGNLAASLLLPVAGVAPEMVATLGFVAGVALVDAIRDACRLDPSPLSPQAGEGDALPQ 120

Query: 103 G-----TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV 157
           G       + +KWPND+L   RK+AGIL+E   L  G +AVVVG G+NV   P   PYP 
Sbjct: 121 GIAAAHAAIHLKWPNDVLADGRKLAGILLEAETLPGGRRAVVVGFGVNVAAAPEGLPYPA 180

Query: 158 TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSY 217
            +L         + +   L +     + +W K  G   I   W   A G+G  ++++++ 
Sbjct: 181 AALSAFSAADAPR-LLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAE 239

Query: 218 GSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            ++ G F  +D+ G L++    G  R +  G++ 
Sbjct: 240 VTLTGIFETIDEGGRLVILAPDGTRRTVTAGEVH 273


>gi|254560039|ref|YP_003067134.1| biotin-protein ligase [Methylobacterium extorquens DM4]
 gi|254267317|emb|CAX23149.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens DM4]
          Length = 279

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 128/272 (47%), Gaps = 22/272 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAHGGETGPLWVTTQRQEAGRGRRGNAWA 60

Query: 61  SDKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVIA---------------STLPVG- 103
           S +GNL ASLL+ +  ++ + +  L F   VA+   +                + LP G 
Sbjct: 61  SPEGNLAASLLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPNPERGYAPLPQGI 120

Query: 104 ----TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
                 + +KWPNDIL   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDILADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L       D   +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAF-SAADAPMLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + G F  +D+ G L++    G  R +  G++ 
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEVH 271


>gi|240137568|ref|YP_002962039.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens AM1]
 gi|240007536|gb|ACS38762.1| putative biotin-protein ligase (birA-like) [Methylobacterium
           extorquens AM1]
          Length = 279

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 128/272 (47%), Gaps = 22/272 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEAMRLAQGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVIA---------------STLPVG- 103
           S +GNL ASLL+ +  ++ + +  L F   VA+   +                + LP G 
Sbjct: 61  SPEGNLAASLLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPRAEMGDAPLPQGI 120

Query: 104 ----TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
                 + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L       D   +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAF-SAADAPMLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + G F  +D+ G L++    G  R +  G++ 
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEVH 271


>gi|220924019|ref|YP_002499321.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium nodulans ORS
           2060]
 gi|219948626|gb|ACL59018.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium nodulans ORS
           2060]
          Length = 264

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 115/244 (47%), Gaps = 7/244 (2%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL-- 71
           +R E  DT+ ST+ + M RA  G  G LW+V   QT GRGRR + W S +GNL ASL   
Sbjct: 14  YRLETHDTLGSTSTQAMARAREGAEGPLWVVTRRQTEGRGRRGSAWSSPEGNLAASLYWP 73

Query: 72  LIDSISKDSLTLLSFAIAV----AMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
           +   ++ D +  L F   +    A+R V           ++KWPND+L    K+AGIL+E
Sbjct: 74  VPPGLAPDRIATLGFVAGLSLERALREVCGPERGAADAFRLKWPNDVLAGGDKLAGILLE 133

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              L  G  AVVVG G+NV   P    YPV SL   G   D   +F  L       L +W
Sbjct: 134 METLPQG-AAVVVGFGVNVAAAPEGLAYPVASLAGLGRPADAAGLFRRLSATWIETLRVW 192

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            + +G   I   W   A G+G  + +      + G F  +D  G L++    G  R +  
Sbjct: 193 DEGSGFPAIRAAWLATAAGLGGPVAVDTGSERLAGTFDTIDSSGRLVVRLADGTQRTVTA 252

Query: 248 GDIF 251
           G + 
Sbjct: 253 GAVH 256


>gi|328543701|ref|YP_004303810.1| Biotin-(acetyl-CoA-carboxylase) ligase [polymorphum gilvum
           SL003B-26A1]
 gi|326413445|gb|ADZ70508.1| Biotin-(Acetyl-CoA-carboxylase) ligase [Polymorphum gilvum
           SL003B-26A1]
          Length = 261

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 129/256 (50%), Gaps = 5/256 (1%)

Query: 1   MFSNLSECQNPYS--FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNK 58
           M   L+    P +  FR EF D++ STN   M  A +GD G LWI+A  QTAGRGRR   
Sbjct: 1   MAEPLTTGPAPSATGFRVEFHDSVPSTNSLAMAAARAGDAGRLWILAHEQTAGRGRRGRA 60

Query: 59  WISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
           W S +GNL+AS+LLID   K  +  L    AVA+   +         V +KWPND+LV  
Sbjct: 61  WASSRGNLFASVLLIDPQPKARIAELPLVAAVALAEAVERAAGAHGLVGLKWPNDLLVEG 120

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
            K++GIL+E   L +G  AVV G G+N    P    Y  T L   G  I    +F  L  
Sbjct: 121 AKLSGILLEAETLADGRLAVVCGFGVNCVSHPEPDGYKATDLAALGYRIGAGLLFDRLAA 180

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKL---SYGSILGRFVGVDDFGYLLL 235
                LD W  D G + +   W   A  +G+ IT++    S   + GRF  +D  G L+L
Sbjct: 181 TFGAWLDTWSADNGFDVVRRAWMGRALRLGETITVRTGTESAADLTGRFCEIDGRGQLVL 240

Query: 236 EEKKGCVRQIFTGDIF 251
           +   G +R I  GD+F
Sbjct: 241 QLDDGTIRTISAGDVF 256


>gi|312116316|ref|YP_004013912.1| biotin/acetyl-CoA-carboxylase ligase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221445|gb|ADP72813.1| biotin/acetyl-CoA-carboxylase ligase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 250

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 133/241 (55%), Gaps = 15/241 (6%)

Query: 19  FDTISSTNDECMKR-ALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           FD+I STN+E +++ A   DL  LWIVA  QT GRGR    W S +GN+YA+LLL  ++S
Sbjct: 12  FDSIDSTNEEALRQLAAEADL-PLWIVARTQTKGRGRAGRSWQSPEGNVYATLLLKTAVS 70

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPV--GTDVKIKWPNDILVFQRKIAGILIETLNL-KNG 134
             + T LSF   +A     A+ L       +++KWPND+++ + K+AG L+E+++L +N 
Sbjct: 71  AATATQLSFVAGLAAHDAAAAHLSPNEAARLRLKWPNDLMLGRAKLAGNLLESISLARNR 130

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL----WKKD 190
             AVV+G+G+NV   P DT   V SL      ++       +F  +AR  D+    W + 
Sbjct: 131 GLAVVLGVGMNVAALPDDTGRDVASLGLAPSSVE------AVFASLARAFDIWLARWNEG 184

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I   W   A  + + I++ L+   I GRF GVDD G L L  + G V  +  GDI
Sbjct: 185 RGFPAIREAWLSRALALNETISVNLNNSIIRGRFCGVDDTGALKLTTEAGVVMTVTAGDI 244

Query: 251 F 251
           +
Sbjct: 245 Y 245


>gi|163850503|ref|YP_001638546.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium extorquens
           PA1]
 gi|163662108|gb|ABY29475.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium extorquens
           PA1]
          Length = 279

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 127/272 (46%), Gaps = 22/272 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E  + A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSEGHRLHSHDRLDSTNSEATRLAQGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVIA---------------STLPVG- 103
           S +GNL ASLL+ +  ++ + +  L F   VA+   +                + LP G 
Sbjct: 61  SPEGNLAASLLMPVTGVAPEMVATLGFVAGVALVDALRDACRLALSPHAERGDAPLPQGI 120

Query: 104 ----TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
                 + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLADGQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L       D   +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAF-SAADAPMLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + G F  +D+ G L++    G  R +  G++ 
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEVH 271


>gi|218529200|ref|YP_002420016.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium
           chloromethanicum CM4]
 gi|218521503|gb|ACK82088.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacterium
           chloromethanicum CM4]
          Length = 279

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 128/272 (47%), Gaps = 22/272 (8%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   LS+       R    D + STN E M+ A  G+ G LW+    Q AGRGRR N W 
Sbjct: 1   MQFRLSQAARSDGHRLHSHDRLGSTNSEAMRLAHGGETGPLWVTTQRQEAGRGRRGNAWT 60

Query: 61  SDKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVIA---------------STLPVG- 103
           S +GNL AS+L+ +  ++ + +  L F   VA+   +                + LP G 
Sbjct: 61  SPEGNLAASVLMPVAGVAPEMVATLGFVAGVALVDALRDACRLALSPHAERGDAPLPQGI 120

Query: 104 ----TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
                 + +KWPND+L   +K+AGIL+E   L  G +AVVVG G+NV   P   PYP  +
Sbjct: 121 APSAAAIHLKWPNDVLAGCQKLAGILLEAETLPGGRRAVVVGFGVNVAAAPDGLPYPAAA 180

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L       D   +   L +     + +W K  G   I   W   A G+G  ++++++  +
Sbjct: 181 LAAF-SAADAPMLLEFLSERFVEAVRIWNKGRGFSNIRRRWLERAAGVGAPVSVRMAEVT 239

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + G F  +D+ G L++    G  R +  G++ 
Sbjct: 240 LTGIFETIDEGGRLVILAPDGTRRTVTAGEVH 271


>gi|170742525|ref|YP_001771180.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium sp. 4-46]
 gi|168196799|gb|ACA18746.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium sp. 4-46]
          Length = 264

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 123/257 (47%), Gaps = 7/257 (2%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M  +L        +R E  DT+ ST+ + M RA  G  G LW+ A  QT GRGRR   W 
Sbjct: 1   MAFSLDPAAEAAGYRLEAHDTLGSTSTQAMARAREGAAGPLWVAARRQTEGRGRRGRTWT 60

Query: 61  SDKGNLYASLL--LIDSISKDSLTLLSFAIAVAMR-SVIASTLPV---GTDVKIKWPNDI 114
           S +GNL ASL   +   ++ + +  L+F   +++  +++ +  P       +++KWPND+
Sbjct: 61  SPEGNLAASLYWPVPPGLAPEEVATLAFVAGLSLEGALVLAGGPAREGSPPLRLKWPNDV 120

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS 174
           L    K+AGIL+E  +L  G  A+VVG G+NV   P   PY  TSL   G   + + +  
Sbjct: 121 LAGSAKLAGILLEMESLPRG-AALVVGFGVNVAAAPEGLPYLATSLAAIGRPAEAEGLLR 179

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            L     R L +W +  G   I   W   A G+     ++     + G F  +D  G L+
Sbjct: 180 QLTGTWLRWLRIWDEGRGFPAIREAWLARAAGLEGPALVRAGSERLSGTFETIDSRGRLV 239

Query: 235 LEEKKGCVRQIFTGDIF 251
           L    G  R +  G++ 
Sbjct: 240 LRLPDGARRTVTAGEVH 256


>gi|298291832|ref|YP_003693771.1| biotin/acetyl-CoA-carboxylase ligase [Starkeya novella DSM 506]
 gi|296928343|gb|ADH89152.1| biotin/acetyl-CoA-carboxylase ligase [Starkeya novella DSM 506]
          Length = 251

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 115/236 (48%), Gaps = 7/236 (2%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+I STN E + RA SG     W VA  QT GRGRR   W S+ GNLYASLLL D    
Sbjct: 13  FDSIGSTNAEALARA-SGP-APRWFVAERQTGGRGRRGRPWTSESGNLYASLLLADPGPA 70

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTD---VKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L F  A+A+   + +    G D   + +KWPND+L+   K+AGIL+E   L  G 
Sbjct: 71  ARQAELCFVAALALYDAVRAV--TGIDPLRIGLKWPNDVLIDGAKLAGILLEGAALPGGH 128

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
            A V+G G+N  H P DTPYP T L   G   D   + + L   +   L  W    G   
Sbjct: 129 TATVIGFGVNCAHHPADTPYPCTDLTAAGYPTDPPGLLAALDAAMRARLAEWAGGEGFAR 188

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             + W   A G+G  +T++       G F  +D  G ++L    G    I  GD+F
Sbjct: 189 TRDAWVLRAAGLGKPVTVRFGERQSEGVFEALDFSGAMVLRRPDGVRETISAGDVF 244


>gi|197105253|ref|YP_002130630.1| biotin protein ligase [Phenylobacterium zucineum HLK1]
 gi|196478673|gb|ACG78201.1| biotin protein ligase [Phenylobacterium zucineum HLK1]
          Length = 246

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 117/237 (49%), Gaps = 4/237 (1%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           E ++ + STN E  +RA +G+ G +WI A+ QTAGRGRR   W + KGNL A+LL +  +
Sbjct: 8   EAYEALDSTNAEARRRAEAGEAGPVWITAAVQTAGRGRRGRAWSTRKGNLAATLLTVTDV 67

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  LSF  A+A   +  + L  GT  ++KWPND+L+  RK  GIL+E+    +G  
Sbjct: 68  PAAEAAQLSFVAALAACDLADACLGEGT-ARLKWPNDVLIHGRKAVGILVESGARPDGRL 126

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQR--EGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
            + VGIG+N+ H P D   P  +      G   + +    +L     R    W    G  
Sbjct: 127 WLAVGIGVNLAHAPQDVERPAAAFAEYMAGPPPEPRAALEVLAAAFERWRRTWAAG-GFA 185

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I   W   A G+G+    +L   ++ G    +D  G L L    G + +I  GD+F
Sbjct: 186 PIAQAWTARAMGLGERCEARLPGRTLAGVAEALDSDGALRLRLDDGSLERITAGDVF 242


>gi|218677981|ref|ZP_03525878.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium etli CIAT 894]
          Length = 163

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 98/146 (67%), Gaps = 1/146 (0%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR++     SSTN+EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHDALSETSSTNNECLARARAGDGGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           D    + L+ L  AIAVA+   I   LP+G + +++KWPNDIL+ ++K  GIL+E   L 
Sbjct: 74  DPAPMERLSSLPLAIAVAVHQAIRRVLPLGAEPLEVKWPNDILIGRKKTCGILVEGERLA 133

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVT 158
           +G  A++VGI +NV   P +  YP T
Sbjct: 134 DGRYALIVGICINVSVMPDNPLYPAT 159


>gi|27380014|ref|NP_771543.1| biotin--protein ligase [Bradyrhizobium japonicum USDA 110]
 gi|27353168|dbj|BAC50168.1| birA bifunctional protein [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 83/246 (33%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           ++   F+   STN E ++ A  G+ G +W V S QTAGRGRR   WI+ +GNL AS+L +
Sbjct: 14  YKLAAFERTGSTNTEAIEHARGGEPGPMWFVTSEQTAGRGRRQRAWIAPRGNLAASILEV 73

Query: 74  DSISKDSLTLLSFAIAVAM-----RSVIASTLPVGTD---VKIKWPNDILVFQRKIAGIL 125
            ++       L FA  +A      +  + + L +G       +KWPND+L   +K+ GI 
Sbjct: 74  MTVPPAVAATLGFAAGLAEEAALEKVSLEAALRLGEGRPRYALKWPNDVLADGKKLVGIG 133

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +E   + + L AVVVGIG NV   P  TP P  SL   G  I  +++FS L         
Sbjct: 134 LEAEVIGDRL-AVVVGIGTNVVAAPEGTPTPAVSLAALGVQISAEELFSALSDAWVEFRG 192

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +W    G  EI  LW   A G+G+ + I     ++ G F  +DD G L++    G    +
Sbjct: 193 IWDNGRGFAEIRRLWLERAAGLGERVAINTGTTTLEGIFDTIDDAGCLIVRTADGRRLPV 252

Query: 246 FTGDIF 251
             G++F
Sbjct: 253 AAGEVF 258


>gi|118590023|ref|ZP_01547427.1| birA bifunctional protein [Stappia aggregata IAM 12614]
 gi|118437520|gb|EAV44157.1| birA bifunctional protein [Stappia aggregata IAM 12614]
          Length = 215

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 118/212 (55%), Gaps = 2/212 (0%)

Query: 41  LWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL 100
           +WI A  QT+GRGRR   W S KGNL+ASLLL+D    + +  L  A AVA+   +    
Sbjct: 1   MWIRADEQTSGRGRRGRDWSSPKGNLFASLLLVDPKPAERIGELPLAAAVALAEAVDKAA 60

Query: 101 PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLN-VKHCPVDTPYPVTS 159
                V +KWPND+LV   K++GIL+E   L +G QAVV+G G+N V H P+   Y  T 
Sbjct: 61  GTLQLVSLKWPNDLLVDGSKLSGILLEAETLADGRQAVVLGFGVNCVSHPPLSL-YQATD 119

Query: 160 LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGS 219
           L+  G  +  + +F  L + +A  L  W++  G + I   W   A  +G  IT++ +   
Sbjct: 120 LRSLGYQVTAQRLFECLAEALADNLSRWQQPDGFDGIRRAWLKRAAHLGKTITVRTAQEE 179

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           I G F  +D  G+L+L++  G  R I+ GD+F
Sbjct: 180 ITGTFADLDARGHLVLKQDGGGARTIYAGDVF 211


>gi|154253651|ref|YP_001414475.1| biotin--acetyl-CoA-carboxylase ligase [Parvibaculum lavamentivorans
           DS-1]
 gi|154157601|gb|ABS64818.1| biotin--acetyl-CoA-carboxylase ligase [Parvibaculum lavamentivorans
           DS-1]
          Length = 252

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 120/237 (50%), Gaps = 4/237 (1%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           F  I STN+E  + A +G+ G LW+VA  QTAGRGRR   W+S  GN   +LL       
Sbjct: 10  FAEIDSTNEEARRLAEAGEPGPLWLVAERQTAGRGRRGRNWVSPTGNFMGTLLFRPRCGP 69

Query: 79  DSLTLLSFAIAVAMRSVIASTLP--VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                LSF  AVA+   + S LP  +   +++KWPND+L  + K+AGIL+E+  +     
Sbjct: 70  RQAGELSFVAAVAVHDAVESLLPPHLRAGLRLKWPNDLLHDKAKLAGILLESSGMAGAEV 129

Query: 137 A-VVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           A V +G+G+N+ H P    YP TSL     G +   +    L       L  W+   G  
Sbjct: 130 AWVAIGMGINLAHHPEGLEYPATSLAAMSVGLVTPDEAQQALAASFDSWLTKWRGVQGFA 189

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I   W   A G+G  +T++L+ G+  G F G+   G L L    G +R +  GD+F
Sbjct: 190 VIREAWLKRAQGLGGPVTVRLADGTYDGTFEGLAPDGTLQLRMPDGELRLVAAGDVF 246


>gi|83858400|ref|ZP_00951922.1| biotin protein ligase [Oceanicaulis alexandrii HTCC2633]
 gi|83853223|gb|EAP91075.1| biotin protein ligase [Oceanicaulis alexandrii HTCC2633]
          Length = 249

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 128/234 (54%), Gaps = 2/234 (0%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +++T+ STN+E  ++AL+G  G  WIVA  Q++GRGRR   W S+ GNL+ + L      
Sbjct: 12  YYETLDSTNEEAKRQALAGATGPQWIVARRQSSGRGRRGRPWASETGNLFTTGLYRLDCD 71

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                 LSFA A+A+  V AS +     V++KWPND+LV  RKI+GIL+E+    +G   
Sbjct: 72  PARAAQLSFAAALAVGDVCASVIDP-ERVRLKWPNDVLVGGRKISGILLESGQHAHGGLW 130

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
           + VGIG+N+ H P D+  P T L  +G  I ++     L +     L+ W +D G   I 
Sbjct: 131 LAVGIGINLAHHPEDSERPATDLSAQGADISVETAAKRLSRRFDHWLNRWAQD-GFTPIR 189

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             W     G+G+   ++L + ++ G F  +   G L L+ K G  R I  GD+F
Sbjct: 190 EAWLSRVHGLGERCVVRLDHETLEGVFADLGPDGSLRLDLKDGGRRFISAGDVF 243


>gi|295689610|ref|YP_003593303.1| biotin/acetyl-CoA-carboxylase ligase [Caulobacter segnis ATCC
           21756]
 gi|295431513|gb|ADG10685.1| biotin/acetyl-CoA-carboxylase ligase [Caulobacter segnis ATCC
           21756]
          Length = 251

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 120/235 (51%), Gaps = 4/235 (1%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D I STN E  +RA +G+ G  W+V   QTAGRGRR   W + +GNL A+LL       
Sbjct: 15  LDEIDSTNAEARRRAEAGEAGPFWLVGLRQTAGRGRRGRPWETGEGNLAATLLFRTDKPP 74

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
                +SF  A+A+  ++A  +P  + V +KWPND L+   K++GILIE+     G   +
Sbjct: 75  GEAAQVSFVAALAVADMLARYVPA-SLVSLKWPNDPLLGGLKVSGILIESGASPLGGLWL 133

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQ--REGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
            VGIG+N++  P+D+  P TS+    E       +   +L +   R   +W    G   I
Sbjct: 134 AVGIGVNLRRKPIDSERPGTSIATYSETLPPSPTEAIEVLAEAFERWFGVWST-LGFPAI 192

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            + W   A G+G+    +L   ++ G   G+D  G L L    G +R+I  GD+F
Sbjct: 193 ADAWTALAHGLGEPCVARLGTETVEGIAEGLDADGALRLRLPDGHLRRITAGDVF 247


>gi|23014039|ref|ZP_00053879.1| COG0340: Biotin-(acetyl-CoA carboxylase) ligase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 248

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 133/244 (54%), Gaps = 9/244 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYAS 69
           P  F +   +++ STNDE  +R   G   +L +V A  QT+GRGRR   W S +GNL+AS
Sbjct: 7   PAPFSHLGLNSVGSTNDEVRRRVQDGSAADLLVVTAKRQTSGRGRRGRVWESPEGNLHAS 66

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
             +           + F  A+A+   +   +P G DV++KWPND+LV  RK+AG+L+E++
Sbjct: 67  FAIRVERPLAEAAQIGFVAALALAEALDELVP-GHDVRVKWPNDVLVDGRKVAGMLLESV 125

Query: 130 NLKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
               G   +V+GIG++V  +  P +T Y   +L   G   D   +   L +     LDLW
Sbjct: 126 ----GDGWLVLGIGVDVECRPAPSETLYATIALAELGYGGDSMVVLGALCRHFGPWLDLW 181

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + + G   I   W  +A G+G+   ++L   ++ G F G+D+ G LLL++ +  +R++  
Sbjct: 182 RAE-GFAPIRAGWLQWARGLGEAALVRLEAETLSGVFKGLDEEGGLLLDQGEAGIRRVLA 240

Query: 248 GDIF 251
           GD+F
Sbjct: 241 GDVF 244


>gi|323138159|ref|ZP_08073232.1| biotin/acetyl-CoA-carboxylase ligase [Methylocystis sp. ATCC 49242]
 gi|322396621|gb|EFX99149.1| biotin/acetyl-CoA-carboxylase ligase [Methylocystis sp. ATCC 49242]
          Length = 266

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 119/255 (46%), Gaps = 9/255 (3%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
            +      +  R    D + STN E  +    G+ G LW+VA+ QT GRGR   +W+S  
Sbjct: 2   EIGSTARAHGVRLLALDEVDSTNSEARRLIEGGERGPLWVVAARQTKGRGRMGREWLSPA 61

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           GNL+AS ++ D         L F   VA    + S    G    +KWPND+++   K+ G
Sbjct: 62  GNLHASFIISDFGETLVAPQLGFVAGVAAMRALVSAAGRGR-FGLKWPNDLMLDGAKLGG 120

Query: 124 ILIETLNLKNG------LQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLL 176
           IL+E + +  G          ++GIG+N  + P D PY   +L   G        +F+ L
Sbjct: 121 ILLENVIVPTGDARAPAASVAIIGIGVNCANAPDDLPYEARALAALGAEAPSAATVFAHL 180

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
              +   L++W+   G  ++   W  +A G+G  I + L+  ++ GRF  +D  G L+L 
Sbjct: 181 SDALVETLEIWRGGAGFAQLREEWLTYASGLGADIRVALARETVEGRFETIDSSGRLVLA 240

Query: 237 EKKGCVRQIFTGDIF 251
              G  R +  GD+ 
Sbjct: 241 TSDGA-RVVEAGDVL 254


>gi|86749706|ref|YP_486202.1| biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
 gi|86572734|gb|ABD07291.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodopseudomonas palustris
           HaA2]
          Length = 271

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 118/244 (48%), Gaps = 9/244 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           + FD   STN + M  A +G     W V + QTAGRGRR+  W++ +GNL +S+    ++
Sbjct: 17  KVFDETGSTNADAMAYARAGGRTPCWFVTTMQTAGRGRRNRVWVAPRGNLASSVFESFNV 76

Query: 77  SKDSLTLLSFAIAVAMR---------SVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
           +      L FA  VA+          + + S      D ++KWPNDIL    K+ G+ +E
Sbjct: 77  TPAVAATLGFAAGVALEKALREVSVEAAMRSPNSAANDYRLKWPNDILAGGSKLVGMNLE 136

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
              L +G  AVVVG+G NV   P   P  VT L + G     +D+F+ L      +  +W
Sbjct: 137 AETLPDGRLAVVVGMGTNVVAAPEGLPTAVTCLSQLGVSASAEDVFAALSDSWHEMRGIW 196

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G  +I +LW   A G+G  ++I+     + G F  +D+ G ++L         I  
Sbjct: 197 DDGRGFAKIRDLWLDRAAGLGQTVSIRSGSSVVSGIFDTIDETGCMVLITSDRRRIPIAA 256

Query: 248 GDIF 251
           GD++
Sbjct: 257 GDVY 260


>gi|114569919|ref|YP_756599.1| biotin--acetyl-CoA-carboxylase ligase [Maricaulis maris MCS10]
 gi|114340381|gb|ABI65661.1| biotin--acetyl-CoA-carboxylase ligase [Maricaulis maris MCS10]
          Length = 249

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 116/244 (47%), Gaps = 1/244 (0%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
            Q     R E+ +  SSTN +  +RAL+G+ G LW+ A  QTAGRGRR   W    GNL+
Sbjct: 2   AQTQPQPRIEWIEETSSTNADIRERALAGERGPLWLAARRQTAGRGRRGRVWSGLTGNLF 61

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
            + L            LSFA A+A+ +V  S     +  ++KWPND LV  RK+AGIL+E
Sbjct: 62  TTGLYTLQSDPGRAAELSFAAALAVAAVCDSATRDPSVTRLKWPNDALVHGRKVAGILLE 121

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
           +     G   + VGIG+N+   P D   P TSL R G  +        L     R    W
Sbjct: 122 SGPAPEGGLWLAVGIGINLAAAPDDVERPATSLDRHGATLSPDAALETLVNAFERERQAW 181

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +   G   I + W   A G+G     +L   ++ G F  +   G L L+   G  R I  
Sbjct: 182 QLG-GFGPIRDRWLTRAHGLGQPCEARLEGETVKGVFADLGPDGALRLDLVGGGRRYISA 240

Query: 248 GDIF 251
           GD+F
Sbjct: 241 GDVF 244


>gi|167646780|ref|YP_001684443.1| biotin--acetyl-CoA-carboxylase ligase [Caulobacter sp. K31]
 gi|167349210|gb|ABZ71945.1| biotin--acetyl-CoA-carboxylase ligase [Caulobacter sp. K31]
          Length = 250

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 125/235 (53%), Gaps = 4/235 (1%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D I STN E  +RA +G++G +WIV   QTAGRGRR   W + +GNL A+LL       
Sbjct: 13  LDEIDSTNAEARRRAEAGEVGPIWIVGLRQTAGRGRRGRAWETGEGNLAATLLFSTDKPP 72

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
                +SF  A+A+  ++A+ +P  + V +KWPND L+   K++GIL+E+     G   +
Sbjct: 73  AEAAQVSFVAALAVADLLAAYVPA-SLVSLKWPNDPLLGGLKVSGILVESGMRSTGGLWI 131

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQ--REGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
            VG+G+N+   P+D+  P T++   R+       +   +L    AR  D+W +  G   I
Sbjct: 132 AVGVGVNLARKPIDSERPATAITAYRDAPPPSPIEAIEVLAAAFARWQDVWLR-LGFPAI 190

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            + W   A G+G+    +L   ++ G   G+D  G L L    G +R+I  GD+F
Sbjct: 191 ADAWTARAHGLGEACVARLGTETLEGIAEGLDGDGALRLRLADGQLRRITAGDVF 245


>gi|84686453|ref|ZP_01014347.1| biotin--acetyl-CoA-carboxylase ligase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665636|gb|EAQ12112.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2654]
          Length = 250

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 120/251 (47%), Gaps = 17/251 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P+ + Y     ++ST DE   RA  G++ G  WI A+ QTA RGRR   W +  GN   +
Sbjct: 6   PHGYGYLPLGEVTSTLDEA--RARVGEMSGPTWITATHQTAARGRRGRPWSNPAGNFAGT 63

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L +     S  L SF  A+A+   + +         +KWPND+L+   K+AGIL+E+L
Sbjct: 64  LVLPNLTDPASAALRSFTTALALDEALTTLTGRPEAFALKWPNDVLLNGSKLAGILLESL 123

Query: 130 NLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             +  L  +V+GIG+N+   P           PV+ +   G  +   D    L    AR 
Sbjct: 124 TERGHLTGLVIGIGVNLASAPDPGALEPGALAPVSLMGETGLSVTPDDFLEALAPAFAR- 182

Query: 184 LDLWK---KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
              W+   +  G   I   W   A  IG+ +T +L    I G F  VD+ G+L+L   KG
Sbjct: 183 ---WEAQLRQYGFAPIRTAWLARAARIGETVTARLPGDEITGTFRTVDEAGHLVLSTPKG 239

Query: 241 CVRQIFTGDIF 251
             R I  GD+F
Sbjct: 240 -ERAIAAGDVF 249


>gi|83311872|ref|YP_422136.1| biotin-(acetyl-CoA carboxylase) ligase [Magnetospirillum magneticum
           AMB-1]
 gi|82946713|dbj|BAE51577.1| Biotin-(acetyl-CoA carboxylase) ligase [Magnetospirillum magneticum
           AMB-1]
          Length = 248

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 131/244 (53%), Gaps = 9/244 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYAS 69
           P  F +   D++ STNDE  +R   G   +L +V A  QT+GRGRR   W S +GNL+ S
Sbjct: 7   PAPFSHVELDSVGSTNDEVRRRVEDGSAADLLVVTARRQTSGRGRRGRVWDSPEGNLHVS 66

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
             +           + FA A+A+   +   +P G DV+ KWPND+LV  RK+AG+L+E+ 
Sbjct: 67  FAIRIQRPLSEAAQIGFAAALALAEALDEVVP-GHDVRCKWPNDVLVDGRKVAGMLLES- 124

Query: 130 NLKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
               G   +++GIG++V+    P +  Y   +L   G   D   + + L + +   L+ W
Sbjct: 125 ---AGDGWLILGIGVDVERRPAPAEALYAAVALAELGYGGDSMGVLAALCRHLGPWLERW 181

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           + D G   I   W  +A G+G+   ++L   ++ G F G+D+ G LLL++ +  +R++  
Sbjct: 182 RAD-GFAPIRAGWLEWARGLGEAALVRLEAETLSGVFRGLDEEGGLLLDQGEAGIRRVLA 240

Query: 248 GDIF 251
           GD+F
Sbjct: 241 GDVF 244


>gi|312136343|ref|YP_004003680.1| biotin/acetyl-CoA-carboxylase ligase [Methanothermus fervidus DSM
           2088]
 gi|311224062|gb|ADP76918.1| biotin/acetyl-CoA-carboxylase ligase [Methanothermus fervidus DSM
           2088]
          Length = 318

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 132/241 (54%), Gaps = 16/241 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL---ID 74
           +FD + STN    K A  G+     ++A  QT GRGR + +WIS KG ++ S++L   I 
Sbjct: 78  YFDIVDSTNLTAKKLAEKGEEEGTIVLAQVQTRGRGRENKEWISPKGGIWTSIILKPDIP 137

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +++   +TL++ A+AVA        L    DV IKWPND+L+  +K+ GIL E+ +    
Sbjct: 138 AVNAPQITLMT-AVAVAK---TLKKLFKNLDVGIKWPNDVLIGNKKVCGILTESYSRNES 193

Query: 135 LQAVVVGIGL----NVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKK 189
           L+ V+VG+G+    ++   P++     TS++ E G  + L D+      +  +V + +K 
Sbjct: 194 LEYVIVGVGIDINVDINSFPIELQEGATSIKEELGKEVPLVDVLCEFLYEFEKVYEKFK- 252

Query: 190 DTGR-EEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             G+ +EI+  WR  +  IG  + I+  +G  I G  VGV   G L+LE   G +++IF+
Sbjct: 253 -AGKFQEILKEWRALSKTIGSYVEIRKKFGKRIRGEAVGVTKDGALILELDDGRLKKIFS 311

Query: 248 G 248
           G
Sbjct: 312 G 312


>gi|99080602|ref|YP_612756.1| biotin--acetyl-CoA-carboxylase ligase [Ruegeria sp. TM1040]
 gi|99036882|gb|ABF63494.1| Biotin--acetyl-CoA-carboxylase ligase [Ruegeria sp. TM1040]
          Length = 249

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 124/250 (49%), Gaps = 15/250 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMK--RALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           P  +       + ST DE  +   ALSG     WI+A  QT GRGRR   W   KGN   
Sbjct: 5   PIGYGRRVLAEVDSTLDEAARLAPALSGPE---WILALRQTKGRGRRGRAWTDPKGNFAG 61

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           +L+     + D + L SF  A+A+   + +     T + +KWPND+L+   K+AGIL+E+
Sbjct: 62  TLVYRPEGAPDQIALRSFVAALALYDAVETVTGRTTGLALKWPNDVLLNGGKLAGILLES 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGC-IDLKDIFSLLFQDVA 181
             +K+G+  + +GIG+N+   P+         +PV SLQ E G  +D +   S L    A
Sbjct: 122 SGVKSGVDHLAIGIGVNLAETPMKEWLEPGAVWPV-SLQSETGVRVDPETFLSALALAFA 180

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           R  D +    G   I  LW   A  +G++IT + +     G F  +DD G L+L+  KG 
Sbjct: 181 RYEDQFTT-YGFGPIRELWLSRAAKLGEVITARTAREETSGTFETIDDAGNLVLKTAKGI 239

Query: 242 VRQIFTGDIF 251
           V  I   DIF
Sbjct: 240 V-TIPAADIF 248


>gi|294083725|ref|YP_003550482.1| birA bifunctional protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663297|gb|ADE38398.1| birA bifunctional protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 246

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 120/243 (49%), Gaps = 14/243 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           ++ +   D   S++D   K AL G       +   QTAGRGRR   WIS +G +Y S +L
Sbjct: 6   AWTFSTADVAKSSSDLARKAALDGAPTGTGFLVGTQTAGRGRRGRTWISPQGGMYLSFVL 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                K    LLSF  A+A R  IA  L      K+KWPNDILV  RKI GIL+E +   
Sbjct: 66  RPDYDKHLWPLLSFVAALAARETIAHVL-ASHRPKVKWPNDILVNDRKICGILLEGVE-- 122

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYP----VTSLQREGGCIDLKDIFSLLFQD-VARVLDLW 187
               A++VG G+NV     DT  P     TSL   G  +    + +  + D +AR  +++
Sbjct: 123 ---DALIVGTGINVAPIKADTAMPGHIQPTSLVDLGDNVTTPALLAADYMDNLARRYNMF 179

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            + T    I + W   A  +   +T+  +   + GRF+G+DD G ++L +  G    I T
Sbjct: 180 NQ-TAFAPIRDEWMRHAAFLNQNVTVMDT--GLTGRFIGIDDDGSMMLVDASGKTHHITT 236

Query: 248 GDI 250
           GD+
Sbjct: 237 GDV 239


>gi|304314249|ref|YP_003849396.1| biotin ligase [Methanothermobacter marburgensis str. Marburg]
 gi|302587708|gb|ADL58083.1| predicted biotin ligase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 261

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 128/258 (49%), Gaps = 24/258 (9%)

Query: 8   CQNPYSFRY-----EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           C+     RY     + FD + STN+   + A  G      ++A  Q+ GRGRR   WIS 
Sbjct: 8   CEVEVKTRYIGHEVKCFDEVDSTNNVAKRMAEDGAPEGTVVIARTQSRGRGRRGKPWISP 67

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL--PVGTDVKIKWPNDILVFQRK 120
           +G ++ S++L   +   +  LL+    VA    +A TL    G DV IKWPNDIL+  +K
Sbjct: 68  QGGIWMSIILRPEVHPSTAPLLTLVTGVA----VARTLKEECGLDVGIKWPNDILIGDKK 123

Query: 121 IAGILIETLNLKNGLQAVVVGIGL----NVKHCPVDTPYPVTS----LQREGGCIDLKDI 172
           + GIL E     N L+ VVVG+G+    ++ H P D     TS    LQR+    +L   
Sbjct: 124 VCGILTEAHARFNTLEYVVVGVGIDTNVDISHFPEDLREGATSIKNELQRDIKSSELISR 183

Query: 173 FSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFG 231
           F   F+DV       K D    EI+  WR  +  IG  + I+   G ++ G  +G++  G
Sbjct: 184 FLKNFEDVYDSFKEGKMD----EILREWRRMSKTIGRRVEIRKQLGEVVRGEAIGINSEG 239

Query: 232 YLLLEEKKGCVRQIFTGD 249
            L+LE   G +R++ +G+
Sbjct: 240 ALILELDDGTLRKVISGE 257


>gi|269792423|ref|YP_003317327.1| biotin/acetyl-CoA-carboxylase ligase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100058|gb|ACZ19045.1| biotin/acetyl-CoA-carboxylase ligase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 336

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 121/243 (49%), Gaps = 8/243 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P       F+ I ST +     A  G    +  VA  QT GRGRRD +W S +G LYAS+
Sbjct: 87  PLGHPILHFERIESTQNPVKDLAQKGHPEGVTAVADRQTMGRGRRDRRWESPEGGLYASV 146

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL   I    + +++ A A+AM   I +    G  V IKWPND+LV  RK+ G+L E   
Sbjct: 147 LLRPPILPGHVQMVNLACAMAMGDAIEAR--CGIKVDIKWPNDLLVGGRKLCGMLSEGAV 204

Query: 131 LKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLW 187
             + +  +V GIG+N+K  P   D+P  VTS+  EGG  +   D+ +   + +   + + 
Sbjct: 205 EADRVHHIVAGIGVNIKGSPTIQDSPQDVTSIAEEGGTLVARHDLLAFFLRSLKHHIGIL 264

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +D  R+  +N +R     +G  I +    G++ G    V+D G LL+    G +R    
Sbjct: 265 CED--RKAFINSYRGRCSTLGRRIVVSSDSGTLEGVAEDVEDEGSLLIRTSTGLLR-FSA 321

Query: 248 GDI 250
           GD+
Sbjct: 322 GDV 324


>gi|260434161|ref|ZP_05788132.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417989|gb|EEX11248.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 249

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +       + ST +E  + A +   G +WI+A  QTA RGRR   W + KGNL A+L
Sbjct: 5   PQGYGLHILQEVDSTLNEAARIAPTA-AGPVWIMAHHQTAARGRRGRVWANPKGNLAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           L+    + +   L SF  A+A+   + S       + +KWPND+L+   K+AGIL+E+  
Sbjct: 64  LMRPEGNPEQAALRSFVAALALFDAVVSVTGRAAGLSLKWPNDVLLNGGKLAGILLESTG 123

Query: 131 LKNGLQAVVVGIGLNVKHCPV-DT--P---YPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              G+  + +GIG+N+   P  DT  P    PV+ L   G  ++ +D  + L    AR  
Sbjct: 124 QGRGVSHLAIGIGVNLADAPAPDTVEPGALRPVSLLSETGAQVEAEDFLTELAAAYAR-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +      G E I   W   A  +G++IT + +    +G F  VD  G L+L   KG V  
Sbjct: 183 EAQFTTYGFEPIRTAWLSRAAKLGEVITARTATSESVGTFETVDAGGNLVLNTAKGRV-S 241

Query: 245 IFTGDIF 251
           I   D++
Sbjct: 242 IPAADVY 248


>gi|315499804|ref|YP_004088607.1| biotin/acetyl-CoA-carboxylase ligase [Asticcacaulis excentricus CB
           48]
 gi|315417816|gb|ADU14456.1| biotin/acetyl-CoA-carboxylase ligase [Asticcacaulis excentricus CB
           48]
          Length = 242

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 114/235 (48%), Gaps = 3/235 (1%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           + FD++ ST  E + R  +GD G  W+ A  QTAG+GR   +W    GNL AS   +  +
Sbjct: 5   DVFDSLPSTQTEALSRLRAGDRGPRWVRAQRQTAGQGRMGRQWDGPSGNLMASWYGVLPV 64

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               +T LSF  A+A+   I   L     +KIKWPND+L   RK+ GIL ++  L+ GL 
Sbjct: 65  EMRRVTQLSFVAALAVTDAIRPVLSAPDPLKIKWPNDVLYEGRKLCGILAQSETLETGL- 123

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
            VV+GIG+N+   P    Y   +L         ++ +   L   + R LD W    G E 
Sbjct: 124 GVVIGIGINIAKAPQGLSYGTAALNDLTAQPQTVEVVLDALDAALTRRLDDWLTH-GFEA 182

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               W   A G   L  I+    +  G  +G+DD+G L + +  G +  I +G +
Sbjct: 183 TAAQWWDQAYGRDQLCLIEQHSQARTGTILGLDDYGALRVRDPDGTIHVIASGSV 237


>gi|300023439|ref|YP_003756050.1| biotin/acetyl-CoA-carboxylase ligase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525260|gb|ADJ23729.1| biotin/acetyl-CoA-carboxylase ligase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 258

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 117/240 (48%), Gaps = 6/240 (2%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R    D   STN + M+ AL G+   LW++A  QTAGRGR    W+S +GNLY S+    
Sbjct: 9   RILHIDETQSTNADAMRLALKGEALPLWVIARRQTAGRGRAGRSWVSPEGNLYTSIAFCC 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNLK 132
           S   +    LS    +++   I ++  +  D  +++KWPNDIL+   K+ GIL+E+   +
Sbjct: 69  SAPMEKAGQLSLIAGISLFEAIRASTDLAQDAPLRLKWPNDILMGTAKMGGILVESTTAR 128

Query: 133 N--GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
              G  A VVG GLN+   P D     T+L +         +   L     + LD+WK  
Sbjct: 129 GSPGFLA-VVGFGLNLASYPDDLGRAATALSQHAQAPVAATLLDALAGQFPQWLDVWKDG 187

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                +   W   A  IG+ I++    G I G + G+ D G  LL E  G +R+I  GD+
Sbjct: 188 DDFAAVRRAWMERAGPIGEAISVNSIDGPIRGTYRGLADNGA-LLAEVGGELREINHGDV 246


>gi|259418714|ref|ZP_05742631.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter sp. TrichCH4B]
 gi|259344936|gb|EEW56790.1| biotin-(acetyl-CoA-carboxylase) ligase [Silicibacter sp. TrichCH4B]
          Length = 249

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 123/248 (49%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +       + ST DE  + A S   G  WI+A  QT GRGRR   W   KGN   +L
Sbjct: 5   PIGYGRRVLAEVDSTLDEAARLAPS-LTGPEWILALRQTKGRGRRGRAWTDPKGNFAGTL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +     + D + L SF  A+A+   + +     + + +KWPND+L+   K+AGIL+E+  
Sbjct: 64  VYRPKGTPDQIALRSFIAALALYDAVETVTGRTSGLALKWPNDVLLNGGKLAGILLESAG 123

Query: 131 LKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGC-IDLKDIFSLLFQDVARV 183
           +K+G+  + +GIG+N+   P+         +PV SLQ E G  +D +   S L    AR 
Sbjct: 124 VKSGVDHLSIGIGVNLAETPMKEWLEPGAVWPV-SLQSETGVRVDPETFLSALALAFARH 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            D +    G   I  LW   A  +G++IT + +     G F  +DD G L+L+  KG V 
Sbjct: 183 EDQFTT-YGFAPIRELWLSRAAKLGEVITARTAREETSGTFETIDDAGNLVLKTAKGKV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|114798329|ref|YP_760463.1| biotin--acetyl-CoA-carboxylase ligase [Hyphomonas neptunium ATCC
           15444]
 gi|114738503|gb|ABI76628.1| biotin--acetyl-CoA-carboxylase ligase [Hyphomonas neptunium ATCC
           15444]
          Length = 255

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 116/233 (49%), Gaps = 5/233 (2%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           F+ I STN E  +RA  G   N WIVAS QTAGRGR+D  W S  GN++ + L  +    
Sbjct: 21  FEEIDSTNTEAKRRAAEGSFNNQWIVASTQTAGRGRQDRAWSSPVGNIFTTALFAEPGGI 80

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
                + FA A+A+   + S  P    V++KWPND+ V  +K++GIL+ET    + L  +
Sbjct: 81  SVALRVPFAAALAVVDTVLSVAPAAP-VRVKWPNDVRVDHQKVSGILVETGGAGDRLW-I 138

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
             G G+NV + P +     TSL R     +DLK++  L F   A    L +     + + 
Sbjct: 139 AAGTGINVAYAPDNVGQGATSLNRLSAQVLDLKEV--LDFYHSAFEARLAQAKVTFDGVR 196

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             W  +A G  + +++++      G F  ++  G L L    G  R I  G++
Sbjct: 197 KDWLKYAEGRNEKVSVRVGDTYEEGVFEDLEQDGALRLRLPDGSARIIRAGEV 249


>gi|330994067|ref|ZP_08317997.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Gluconacetobacter sp.
           SXCC-1]
 gi|329759013|gb|EGG75527.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Gluconacetobacter sp.
           SXCC-1]
          Length = 263

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 122/247 (49%), Gaps = 16/247 (6%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           ++R E  D + ST+D C  R  +G   N L I+A  QTAGRG R  +W+   GNL  S++
Sbjct: 20  AWRMEVHDRLGSTSDTCKARLDAGQGENGLAILALSQTAGRGSRGREWVDPGGNLALSVM 79

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L+   +   + L  F   +A+   +   LP    + +KWPND+L+  RK+AGILIET   
Sbjct: 80  LVGPGAAVPVGLWPFIAGLALHDAMGDFLPDTRALALKWPNDLLLAGRKMAGILIETGTR 139

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCID--LKDIFS--LLFQDVARVLDLW 187
             G Q  V+G+G N++H P           RE  C+   + D+ +  ++ + V R LD W
Sbjct: 140 VTGEQWQVIGMGANLRHAPAIA-------GRELACLADMIPDVPAAPVVARAVLRHLDRW 192

Query: 188 ---KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                  G   +   W      +G  + +K       G F G+ D G LLL+   G +R+
Sbjct: 193 LGCHATHGFGAVRAAWLERGHPVGTGVNVKAGNQQFTGTFAGLADDGTLLLQTAHG-LRR 251

Query: 245 IFTGDIF 251
           + TG++ 
Sbjct: 252 VVTGEVI 258


>gi|15679898|ref|NP_277016.1| biotin acetyl-CoA carboxylase ligase / biotin operon repressor
           bifunctional protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2623050|gb|AAB86376.1| biotin acetyl-CoA carboxylase ligase/biotin operon repressor
           [Methanothermobacter thermautotrophicus str. Delta H]
          Length = 261

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 129/262 (49%), Gaps = 18/262 (6%)

Query: 1   MFSNLSECQNPYSFRY-----EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRR 55
           M  +   C+      Y     + FD + STN+   + A  G      ++A  Q+ GRGRR
Sbjct: 1   MVEDYDPCEVEVDTEYIGHEIKCFDEVDSTNNVAKRMAEDGATEGTVVIAKTQSRGRGRR 60

Query: 56  DNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL--PVGTDVKIKWPND 113
              WIS +G ++ S++L   +      LL+    VA    +A TL    G DV IKWPND
Sbjct: 61  GKPWISPQGGIWMSIILRPEVHPSRAPLLTLVAGVA----VARTLRDECGLDVGIKWPND 116

Query: 114 ILVFQRKIAGILIETLNLKNGLQAVVVGIGL----NVKHCPVDTPYPVTSLQRE-GGCID 168
           IL+  +K+ GIL E     N L+ VVVG+G+    ++ H P D     TS++ E    I 
Sbjct: 117 ILIGDKKVCGILTEAHARFNTLEYVVVGVGIDTNVDISHFPDDLREGATSIKNELKRDIK 176

Query: 169 LKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGV 227
             ++ +   ++     + + KD   +EI+  WR  +  IG  + I+   G I+ G  VG+
Sbjct: 177 SSELIARFLRNFEETYNSF-KDGKMDEILTEWRKLSKTIGRRVEIRKQLGEIVHGDAVGI 235

Query: 228 DDFGYLLLEEKKGCVRQIFTGD 249
           +  G L+LE   G +R++ +G+
Sbjct: 236 NSEGALILELDDGTLRKVISGE 257


>gi|326403100|ref|YP_004283181.1| biotin--[acetyl-CoA-carboxylase] synthetase [Acidiphilium
           multivorum AIU301]
 gi|325049961|dbj|BAJ80299.1| biotin--[acetyl-CoA-carboxylase] synthetase [Acidiphilium
           multivorum AIU301]
          Length = 242

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 114/229 (49%), Gaps = 12/229 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E +DT+ ST+D C +RA  G+   L +VA+ QTAGRGR    W S  GN   S LL
Sbjct: 7   PWRIEHYDTLGSTSDFCARRAAEGEPERLMVVAARQTAGRGRAGRAWESPAGNFCGSALL 66

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +        +    +A+  V+   LP    V +KWPND++    K+AGIL++   ++
Sbjct: 67  RPRVPAGQGGWFALLAGLALIEVLDPALPAPGAVMLKWPNDLMAGAAKLAGILLDA-TIE 125

Query: 133 NGL-QAVVVGIGLNVKHCPVDTPYP---VTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           NG+  A++VG+G+N+   P   P P    TSL   GG +  + +       +   LD+  
Sbjct: 126 NGMITAMIVGVGVNLAEAP---PVPGRVTTSLAALGGAMTPEALAPAFCARLDHWLDVLA 182

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
             +G   +   W C A   G  IT+    G   G + G+DD G LLL E
Sbjct: 183 --SGAAPLRAAWMCRAHPEGTAITVD--GGRRSGIYAGLDDDGALLLRE 227


>gi|86137579|ref|ZP_01056156.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. MED193]
 gi|85825914|gb|EAQ46112.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. MED193]
          Length = 249

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 119/248 (47%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +     D + ST DE  +  ++ DL G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 5   PEGYGKRILDAVDSTLDEAAR--IASDLSGPEWILAKRQTKGRGRRGRDWKEPKGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++  +     + L SF  A+A+     +     + + +KWPND+L+   K+AGIL+E+ 
Sbjct: 63  LVMRPTEPPQVVALRSFLAALALYDACEALTGRTSGLALKWPNDVLLNGGKLAGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + +GIG+N+   P+         +PV+ L   G  +  +D  + L    AR 
Sbjct: 123 GAAQGVTHLAIGIGVNLVETPMKEWLEPGAVWPVSLLSETGVQVTPEDFLTALAAAYAR- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +L     G E I   W   A  +G++IT + +     G F  VD  G L+L   KG V 
Sbjct: 182 YELQFTTYGFEPIRTAWLARAAKLGEVITARTTNSETTGTFETVDAEGNLVLNSAKGRV- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|119384962|ref|YP_916018.1| biotin--acetyl-CoA-carboxylase ligase [Paracoccus denitrificans
           PD1222]
 gi|119374729|gb|ABL70322.1| biotin--acetyl-CoA-carboxylase ligase [Paracoccus denitrificans
           PD1222]
          Length = 252

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 114/246 (46%), Gaps = 16/246 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P            STN E +K A  G  G+ W++A  Q AGRGRR  +W+   GN   +L
Sbjct: 6   PEGVARHVLARTDSTNAEALKLA-PGLSGSAWVLAREQFAGRGRRGREWVMPAGNFAGTL 64

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L       +   LSF  A+A+   +         + IKWPND+L+   K+AGIL+E+  
Sbjct: 65  VLRPQGGALAAAQLSFVAALALYDALGLACGPAARLAIKWPNDVLLNGGKVAGILLESSG 124

Query: 131 LKNGLQAVVVGIGLNVKHCP-----VDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVL 184
              G+QAV VGIG+N+   P          P  S+Q E G  +D ++   LL    AR  
Sbjct: 125 SGPGVQAVAVGIGVNLAAAPDAGAVEPGATPPVSVQGETGHAVDPEEFLDLLAPAFAR-- 182

Query: 185 DLWKK--DT-GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
             W+   DT G   I N W   A  +G+ I  +       G F G+DD G L+L    G 
Sbjct: 183 --WQAQLDTYGFAPIRNAWLARAARLGEPIIARTGTAESHGIFEGIDDSGALILRGPAG- 239

Query: 242 VRQIFT 247
            RQ+  
Sbjct: 240 -RQVIP 244


>gi|260426575|ref|ZP_05780554.1| biotin-(acetyl-CoA-carboxylase) ligase [Citreicella sp. SE45]
 gi|260421067|gb|EEX14318.1| biotin-(acetyl-CoA-carboxylase) ligase [Citreicella sp. SE45]
          Length = 248

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 119/248 (47%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +       + STN E  +  L+G L G  WI+A  QTA RGRR   W++ KGN   +
Sbjct: 4   PAGYGRRVLAEVDSTNAEAAR--LAGTLAGPEWILALRQTAARGRRGRPWVNPKGNFAGT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LL++   + D + L SF  ++A+    A+       + +KWPND+L+   K+AGIL+E+L
Sbjct: 62  LLMMPRETPDVVALRSFVASLALYDAFAAATGRVEGLALKWPNDVLLNGGKVAGILLESL 121

Query: 130 NLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             + G+  + +GIG+N+   P           PV+ L   G  ID +    LL    A  
Sbjct: 122 GQRRGVAHLAIGIGVNLAEAPDAGEVEPGALRPVSLLSESGVLIDPESFLDLLATSYAE- 180

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +      G   +   W   A  +G++IT +      +G F  VD+ G L+L   +G  +
Sbjct: 181 HEARFATYGFGPLREAWLARAARLGEVITARSGTAETVGTFETVDERGNLIL-TTRGGRQ 239

Query: 244 QIFTGDIF 251
            I   D+F
Sbjct: 240 AIAAADVF 247


>gi|16126179|ref|NP_420743.1| biotin protein ligase [Caulobacter crescentus CB15]
 gi|221234951|ref|YP_002517387.1| biotin operon repressor/biotin--(acetyl-CoA-carboxylase) synthetase
           [Caulobacter crescentus NA1000]
 gi|13423393|gb|AAK23911.1| biotin protein ligase [Caulobacter crescentus CB15]
 gi|220964123|gb|ACL95479.1| biotin operon repressor/biotin--(acetyl-CoA-carboxylase) synthetase
           [Caulobacter crescentus NA1000]
          Length = 250

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 120/237 (50%), Gaps = 9/237 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D I STN E  +RA +G +  LW+V   QTAGRGRR   W + +GNL A+LL       
Sbjct: 15  LDEIDSTNAEARRRAEAGAVEPLWLVGLRQTAGRGRRGRAWETGEGNLAATLLFRTERPP 74

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
                +SF  A+A+  ++A  +P    + +KWPND L+   K++GIL+E+     G   +
Sbjct: 75  AEAAQVSFVAALAVADLLARYVPSHL-ISLKWPNDPLLGGLKVSGILVESGASPFGGLWL 133

Query: 139 VVGIGLNVKHCPVDTPYPVTS----LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
            VGIG+N+K  P+D   P T+    L+      +  ++ +  F+   R  D+     G  
Sbjct: 134 AVGIGVNLKRKPIDAERPATAIATYLEAPPSPQEAAEVLAEAFERWLRTWDI----LGFR 189

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I + W   A G+G+    +L + ++ G    +D  G L L    G +R+I  GD+F
Sbjct: 190 AIADAWTARAHGLGEPCVARLGHETVEGVAEALDADGALRLRLADGSLRRITAGDVF 246


>gi|144900800|emb|CAM77664.1| Biotin-(acetyl-CoA carboxylase) ligase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 248

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 127/245 (51%), Gaps = 12/245 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYAS 69
           P  F     D++ STNDE  + A SG   +  +V A  Q+AGRGRR   W+S  GNL+ S
Sbjct: 7   PAPFGLISLDSVGSTNDEARRLAQSGAAADFLVVSAESQSAGRGRRGRAWVSPAGNLHFS 66

Query: 70  LLL-IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           LL+ I S+S  S   L FA A A+ S +++ LP G   + KWPND++   RK AG+L+E+
Sbjct: 67  LLIRIQSLS--SAAQLGFAAAAALVSALSTLLPQG-QFQAKWPNDVMAAGRKCAGMLLES 123

Query: 129 LNLKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                G   +V+GIG+NV     PV   +P  +L   G      D+ +    D   ++  
Sbjct: 124 ----AGTDWLVLGIGVNVVAAPPPVGLNHPACALADLGFSGTADDVLAAFCTDFLPLVQA 179

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W+   G   +   W   A G+G    ++L   +  G F G+D+ G LLL++     R+I 
Sbjct: 180 WRGQ-GFAPVRQAWLNCARGLGQPTVVRLETDTQTGIFAGLDEEGALLLDQGASGFRRIL 238

Query: 247 TGDIF 251
            GD+F
Sbjct: 239 AGDVF 243


>gi|231637|sp|P29906|BIRA_PARDE RecName: Full=Biotin--[acetyl-CoA-carboxylase] synthetase; AltName:
           Full=Biotin--protein ligase
 gi|150617|gb|AAA25601.1| biotin [acetyl-CoA carboxylase] ligase [Paracoccus denitrificans]
          Length = 240

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 113/233 (48%), Gaps = 16/233 (6%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN E +K A  G  G+ W++A  Q AGRGRR  +W+   GN   +L+L       +   
Sbjct: 7   STNAEALKLA-PGLSGSAWVLAREQFAGRGRRGREWVMPAGNFAGTLVLRPQGGALAAAQ 65

Query: 84  LSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIG 143
           LSF  A+A+   +         + IKWPND+L+   K+AGIL+E+     G+QAV VGIG
Sbjct: 66  LSFVAALALYDALGLACGPAARLAIKWPNDVLLNGGKVAGILLESSGSGPGVQAVAVGIG 125

Query: 144 LNVKHCP-----VDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKK--DT-GRE 194
           +N+   P          P  S+Q E G  +D ++   LL    AR    W+   DT G  
Sbjct: 126 VNLAGAPDAGAVEPGATPPVSVQGETGHAVDPEEFLDLLAPAFAR----WQAQLDTYGFA 181

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            I N W   A  +G+ I  +       G F G+DD G L+L    G  RQ+  
Sbjct: 182 PIRNAWLARAARLGEPIIARTGTAESHGIFEGIDDSGALILRGPAG--RQVIP 232


>gi|209964536|ref|YP_002297451.1| biotin-[acetyl-CoA-carboxylase] ligase, birA [Rhodospirillum
           centenum SW]
 gi|209958002|gb|ACI98638.1| biotin-[acetyl-CoA-carboxylase] ligase, birA [Rhodospirillum
           centenum SW]
          Length = 257

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 124/243 (51%), Gaps = 6/243 (2%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +R    +   STNDE    A +G      + A  Q AGRGRR   W S +GNLY SL
Sbjct: 17  PPWYRLVQLEVCGSTNDEAKALAQAGAPEGTLVRARRQEAGRGRRGRGWSSPEGNLYTSL 76

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L   +       +SF  A+A+   ++  +P     ++KWPND+LV   KIAGIL+E+  
Sbjct: 77  VLRPGVPPVVAAQVSFVAALAVGQTVSDLVP--GLARLKWPNDVLVDGAKIAGILLESEP 134

Query: 131 LKNG-LQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWK 188
             +G +  +VVG+G+NV H P    YP  SL   G    D  D+ +          + W+
Sbjct: 135 AADGRVDWLVVGVGINVLHHPDAPGYPSCSLLSRGAVSPDPADVLARYAGHFQSWYNRWR 194

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   +   W   A G+G  +T++L+  S  GRFV +DD G L++E  +G  R++  G
Sbjct: 195 AQ-GFAPVRAAWLNAAHGLGGPLTVRLAGESFAGRFVDLDDDGGLIVETTEGR-RRVTAG 252

Query: 249 DIF 251
           D+F
Sbjct: 253 DVF 255


>gi|89053688|ref|YP_509139.1| biotin--acetyl-CoA-carboxylase ligase [Jannaschia sp. CCS1]
 gi|88863237|gb|ABD54114.1| Biotin--acetyl-CoA-carboxylase ligase [Jannaschia sp. CCS1]
          Length = 251

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 118/238 (49%), Gaps = 16/238 (6%)

Query: 24  STNDECM---KRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           +T D  M    RA     G  W++A  QTA RGRR   W+   GN  ASL L  S     
Sbjct: 19  ATTDSTMLEAARAAPTLTGPEWVLALHQTAARGRRGRAWVMPSGNFAASLTLQPSGPLAQ 78

Query: 81  LTLLSFAIAVAMR-SVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL-NLKNGLQAV 138
           + L SFA A A+R ++IA   P G DV +KWPND+L+   K+AGIL+E++ + + G+  +
Sbjct: 79  IALRSFAAATALRDALIAVGCPPG-DVSLKWPNDVLLRGGKVAGILLESIGDGRGGVSHL 137

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK-----DIFSLLFQDVARVLDLWKKDTGR 193
           ++GIG+N+ H P  +     ++      +D+      D  +  F      L  +  D  R
Sbjct: 138 IIGIGVNLAHAPDPSEVEARAVTPVALGLDVTPEDFLDALAPAFASREYSLATYGFDPTR 197

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            E    W   A  + ++IT +L    I G F  +D+ G L+LE   G  R I   DI+
Sbjct: 198 TE----WLAHAARLEEVITARLPGEEITGTFRTIDETGNLILETAHGP-RAIAAADIY 250


>gi|228938748|ref|ZP_04101351.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971630|ref|ZP_04132252.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978239|ref|ZP_04138616.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           Bt407]
 gi|228781256|gb|EEM29457.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           Bt407]
 gi|228788043|gb|EEM36000.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228820923|gb|EEM66945.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 290

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G DV IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVDVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + K+ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLKN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|326939254|gb|AEA15150.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 326

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G DV IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVDVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + K+ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLKN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|326333790|ref|ZP_08200023.1| biotin-[acetyl-CoA-carboxylase] ligase [Nocardioidaceae bacterium
           Broad-1]
 gi|325948372|gb|EGD40479.1| biotin-[acetyl-CoA-carboxylase] ligase [Nocardioidaceae bacterium
           Broad-1]
          Length = 262

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 119/248 (47%), Gaps = 15/248 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P  +R E  D   STN E   RA SG+   L I    QTAGRGR D  W +  +  L  S
Sbjct: 15  PGGWRVEILDETPSTNAELAARARSGEASGLVITTEHQTAGRGRLDRGWTTPARSALTVS 74

Query: 70  LLLID--SISKDSLTLLSFAIAVAMRSVIASTL-PVGTDVKIKWPNDILVFQRKIAGILI 126
           +LL    SIS +    L     VA    +ASTL   G    +KWPND+L+  RK+ GILI
Sbjct: 75  VLLRPSASISVERWPWLPLMTGVA----VASTLRKKGYAAGLKWPNDVLIEGRKVCGILI 130

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTP-YPVTSLQREGGC-IDLKDIFSLLFQDVARVL 184
           E +    G  A V+G GLN      + P    TSL+ E G  +D  ++   L  ++    
Sbjct: 131 ERIEAPEG-AAAVIGFGLNTSQTREELPIEAATSLELESGAPVDRTEMLVALLAELGAAY 189

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVR 243
           ++W  D    E+   +R  +  +G+ +  +L  G +  G    +DDFG L++   +G  R
Sbjct: 190 EIWGSDPA--ELARRYRELSVTVGEQVRAELPGGDVWEGVATEIDDFGRLVIATDEGS-R 246

Query: 244 QIFTGDIF 251
            +  GD+ 
Sbjct: 247 VVGAGDVI 254


>gi|58038571|ref|YP_190535.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Gluconobacter oxydans 621H]
 gi|58000985|gb|AAW59879.1| Biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Gluconobacter oxydans 621H]
          Length = 243

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 115/242 (47%), Gaps = 5/242 (2%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           S+R+E+ +T+ ST+D C  RA +G+  +L + A  QT+GRG R   W    GNL  SLL 
Sbjct: 2   SWRFEYHETLGSTSDLCKARAEAGEPEHLAVQAFSQTSGRGTRGRTWTDPGGNLAISLLF 61

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVK---IKWPNDILVFQRKIAGILIETL 129
             +     +  L F +AVA+        PV T      +KWPND+L+  RK+AG+LIET 
Sbjct: 62  RPADPAAFIAALPFVVAVALFETAIHFCPVVTGPSRFMLKWPNDLLMDGRKMAGVLIET- 120

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
               G   VVVGIG N++  P      + +L         +    +L   +     L ++
Sbjct: 121 GGPQGNPWVVVGIGANLRQAPEIPGRRLAALSEVTDPPSAEAFGKVLVAQIEHWTALRER 180

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           + G   +   W   A  +G  + ++     I G F G+D  G LLL    G    + TGD
Sbjct: 181 E-GFAPVRAAWLARAHPVGTPLAVQRCETYITGSFSGLDAQGRLLLALPHGETIPVVTGD 239

Query: 250 IF 251
           I 
Sbjct: 240 IL 241


>gi|238650233|ref|YP_002916084.1| biotin--protein ligase [Rickettsia peacockii str. Rustic]
 gi|238624331|gb|ACR47037.1| biotin--protein ligase [Rickettsia peacockii str. Rustic]
          Length = 270

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 127/257 (49%), Gaps = 21/257 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD + STN E MK A +  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPV----------GTDVK-------IKWPNDIL 115
                 + L  LSF  A+++   I S              G D++       +KWPND+L
Sbjct: 66  KPDKELELLPQLSFVTALSVYDSITSLCHSHSSLCHSRFRGNDIRNENNIIQLKWPNDVL 125

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFS 174
           +  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    ++ + +  
Sbjct: 126 INSRKIAGILLESVKVENNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPMEPQALLE 184

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           +L ++      +W  + G   I   W  +A  + + I++K     + G F  +D+ G ++
Sbjct: 185 ILIENFEEYYQIW-HNNGFPFIRKKWLEYAYKLYENISVKYQNDIVTGLFKDIDNTGRII 243

Query: 235 LEEKKGCVRQIFTGDIF 251
           L+     +    T ++F
Sbjct: 244 LQLPSKKIISFSTAELF 260


>gi|170748463|ref|YP_001754723.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654985|gb|ACB24040.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 267

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 118/261 (45%), Gaps = 12/261 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M   L         R    DT+ STN E M RA +G+ G LW+V   Q  GRGRR N W 
Sbjct: 1   MSYRLGPSARAEGHRLHVHDTLGSTNTEAMARARAGETGPLWVVTHRQETGRGRRGNSWA 60

Query: 61  SDKGNLYASLL-LIDSISKDSLTLLSFAIAVAMRSVIAS---TLP-VGTDV-----KIKW 110
           S  GNL AS+L  +  ++ D L  L F   +A+   + +   TLP  G+       ++KW
Sbjct: 61  SLPGNLAASVLWPVAGVAPDHLAELGFVAGLALIEALEAACGTLPDTGSGAGARSFRLKW 120

Query: 111 PNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK 170
           PND+L+   K+AG+L+E   L  G +A V+G G+NV   P        +        D +
Sbjct: 121 PNDVLLGGAKLAGLLLEAETLPGGRRAAVIGFGVNVAAAPDGLEAASLAAAGY--ARDAE 178

Query: 171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDF 230
            +   L   +A     W +     ++   W   A G+G  I +     ++ G F  +D+ 
Sbjct: 179 ALLEHLSDRMAARARAWDRGRNFADLRAAWLARAAGLGSEIAVHSGGHTLRGVFETIDEG 238

Query: 231 GYLLLEEKKGCVRQIFTGDIF 251
           G L++    G    +  G++ 
Sbjct: 239 GRLVILAPDGNRHTVTAGEVH 259


>gi|15892696|ref|NP_360410.1| biotin--protein ligase [Rickettsia conorii str. Malish 7]
 gi|34580409|ref|ZP_00141889.1| biotin-protein ligase [Rickettsia sibirica 246]
 gi|15619869|gb|AAL03311.1| biotin-protein ligase [Rickettsia conorii str. Malish 7]
 gi|28261794|gb|EAA25298.1| biotin-protein ligase [Rickettsia sibirica 246]
          Length = 270

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 127/257 (49%), Gaps = 21/257 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD + STN E MK A +  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAM----------RSVIASTLPVGTDVK-------IKWPNDIL 115
                 + L  LSF  A+++           S +  +   G D++       +KWPND+L
Sbjct: 66  KPDKELELLPQLSFVTALSVYDSITSLCHSHSALCHSRFRGNDIRNENNIIQLKWPNDVL 125

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFS 174
           +  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+ + +  
Sbjct: 126 INSRKIAGILLESVKVENNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPIEPQALLE 184

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           +L ++      +W  + G   I   W   A  + + I++K     + G F  +D+ G ++
Sbjct: 185 ILIENFEEYYQIW-HNNGFPFIRKKWLEHAYKLYENISVKYQNDIVTGLFKDIDNTGRII 243

Query: 235 LEEKKGCVRQIFTGDIF 251
           L+     +    T ++F
Sbjct: 244 LQLPSKKIISFSTAELF 260


>gi|165933273|ref|YP_001650062.1| biotin operon repressor [Rickettsia rickettsii str. Iowa]
 gi|165908360|gb|ABY72656.1| biotin operon repressor [Rickettsia rickettsii str. Iowa]
          Length = 266

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 123/243 (50%), Gaps = 21/243 (8%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           +F+   FD + STN E MK A +  +  N  ++A  QT GRGR    W S  GNL+ SLL
Sbjct: 5   TFKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLL 64

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIAS----------TLPVGTDVK-------IKWPNDI 114
           +      + +  LSF  A+++   I S          +   G D++       +KWPND+
Sbjct: 65  IKPDKELELVPQLSFVTALSVYDSITSLCHSYSSLCHSRESGNDIRNENNIIQLKWPNDV 124

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIF 173
           L+  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+ + + 
Sbjct: 125 LINSRKIAGILLESVKVENNY-YLIIGIGINISYHPDNIDQPTTSLISENLPPIEPQALL 183

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            +L ++      +W  + G   I   W   A  + + I++K     + G F  +D+ G +
Sbjct: 184 EILIENFEEYYQIW-HNNGFPFIRKKWLEHAYKLYENISVKYQNDIVTGLFKDIDNTGRI 242

Query: 234 LLE 236
           +L+
Sbjct: 243 ILQ 245


>gi|228907269|ref|ZP_04071129.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 200]
 gi|228852409|gb|EEM97203.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 200]
          Length = 290

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 120/239 (50%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++  VI     VG  V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQVIEKCTGVG--VGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSGIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|229586774|ref|YP_002845275.1| Biotin-(acetyl-CoA carboxylase) ligase [Rickettsia africae ESF-5]
 gi|228021824|gb|ACP53532.1| Biotin-(acetyl-CoA carboxylase) ligase [Rickettsia africae ESF-5]
          Length = 270

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 127/257 (49%), Gaps = 21/257 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD + STN E MK A +  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAM----------RSVIASTLPVGTDVK-------IKWPNDIL 115
                 + L  LSF  A+++           S +  +   G D++       +KWPND+L
Sbjct: 66  KPDKELELLPQLSFVTALSVYDSITSLCHSHSALCHSRFRGDDIRNENNIIQLKWPNDVL 125

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFS 174
           +  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+ + +  
Sbjct: 126 INSRKIAGILLESVKVENNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPIEPQALLE 184

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           +L ++      +W  + G   I   W   A  + + I++K     + G F  +D+ G ++
Sbjct: 185 ILIENFEEYYHIW-HNNGFPFIRKKWLEHAYKLYENISVKYQNDIVTGIFKDIDNTGRII 243

Query: 235 LEEKKGCVRQIFTGDIF 251
           L+     +    T ++F
Sbjct: 244 LQLPSKKIISFSTAELF 260


>gi|67459136|ref|YP_246760.1| biotin--protein ligase [Rickettsia felis URRWXCal2]
 gi|67004669|gb|AAY61595.1| Biotin--acetyl-CoA-carboxylase ligase [Rickettsia felis URRWXCal2]
          Length = 267

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 126/257 (49%), Gaps = 21/257 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD I ST+ E M+ A S  +  N  ++A  QT  RGR    W S  GNL+ SLL+
Sbjct: 12  FKLIVFDEIDSTSSEAMRIAKSNKVDSNYAVLAKSQTKARGRSGKNWQSRVGNLHVSLLI 71

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAST-------------LPVG----TDVKIKWPNDIL 115
                 + L  LSF  A+A+   ++S               PVG      +++KWPND+L
Sbjct: 72  KPDKELELLPQLSFVTALAVYDTMSSRGPATGFNQSINNLDPVGGLRDDTIQLKWPNDVL 131

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFS 174
           V  RKIAGIL+E++ +KN    +++GIG+N+ + P +   P TSL  E    I+ + +  
Sbjct: 132 VNGRKIAGILLESVKVKNNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPIEPQALLE 190

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            L ++  +   +W  + G   I   W   A  + + I++K     + G F  +D  G ++
Sbjct: 191 KLIENFEKYYQIW-HNNGFSFIRKKWLEHAYKLHENISVKYQNDIVTGLFKDIDSTGRII 249

Query: 235 LEEKKGCVRQIFTGDIF 251
           L+     +    T ++F
Sbjct: 250 LQLPSKKIISFSTAELF 266


>gi|315303842|ref|ZP_07874329.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria ivanovii FSL
           F6-596]
 gi|313627785|gb|EFR96431.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria ivanovii FSL
           F6-596]
          Length = 329

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 121/241 (50%), Gaps = 8/241 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           R E +D++SST     +   S   G + IVA  QTAG+GR    W S KG  ++ S++L 
Sbjct: 84  RLEIYDSVSSTQIIAHQHIESSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILK 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E      
Sbjct: 143 PQIPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAE 200

Query: 134 GLQAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
            + AV++G+G+NV  +  P +     +SLQ E G  +  K +   +   + +   L+  D
Sbjct: 201 TIHAVIIGMGINVNQRQFPEEIKDKASSLQLELGASVSRKALLQEILTSLEKYYALF-LD 259

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI
Sbjct: 260 KGFAPIKLLWETKAIPFGEKLTASTTKGKIHGKVKGISDEGVLLLQDALGEVHAIYSADI 319

Query: 251 F 251
            
Sbjct: 320 L 320


>gi|148259946|ref|YP_001234073.1| biotin--acetyl-CoA-carboxylase ligase [Acidiphilium cryptum JF-5]
 gi|146401627|gb|ABQ30154.1| biotin--acetyl-CoA-carboxylase ligase [Acidiphilium cryptum JF-5]
          Length = 242

 Score =  111 bits (278), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 113/229 (49%), Gaps = 12/229 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +R E +DT+ ST+D C +RA  G+   L +VA+ QTAGRGR    W S  GN   S LL
Sbjct: 7   PWRIEHYDTLGSTSDFCARRAAEGEPERLMVVAARQTAGRGRAGRAWESPAGNFCGSALL 66

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +        +    +A+  V+   LP    V +KWPND++    K+AGIL++   ++
Sbjct: 67  RPRVPAGQGGWFALLAGLALIEVLDPALPAPGAVMLKWPNDLMAGAAKLAGILLDA-TIE 125

Query: 133 NGL-QAVVVGIGLNVKHCPVDTPYP---VTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           NG+  A++VG+G+N+   P   P P    TSL   GG +  + +       +   LD+  
Sbjct: 126 NGMITAMIVGVGVNLAEAP---PVPGRVTTSLAALGGAMTPEALAPAFCARLDHWLDVLA 182

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
             +G   +   W   A   G  IT+    G   G + G+DD G LLL E
Sbjct: 183 --SGAAPLRAAWMRRAHPEGTAITVD--GGRRSGIYAGLDDDGALLLRE 227


>gi|229016894|ref|ZP_04173822.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1273]
 gi|229023100|ref|ZP_04179614.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1272]
 gi|228738246|gb|EEL88728.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1272]
 gi|228744455|gb|EEL94529.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1273]
          Length = 317

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     + A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G DV IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVDVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + K+ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLKN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G L+LE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAISIGKEITARTMKQTINGLAKGITEDGVLMLEDHQGHVHHIHSADI 314


>gi|51473715|ref|YP_067472.1| biotin--protein ligase [Rickettsia typhi str. Wilmington]
 gi|51460027|gb|AAU03990.1| Acetyl-CoA carboxylase biotin holoenzyme synthetase [Rickettsia
           typhi str. Wilmington]
          Length = 262

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 124/243 (51%), Gaps = 22/243 (9%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD I ST+ E M+ A    +  +  I A  QT+GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDEIDSTSSEAMRIAKHNKVYADYAIFAKSQTSGRGRSGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-TLPVGTD-----------------VKIKWPNDI 114
                 + L  LSF  A+A+ + I S  L VG++                 +++KWPND+
Sbjct: 66  RPEKELELLPQLSFVTALAVYNTILSCVLCVGSNQLINNFNAMSVCAQNYSIQLKWPNDV 125

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC-IDLKDIF 173
           L+  RKIAGIL+E++ + N    +++GIG+N+ + P +   P TSL  E    +  + + 
Sbjct: 126 LMNGRKIAGILLESVKVDNNY-YLIIGIGINITYHPENIDQPTTSLITENIIHVVPQALL 184

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            +L Q+  +   +W ++ G   I   W   A  + + I IK   G + G F  +D+ G +
Sbjct: 185 KILIQNFEKYYQIW-QNNGFSFIRKKWIEHAYKLYENINIKYQNGIVTGLFKDIDNTGRI 243

Query: 234 LLE 236
           +L+
Sbjct: 244 ILQ 246


>gi|254463244|ref|ZP_05076660.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679833|gb|EDZ44320.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 238

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 117/241 (48%), Gaps = 11/241 (4%)

Query: 18  FFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
               I STN E  +  ++G L G  WI+A  QTA RGRR   W   KGN  A+L+L    
Sbjct: 1   MLSEIDSTNAEAAR--IAGTLAGPEWILALNQTASRGRRGRAWHFPKGNFAATLVLHPRE 58

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           + D + L SF  ++A+   + +       + +KWPND+L+   K+AGIL+E++    G+ 
Sbjct: 59  APDVVALRSFVASLALYDALVACGVQAQSLALKWPNDVLLNGGKVAGILLESIGAGGGVS 118

Query: 137 AVVVGIGLNVKHCPVDTPY------PVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            + +GIG+N+   P+ +        PV+ L   G  I  +D   LL    AR    +   
Sbjct: 119 HLAIGIGVNLADAPLASDVEALAMRPVSLLSEAGVAISPEDFLDLLASAYARQESQFTT- 177

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I + W   A  +G++IT +       G F  VD  G L+L+  +G V  I   D+
Sbjct: 178 YGFAAIRDAWLARAAKLGEVITARTMNSETTGTFETVDAQGNLVLKTSEGRV-AIAAADV 236

Query: 251 F 251
           F
Sbjct: 237 F 237


>gi|126740395|ref|ZP_01756083.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. SK209-2-6]
 gi|126718531|gb|EBA15245.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. SK209-2-6]
          Length = 249

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 121/248 (48%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +     + + ST DE  +  ++ +L G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 5   PEGYGKRILEEVDSTLDEAAR--IAPELAGPEWILAKRQTKGRGRRGRDWKDPKGNFAAA 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L  S + + + L SF  A+A+     +       + +KWPND+L+   K++GIL+E+ 
Sbjct: 63  LVLRPSEAPNVVALRSFVAALAVADACEALTGQSARISLKWPNDVLLNGGKLSGILLESA 122

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD---TP---YPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + VGIG+N+   P+     P   +PV+ L   G  +  +   + L    AR 
Sbjct: 123 GQGAGVTHLAVGIGVNLIETPMKEWLEPGAVWPVSLLSETGVQVTPEGFLTELAAAYAR- 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +L     G E I   W   A  +G++IT + +     G F  VD+ G L+L   KG + 
Sbjct: 182 YELQFTTYGFEPIRKAWLARAAKLGEVITARTASSETEGTFETVDEEGNLVLNSAKGRI- 240

Query: 244 QIFTGDIF 251
            I   DIF
Sbjct: 241 TIPAADIF 248


>gi|229126950|ref|ZP_04255961.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-Cer4]
 gi|228656550|gb|EEL12377.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-Cer4]
          Length = 290

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|218233846|ref|YP_002366318.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus B4264]
 gi|218161803|gb|ACK61795.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus B4264]
          Length = 326

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|229029318|ref|ZP_04185406.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1271]
 gi|228731977|gb|EEL82871.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           AH1271]
          Length = 290

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 120/239 (50%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT+GRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I+G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEITARTMRETIIGVAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|206970585|ref|ZP_03231537.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH1134]
 gi|206734221|gb|EDZ51391.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH1134]
          Length = 326

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|149914598|ref|ZP_01903128.1| Biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. AzwK-3b]
 gi|149811391|gb|EDM71226.1| Biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. AzwK-3b]
          Length = 256

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 105/220 (47%), Gaps = 8/220 (3%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           + STN E  + A  G  G  WI+A  QTA RGRR   W   KGN  A+L++  + S D +
Sbjct: 23  VDSTNAEAARLA-PGLSGPEWILALNQTAARGRRGRPWTHPKGNFAATLVMRPTESPDQV 81

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
            L SF  ++A+     +       + +KWPND+L+   K+AGIL+E+   + GL    +G
Sbjct: 82  ALRSFVASLALFDAFVAATGQSGGLSLKWPNDVLLNGGKLAGILLESAGTREGLSYFAIG 141

Query: 142 IGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           IG+N+   P           PV+ L   G  I  ++   LL    AR  +      G   
Sbjct: 142 IGVNLAQAPGRDMVEAGALQPVSLLSEAGVTITPEEFLDLLAPAYAR-YEAQFTTYGFAP 200

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           I   W   A  +G  IT + S  +I G F  VD+ G L+L
Sbjct: 201 IRREWLARAAKLGQTITARTSRDAITGVFETVDEAGNLVL 240


>gi|14548143|gb|AAK66800.1|U40238_23 bifunctional protein: biotin repressor/biotin
           [acetyl-CoA-carboxylase] ligase [uncultured
           crenarchaeote 4B7]
          Length = 333

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 127/248 (51%), Gaps = 19/248 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F+ I ST +   + A         I+A  QTAGRGR D KW S KG ++ SL++  
Sbjct: 90  RIYYFEEIDSTQNFAKQIAYDKKENGTIIIAEKQTAGRGRLDRKWTSPKGGMWFSLIIHP 149

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                + TL+    AVA+   I S L + T+V  KWPNDI +  +K+AG+L++     N 
Sbjct: 150 KFDVSNSTLIPILSAVALSKSIKSVLGIKTEV--KWPNDITMNGKKVAGMLVDASFQANN 207

Query: 135 LQAVVVGIGLN-------VKHCPVDTP--YPVTSLQREGGCIDLKDI---FSLLFQDVAR 182
           +  +++GIG+N       ++     TP  Y V SL+++      K +   F L F++   
Sbjct: 208 IDYLILGIGVNFDIDAKKLEKRLAKTPNFYGVNSLRKKDDKTPPKLLLKEFLLQFEEKLS 267

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            LD    +  + +I+  W   A GIG  ITI  S G I G   G+D+ G L ++ +K   
Sbjct: 268 QLD----NGEKSKIVKEWTKRAAGIGKKITINTSNGKISGISQGIDNDGALKIKTRKET- 322

Query: 243 RQIFTGDI 250
           ++IF GD+
Sbjct: 323 KKIFVGDV 330


>gi|157828559|ref|YP_001494801.1| biotin--protein ligase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|157801040|gb|ABV76293.1| biotin--protein ligase [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 266

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 122/243 (50%), Gaps = 21/243 (8%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           +F+   FD + STN E MK A +  +  N  ++A  QT GRGR    W S  GNL+ SLL
Sbjct: 5   TFKLIVFDKLDSTNSEAMKMAQNAKVDSNYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLL 64

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPV----------GTDVK-------IKWPNDI 114
           +      + +  LSF  A+++   I S              G D++       +KWPND+
Sbjct: 65  IKPDKELELVPQLSFVTALSVYDSITSLCHSYSSLCHSRFRGNDIRNENNIIQLKWPNDV 124

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIF 173
           L+  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+ + + 
Sbjct: 125 LINSRKIAGILLESVKVENNY-YLIIGIGINISYHPDNIDQPTTSLISENLPPIEPQALL 183

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            +L ++      +W  + G   I   W   A  + + I++K     + G F  +D+ G +
Sbjct: 184 EILIENFEEYYQIW-HNNGFPFIRKKWLEHAYKLYENISVKYQNDIVTGLFKDIDNTGRI 242

Query: 234 LLE 236
           +L+
Sbjct: 243 ILQ 245


>gi|229178044|ref|ZP_04305416.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           172560W]
 gi|228605532|gb|EEK62981.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           172560W]
          Length = 317

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|228952016|ref|ZP_04114111.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957912|ref|ZP_04119652.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|229043382|ref|ZP_04191099.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH676]
 gi|229069189|ref|ZP_04202480.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           F65185]
 gi|229078819|ref|ZP_04211372.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock4-2]
 gi|229109092|ref|ZP_04238692.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-15]
 gi|229144235|ref|ZP_04272649.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST24]
 gi|229149834|ref|ZP_04278062.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1550]
 gi|229189718|ref|ZP_04316732.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           10876]
 gi|228593767|gb|EEK51572.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           10876]
 gi|228633515|gb|EEK90116.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1550]
 gi|228639243|gb|EEK95659.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST24]
 gi|228674370|gb|EEL29614.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-15]
 gi|228704501|gb|EEL56934.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock4-2]
 gi|228713941|gb|EEL65825.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           F65185]
 gi|228725963|gb|EEL77203.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH676]
 gi|228801828|gb|EEM48705.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807548|gb|EEM54072.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 317

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|228920348|ref|ZP_04083694.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839270|gb|EEM84565.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 317

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|75760405|ref|ZP_00740449.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|74492116|gb|EAO55288.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 330

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 92  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 151

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I     VG  V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 152 PVHHAPQLTLLAAVSVAQAIEKCTGVG--VGIKWPNDILIQGKKAVGILTEMQADPDKIN 209

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 210 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 268

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 269 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 327


>gi|196039082|ref|ZP_03106389.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus NVH0597-99]
 gi|300117436|ref|ZP_07055226.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus SJ1]
 gi|196030227|gb|EDX68827.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus NVH0597-99]
 gi|298725271|gb|EFI65923.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus SJ1]
          Length = 326

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|228900217|ref|ZP_04064448.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 4222]
 gi|228964611|ref|ZP_04125719.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228795042|gb|EEM42540.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228859386|gb|EEN03815.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           IBL 4222]
          Length = 286

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I     VG  V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKCTGVG--VGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 166 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 225 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 283


>gi|229090600|ref|ZP_04221834.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-42]
 gi|228692743|gb|EEL46468.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-42]
          Length = 290

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|163741473|ref|ZP_02148864.1| biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           2.10]
 gi|161385207|gb|EDQ09585.1| biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           2.10]
          Length = 249

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 116/247 (46%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +     + + ST DE  +RA +   G  WI+A  QT GRGRR   W   KGN  A+L
Sbjct: 5   PEGYGRSLLEEVDSTLDEAARRAPT-LTGPEWIMAKRQTKGRGRRGRAWKEPKGNFAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++      D + L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+  
Sbjct: 64  VMRPEGPPDQVALRSFVAALALYDACVALCGETAGLALKWPNDVLLNGGKLAGILLESAG 123

Query: 131 LKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              G+  + +GIG+N+   P+         +PV+ L   G  +  +D  + L     R  
Sbjct: 124 AVGGVTHLSIGIGVNLIETPMQEWLEPGAVWPVSLLSETGIHVTPEDFLTELAAAYNR-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           ++     G E I   W   A  +G++I  + S     G F  VD  G L+L+  KG V  
Sbjct: 183 EIQFVTYGFEPIRTAWLARAARLGEVIIARTSNSETEGTFETVDANGNLVLKTAKGRV-N 241

Query: 245 IFTGDIF 251
           I   DIF
Sbjct: 242 IPAADIF 248


>gi|152983881|ref|YP_001346206.1| biotin--protein ligase [Pseudomonas aeruginosa PA7]
 gi|150959039|gb|ABR81064.1| biotin-[acetyl-CoA-carboxylase] ligase [Pseudomonas aeruginosa PA7]
          Length = 293

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 123/240 (51%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E    I STN E M+R  +G      +VA  QTAGRGRR   WIS  G NLY SL +   
Sbjct: 53  EILSAIDSTNSEAMRRLAAGASTPFVLVAEQQTAGRGRRGRVWISPYGENLYYSLAVTVR 112

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+  V+   L V +   +KWPND+L   RKIAGIL+E       L
Sbjct: 113 GGARELEGLSLVVGLAVLKVL-DLLQV-SKAGLKWPNDLLQDGRKIAGILLELSGDPADL 170

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   GG +D   + S+L Q +A  LD   ++   
Sbjct: 171 CQVVIGIGINVNMKVATDIDQPWTSLREALGGLVDRSHLLSVLNQQLAWYLDRHSREGFA 230

Query: 191 TGRE--EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             RE  E  NLW+      G L+++  S  SI GR +GVD  G L LE   G V Q F+G
Sbjct: 231 ASREEWEARNLWQ------GALVSLSTSSTSIEGRVLGVDARGALRLE--VGGVEQSFSG 282


>gi|308174035|ref|YP_003920740.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens DSM 7]
 gi|307606899|emb|CBI43270.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens DSM 7]
 gi|328552839|gb|AEB23331.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens TA208]
 gi|328912365|gb|AEB63961.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus amyloliquefaciens LL3]
          Length = 325

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 128/261 (49%), Gaps = 19/261 (7%)

Query: 4   NLSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
            LSE +  +  + E       + D + ST     + A  G      +VA  QTAGRGR  
Sbjct: 67  KLSESEIRFGLKTEVLGKQLYYRDVLPSTQKTAHELANDGAPEGTLVVADKQTAGRGRMS 126

Query: 57  NKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
             W S +GN ++ SL+L   +       L+   AVA+   I +    G    IKWPND++
Sbjct: 127 RVWHSQEGNGIWMSLILRPDVPLQKTPQLTLLSAVAVVQAIEAF--TGVQPAIKWPNDLM 184

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQRE-GGCIDLK 170
           +  +K  GIL E    ++ +++V++GIG+NV     D P  +    TSL  E GG ID  
Sbjct: 185 IHGKKAVGILTELQAEEDRVRSVILGIGINVNQQETDFPGELQEIATSLSLEAGGKIDRA 244

Query: 171 D-IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDD 229
             I  +L     R  D  K   G   I  LW  +A G+G+ +  +   G+  G+ +G+DD
Sbjct: 245 GLIQEILLTFEKRYQDYLKH--GFTPIKLLWESYAVGLGNELRARTLQGTFYGKSLGIDD 302

Query: 230 FGYLLLEEKKGCVRQIFTGDI 250
            G LLLE K G +++I++ DI
Sbjct: 303 EGVLLLETKDG-IKKIYSADI 322


>gi|321311713|ref|YP_004204000.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis BSn5]
 gi|320017987|gb|ADV92973.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis BSn5]
          Length = 325

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 129/262 (49%), Gaps = 23/262 (8%)

Query: 5   LSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           LSE +  +  + E       + D +SST     + A +       +VA  QTAGRGR   
Sbjct: 68  LSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSR 127

Query: 58  KWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
            W S +GN ++ SL+L   I       L+   AVA+   I     + TD  IKWPNDIL+
Sbjct: 128 VWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTD--IKWPNDILI 185

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLKD 171
             +K  GIL E    ++ +++V++GIG+NV   P D P  +    TSL Q  G  ID   
Sbjct: 186 NGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPEELKDIATSLSQAAGEKIDRAG 245

Query: 172 IFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
           +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+D
Sbjct: 246 VIQHILLCFEK--RYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGID 301

Query: 229 DFGYLLLEEKKGCVRQIFTGDI 250
           D G LLLE  +G +++I++ DI
Sbjct: 302 DEGVLLLETNEG-IKKIYSADI 322


>gi|296502206|ref|YP_003663906.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis BMB171]
 gi|296323258|gb|ADH06186.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus thuringiensis BMB171]
          Length = 286

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 166 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 225 GFSIIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 283


>gi|218896566|ref|YP_002444977.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus G9842]
 gi|218545634|gb|ACK98028.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus G9842]
          Length = 326

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEETVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I     VG  V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKCTGVG--VGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|254294088|ref|YP_003060111.1| biotin/acetyl-CoA-carboxylase ligase [Hirschia baltica ATCC 49814]
 gi|254042619|gb|ACT59414.1| biotin/acetyl-CoA-carboxylase ligase [Hirschia baltica ATCC 49814]
          Length = 253

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 123/260 (47%), Gaps = 22/260 (8%)

Query: 2   FSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS 61
            + L E    +++  +++D + STN E  +RA +G+ G  WI A  Q  G+GR    W +
Sbjct: 1   MTKLIESALAHAWPVQWYDELDSTNAEAKRRASTGEFGPCWIAARKQINGKGRLGRPWQA 60

Query: 62  DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
            +GNL A+ L     S D ++ LSF   +A+           + +++KWPND+   + K 
Sbjct: 61  PEGNLSATALFPFDGSFDQISKLSFLAGLAIYDAALLEGVPASKLQLKWPNDVRCERHKF 120

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCP-VDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           +G+LIET  +   L  V +G+G+N+   P +D P            + LKD+ +    + 
Sbjct: 121 SGVLIETGQVSKDLSWVALGVGVNILRAPEIDQP-----------TVCLKDLSANAIVNA 169

Query: 181 ARVLDLWKKDTGR----------EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDF 230
              LD  K   G           E I   W   A G    I++K S  ++ G   G+++ 
Sbjct: 170 DNFLDSLKVTFGNRLHSLIKFGFEPIRQDWLANAEGYNHSISVKDSQSTMTGIMRGINET 229

Query: 231 GYLLLEEKKGCVRQIFTGDI 250
           G L+LE   G ++ + TGD+
Sbjct: 230 GALMLEMGDGTIKLVTTGDV 249


>gi|83953892|ref|ZP_00962613.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. NAS-14.1]
 gi|83841837|gb|EAP81006.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. NAS-14.1]
          Length = 253

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 123/260 (47%), Gaps = 17/260 (6%)

Query: 1   MFSNLSECQN---PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           M +  ++ QN   P  +  + FD++ ST  E  ++A S   G+ WI+A  QTA RGRR  
Sbjct: 1   MEATGAKAQNASWPDGYGRQVFDSVDSTLSEAARQA-SELTGSTWILAQEQTAARGRRGR 59

Query: 58  KWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF 117
            W + +GN  A+L++  S S  +  L SF  ++A+R    +T        +KWPND+L+ 
Sbjct: 60  SWATPRGNFAATLMMRRSESPSTAALRSFVASLALRRAFVATTRDEGAFTLKWPNDVLLN 119

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKD 171
             K+AGIL+E++        + +GIG+N+ H P           PV+ +   G  +  + 
Sbjct: 120 GGKVAGILLESIG-----DFLAIGIGVNLSHAPGADQVEAGALRPVSVVAETGKVVPPEV 174

Query: 172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
               L  + A+ L+   +  G   I   W   A  +G+ I  +       G F  VD  G
Sbjct: 175 FLDALAAEYAQ-LETQFQTYGFAPIRTAWLSHAARLGEEIIARTMKDETRGVFEDVDAQG 233

Query: 232 YLLLEEKKGCVRQIFTGDIF 251
            L+L   KG V  I   D+F
Sbjct: 234 NLILRTPKGRV-PITAADVF 252


>gi|229121179|ref|ZP_04250416.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           95/8201]
 gi|228662298|gb|EEL17901.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           95/8201]
          Length = 286

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 166 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGRPIVRAELMQQIFLQLEKLYEEYLQN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ KG V  I + DI
Sbjct: 225 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHKGKVHHIHSADI 283


>gi|291484666|dbj|BAI85741.1| bifunctional protein BirA [Bacillus subtilis subsp. natto BEST195]
          Length = 325

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 129/262 (49%), Gaps = 23/262 (8%)

Query: 5   LSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           LSE +  +  + E       + D +SST     + A +       +VA  QTAGRGR   
Sbjct: 68  LSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELANNNSPEGTLVVADKQTAGRGRMSR 127

Query: 58  KWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
            W S +GN ++ SL+L   I       L+   AVA+   I     + TD  IKWPNDIL+
Sbjct: 128 VWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTD--IKWPNDILI 185

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLKD 171
             +K  GIL E    ++ +++V++GIG+NV   P D P  +    TSL Q  G  ID   
Sbjct: 186 NGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAG 245

Query: 172 IFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
           +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+D
Sbjct: 246 VIQHILLCFEK--RYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGID 301

Query: 229 DFGYLLLEEKKGCVRQIFTGDI 250
           D G LLLE  +G +++I++ DI
Sbjct: 302 DEGVLLLETNEG-IKKIYSADI 322


>gi|228926667|ref|ZP_04089736.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228833043|gb|EEM78611.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 286

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+NV    +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 166 AVIMGIGINVNQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 225 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 283


>gi|255264857|ref|ZP_05344199.1| biotin-(acetyl-CoA-carboxylase) ligase [Thalassiobium sp. R2A62]
 gi|255107192|gb|EET49866.1| biotin-(acetyl-CoA-carboxylase) ligase [Thalassiobium sp. R2A62]
          Length = 254

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 124/248 (50%), Gaps = 13/248 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +     D   ST  E  +R  S   G+ WI+A  QTA  GRR   W +  GN  A+L
Sbjct: 12  PAGYDRVILDHTDSTMAEA-RRISSSASGHTWILAREQTAAHGRRGRAWTNPAGNFSATL 70

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL    +  +  L SF +AVA+R  +A T+P    + +KWPND ++   K+AGIL+E++ 
Sbjct: 71  LLRVDDTPANAALRSFVMAVALRQTLAMTVPP-EQLSLKWPNDAMIAGGKVAGILLESVG 129

Query: 131 LKNGLQAVVVGIGLNVKHCP----VDT-PYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
               +  + +GIG+N+   P    V+T  +   ++ + G     +D    LF  V+   D
Sbjct: 130 RAGRVDWLSIGIGVNLTQAPDVAEVETGAFRPVAVSQYGTAPSPQD---FLFWLVSHFAD 186

Query: 186 LWK--KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
             +  +  G + I  LW   A  +G++IT K +  ++ G F  VD  G L+L+   G V+
Sbjct: 187 REQSFRSFGFDPIRRLWLAHAARLGEVITAKTTRDTLTGTFETVDADGNLVLKTPSG-VQ 245

Query: 244 QIFTGDIF 251
            I   D++
Sbjct: 246 AIPAADVY 253


>gi|188584727|ref|YP_001916272.1| biotin--acetyl-CoA-carboxylase ligase [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179349414|gb|ACB83684.1| biotin--acetyl-CoA-carboxylase ligase [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 323

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 125/243 (51%), Gaps = 17/243 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           ++  +FD I STN+    R+L        ++A  QT GRGR    W S  G +Y SL++ 
Sbjct: 88  YQITYFDNIDSTNNYA--RSLQPPQ---VVIAEQQTKGRGRMGRAWFSAPGGIYFSLVIT 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
              S D +  +   I+ A+  V+   L  G   +IKWPNDILV  +K+ GIL+E     +
Sbjct: 143 PRCSVDEIPTIPLLISTAITKVLKREL--GIQAEIKWPNDILVQGQKVTGILVELAGETD 200

Query: 134 GLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGC--IDLKDIFSLLFQDVARVLDLW 187
             Q  V+G+G+N        P +    VTSL RE  C  ++ K + + + +++ ++   +
Sbjct: 201 APQKAVIGVGINANQNTNLFPEELKKSVTSL-RELNCSPVNRKLMLNSILEEITQL--FF 257

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +      +++N W+ ++C +G  IT+K    +I G    +D  G L++E  +G  R I T
Sbjct: 258 ELPNCIPKVLNTWKEYSCTLGKKITVKQVSKTITGIAKDIDRSGALIVETPQGEQR-ILT 316

Query: 248 GDI 250
           GD+
Sbjct: 317 GDL 319


>gi|163738816|ref|ZP_02146230.1| Biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           BS107]
 gi|161388144|gb|EDQ12499.1| Biotin--acetyl-CoA-carboxylase ligase [Phaeobacter gallaeciensis
           BS107]
          Length = 249

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 116/247 (46%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +     + + ST DE  +RA +   G  WI+A  QT GRGRR   W   KGN  A+L
Sbjct: 5   PEGYGRSLLEEVDSTLDEAARRAPT-LTGPEWIMAKRQTKGRGRRGRAWKEPKGNFAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++      D + L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+  
Sbjct: 64  VMRPEGPPDQVALRSFVAALALYDACVALCGETAGLALKWPNDVLLNGGKLAGILLESAG 123

Query: 131 LKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              G+  + +G+G+N+   P+         +PV+ L   G  +  +D  + L     R  
Sbjct: 124 AAGGVTHLSIGLGVNLIETPMQEWLEPGAVWPVSLLSETGIHVTPEDFLTELAAAYDR-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           ++     G E I   W   A  +G++I  + S     G F  VD  G L+L+  KG V  
Sbjct: 183 EIQFVTYGFEPIRTAWLARAARLGEVIIARTSNSETEGTFETVDANGNLVLKTAKGRV-N 241

Query: 245 IFTGDIF 251
           I   DIF
Sbjct: 242 IPAADIF 248


>gi|313111435|ref|ZP_07797238.1| BirA protein [Pseudomonas aeruginosa 39016]
 gi|310883740|gb|EFQ42334.1| BirA protein [Pseudomonas aeruginosa 39016]
          Length = 312

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 74  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  D  +KWPND+L   +KIAGIL+E       L
Sbjct: 134 GGARELEGLSLVVGLAVLRALES-LGV-RDAGLKWPNDVLQGGKKIAGILLELSGDPADL 191

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 192 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 251

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 252 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVD--GVEQGFSG 303


>gi|254419436|ref|ZP_05033160.1| biotin-(acetyl-CoA-carboxylase) ligase [Brevundimonas sp. BAL3]
 gi|196185613|gb|EDX80589.1| biotin-(acetyl-CoA-carboxylase) ligase [Brevundimonas sp. BAL3]
          Length = 249

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 113/238 (47%), Gaps = 5/238 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
             D I ST  E  + A +G++G  WI+A  QTAGRGRR   W+   GNL A+LL+    S
Sbjct: 8   ILDEIDSTLSEARRLAEAGEVGPKWIIARRQTAGRGRRGRSWVDKPGNLAATLLIRVHAS 67

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                  +F  A+A+  ++         V IKWPND+L+  RK  GIL+E+    +G   
Sbjct: 68  PREAAQATFIAALAVADLL-DVFVSPALVSIKWPNDVLLDGRKACGILVESGAHASGGLW 126

Query: 138 VVVGIGLNVKHCPVDTPYPVTSL-QREGGCIDLKDIFSLLFQDVARVLDLW---KKDTGR 193
           + VGIG+N+ H P  T     ++ +R    +          + +A    +W    +  G 
Sbjct: 127 LAVGIGVNLAHAPEGTEKASAAIAERLREDLAFAPPVEAAAEILAETFAVWWGRWQTMGF 186

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           E +++ W     G+    T +L   +I G   GV+  G L L    G VR I  GD+F
Sbjct: 187 EPVLDAWTSRLTGLNGPCTARLDNETIEGLAEGVEPDGALRLRLADGSVRLISAGDVF 244


>gi|91205597|ref|YP_537952.1| biotin-(acetyl-CoA carboxylase) ligase [Rickettsia bellii RML369-C]
 gi|91069141|gb|ABE04863.1| Biotin-(acetyl-CoA carboxylase) ligase [Rickettsia bellii RML369-C]
          Length = 266

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 125/248 (50%), Gaps = 28/248 (11%)

Query: 15  RYEFF--DTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYASLL 71
           RY+ F  D + STN E ++ A S      +I+ A  QT GRGR    W S  GNL+ SLL
Sbjct: 5   RYKLFVFDELDSTNLEAIRIAKSNKPDRDYIILAKSQTKGRGRSGKNWQSTLGNLHVSLL 64

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP----------------------VGTDVKIK 109
           +  +   + L  LSF  A+A+   +   +P                      V   +++K
Sbjct: 65  IKPNKELELLPQLSFVTALAVYDSMVHVIPWLDHGIQKINEIPIQARGMTPLVLKKIQLK 124

Query: 110 WPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL-QREGGCID 168
           WPND+LV  +KI+GIL+E++ +++    +++G+G+N+ + P++   P TSL   E   I 
Sbjct: 125 WPNDVLVGGKKISGILLESVKVEDAY-YLIIGVGINITYHPINIDQPTTSLVAEELPIIT 183

Query: 169 LKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
            + +  +L ++  +   +W+K+ G   I   W   A  + + I++K     + G F G+D
Sbjct: 184 PQALLEILIENFEKYYQIWEKN-GFSFIRGTWLKHAYKLHENISVKYQNNIVTGTFQGID 242

Query: 229 DFGYLLLE 236
             G ++L+
Sbjct: 243 SIGRIILQ 250


>gi|124441833|gb|ABN11532.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. 168]
 gi|124441837|gb|ABN11535.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|124441853|gb|ABN11547.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441857|gb|ABN11550.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441861|gb|ABN11553.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441865|gb|ABN11556.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. SMY]
          Length = 319

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 129/262 (49%), Gaps = 23/262 (8%)

Query: 5   LSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           LSE +  +  + E       + D +SST     + A +       +VA  QTAGRGR   
Sbjct: 62  LSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSR 121

Query: 58  KWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
            W S +GN ++ SL+L   I       L+   AVA+   I     + TD  IKWPNDIL+
Sbjct: 122 VWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTD--IKWPNDILI 179

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLKD 171
             +K  GIL E    ++ +++V++GIG+NV   P D P  +    TSL Q  G  ID   
Sbjct: 180 NGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAG 239

Query: 172 IFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
           +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+D
Sbjct: 240 VIQHILLCFE--KRYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGID 295

Query: 229 DFGYLLLEEKKGCVRQIFTGDI 250
           D G LLLE  +G +++I++ DI
Sbjct: 296 DEGVLLLETNEG-IKKIYSADI 316


>gi|16079301|ref|NP_390125.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|221310160|ref|ZP_03592007.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221314482|ref|ZP_03596287.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319404|ref|ZP_03600698.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323680|ref|ZP_03604974.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|317374856|sp|P0CI75|BIRA_BACSU RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|1146239|gb|AAB38447.1| biotin [acetyl-CoA-carboxylase] ligase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|2634662|emb|CAB14160.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 325

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 129/262 (49%), Gaps = 23/262 (8%)

Query: 5   LSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           LSE +  +  + E       + D +SST     + A +       +VA  QTAGRGR   
Sbjct: 68  LSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELANNNAPEGTLVVADKQTAGRGRMSR 127

Query: 58  KWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
            W S +GN ++ SL+L   I       L+   AVA+   I     + TD  IKWPNDIL+
Sbjct: 128 VWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTD--IKWPNDILI 185

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLKD 171
             +K  GIL E    ++ +++V++GIG+NV   P D P  +    TSL Q  G  ID   
Sbjct: 186 NGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAG 245

Query: 172 IFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
           +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+D
Sbjct: 246 VIQHILLCFEK--RYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGID 301

Query: 229 DFGYLLLEEKKGCVRQIFTGDI 250
           D G LLLE  +G +++I++ DI
Sbjct: 302 DEGVLLLETNEG-IKKIYSADI 322


>gi|229160587|ref|ZP_04288582.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           R309803]
 gi|228622997|gb|EEK79828.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           R309803]
          Length = 317

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     + A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEETVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--AGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|15599476|ref|NP_252970.1| biotin--protein ligase [Pseudomonas aeruginosa PAO1]
 gi|9950499|gb|AAG07668.1|AE004843_10 BirA bifunctional protein [Pseudomonas aeruginosa PAO1]
          Length = 312

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 74  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  D  +KWPND+L   +KIAGIL+E       L
Sbjct: 134 GGARELEGLSLVVGLAVLRALES-LGV-QDTGLKWPNDLLQGGKKIAGILLELSGDPADL 191

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 192 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 251

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 252 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVD--GVEQGFSG 303


>gi|83942651|ref|ZP_00955112.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. EE-36]
 gi|83846744|gb|EAP84620.1| biotin--acetyl-CoA-carboxylase ligase [Sulfitobacter sp. EE-36]
          Length = 263

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 117/247 (47%), Gaps = 14/247 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +  + FD++ ST  E  ++A S   G+ WI+A  QTA RGRR   W + +GN  A+L
Sbjct: 24  PDGYGRQVFDSVDSTLSEAARQA-SELTGSTWILAQEQTAARGRRGRSWATPRGNFAATL 82

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++  S S  +  L SF  ++A+R    +T        +KWPND+L+   K+AGIL+E++ 
Sbjct: 83  MMRRSESPSTAALRSFVASLALRRAFVATTRDEGAFTLKWPNDVLLNGGKVAGILLESIG 142

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
                  + +GIG+N+ H P           PV+ +   G  +  +     L  + A+ L
Sbjct: 143 -----DFLAIGIGVNLAHAPGADQVEAGALRPVSVVAETGKVVPPEVFLDALAAEYAQ-L 196

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +   +  G   I   W   A  +G+ I  +       G F  VD  G L+L   KG V  
Sbjct: 197 ETQFQTYGFAPIRTAWLSHAARLGEEIVARTMKDETRGVFEDVDAQGNLILRTPKGRV-P 255

Query: 245 IFTGDIF 251
           I   D+F
Sbjct: 256 ITAADVF 262


>gi|218889392|ref|YP_002438256.1| biotin--protein ligase [Pseudomonas aeruginosa LESB58]
 gi|254242922|ref|ZP_04936244.1| hypothetical protein PA2G_03707 [Pseudomonas aeruginosa 2192]
 gi|126196300|gb|EAZ60363.1| hypothetical protein PA2G_03707 [Pseudomonas aeruginosa 2192]
 gi|218769615|emb|CAW25375.1| BirA bifunctional protein [Pseudomonas aeruginosa LESB58]
          Length = 312

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 74  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  D  +KWPND+L   +KIAGIL+E       L
Sbjct: 134 GGARELEGLSLVVGLAVLRALES-LGV-RDAGLKWPNDLLQGGKKIAGILLELSGDPADL 191

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 192 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 251

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 252 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVD--GVEQGFSG 303


>gi|49085164|gb|AAT51257.1| PA4280 [synthetic construct]
          Length = 313

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 74  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  D  +KWPND+L   +KIAGIL+E       L
Sbjct: 134 GGARELEGLSLVVGLAVLRALES-LGV-QDTGLKWPNDLLQGGKKIAGILLELSGDPADL 191

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 192 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 251

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 252 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVD--GVEQGFSG 303


>gi|229096128|ref|ZP_04227101.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-29]
 gi|228687088|gb|EEL40993.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-29]
          Length = 317

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K+ GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKVVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDKEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIHSADI 314


>gi|30019685|ref|NP_831316.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus cereus ATCC 14579]
 gi|29895229|gb|AAP08517.1| Biotin operon repressor / Biotin--[acetyl-CoA-carboxylase]
           synthetase [Bacillus cereus ATCC 14579]
          Length = 317

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +T+ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEETVESTQHIAAKLAYEGAEEGTVVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADLDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   ++  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIYLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRETITGLAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|110668802|ref|YP_658613.1| biotin--[acetyl-CoA-carboxylase] ligase [Haloquadratum walsbyi DSM
           16790]
 gi|109626549|emb|CAJ53012.1| biotin--[acetyl-CoA-carboxylase] ligase [Haloquadratum walsbyi DSM
           16790]
          Length = 324

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 122/251 (48%), Gaps = 25/251 (9%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           S+R E+ D   STND   + A  G   ++ +VA  QT GRGR D +W S  G ++ SLLL
Sbjct: 76  SYRIEYADQYESTNDRARELAKMGTTDDVAVVADAQTGGRGRLDRQWSSPSGGIWVSLLL 135

Query: 73  ID-SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----------RKI 121
           +    S   L + +FA AVA+   +      G DV IKWPND+L+ +          RKI
Sbjct: 136 LHPHCSPAELPVYTFAAAVAVVRAVQQ---CGIDVNIKWPNDVLLSRDTPEINPSDGRKI 192

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLL---FQ 178
           AGIL ET    + +  ++VGIGLN        P   TSLQ   G +D + +   L   F 
Sbjct: 193 AGILTETAGEADQVSWLIVGIGLNANVDSTALPPEATSLQSVIGAVDRRALLQRLLNSFA 252

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
           ++   +DL       + I++ WR  +  +   + I     +I G  V +   G L+++  
Sbjct: 253 ELTNPIDL-------DNIIDAWRTHSTTLNQRVRITTPRETIEGVAVDIQTPGALIVQTN 305

Query: 239 KGCVRQIFTGD 249
            G ++ I  GD
Sbjct: 306 NG-IKTIHAGD 315


>gi|52143811|ref|YP_083017.1| biotin operon repressor [Bacillus cereus E33L]
 gi|51977280|gb|AAU18830.1| biotin operon repressor [Bacillus cereus E33L]
          Length = 326

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 120/239 (50%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLK-DIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G + ++ ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKLIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|253577528|ref|ZP_04854841.1| biotin-acetyl-CoA-carboxylase ligase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843068|gb|EES71103.1| biotin-acetyl-CoA-carboxylase ligase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 327

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 122/250 (48%), Gaps = 18/250 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  R +  D+ SST +E  K A  G      ++A  QTAGRGR+  +W S  G  ++ SL
Sbjct: 81  FGQRLKLLDSTSSTQEEVRKLAEEGAPHGTLVLAEEQTAGRGRQGRRWYSPPGKGVWMSL 140

Query: 71  LLID-----SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LL       SI+     L + A+  A+R V       G D  IKWPNDIL   RK+ GI+
Sbjct: 141 LLRPDRQPLSIAPQLTLLTAVAVCRAIRKV------TGVDAGIKWPNDILARGRKLCGII 194

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDV 180
           +E+      ++  V GIG++V     D P  + ++        G  ID   +   + +++
Sbjct: 195 VESAAEDELIRYAVAGIGIDVNLTAADIPPELETIATSLCIESGRRIDRTSLIGAVIKEL 254

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
            ++ +L+ ++ G   I +LW   +  +G  IT+    G + G   G+D  G L L ++ G
Sbjct: 255 EQLYELYIQE-GFAPIGHLWEALSVTLGREITVHTPNGVLQGTATGLDSSGALFLLDQNG 313

Query: 241 CVRQIFTGDI 250
               IF+G++
Sbjct: 314 KHFTIFSGEV 323


>gi|152975061|ref|YP_001374578.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023813|gb|ABS21583.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus cytotoxicus NVH
           391-98]
          Length = 326

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 118/240 (49%), Gaps = 11/240 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHVAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWYSPKGTGVWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILINGKKTVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK--D 190
           AV++GIG+N     +H   +     TSL  E G   ++    L+ Q   ++  L+K+  +
Sbjct: 206 AVIMGIGINANQQTEHFVDEIKQIATSLAIESGKPIVR--AELMQQIFLQMEKLYKEYLN 263

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   +  LW  +A  IG  IT +    +I G   G+ D G LLLE+ +G +  I + DI
Sbjct: 264 NGFTVVKLLWESYAVSIGKEITARTMRQTITGVAKGITDDGVLLLEDHQGYIHHIHSADI 323


>gi|83952325|ref|ZP_00961057.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius nubinhibens ISM]
 gi|83837331|gb|EAP76628.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius nubinhibens ISM]
          Length = 249

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 113/247 (45%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +       + STN E  + A +   G  WI+A  QTA RGRR   W +  GN  A+L
Sbjct: 5   PEGYGRRVLARVDSTNAEAARIAPT-LAGPEWILALEQTAARGRRGRAWANPVGNFAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++  + S D + L SF  ++A+   +         V +KWPND+L+   K+AGIL+E+  
Sbjct: 64  VMRPTESPDQVALRSFVASLALFDAVVDATGRAAGVSLKWPNDVLLNGGKLAGILLESAG 123

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              GL    +GIG+N++  P           PV+ L   G  +  ++   LL    AR  
Sbjct: 124 SGGGLSHFAIGIGVNLREAPGAGEVEPGAVRPVSLLSEAGVMVTPEEFLDLLAPAYAR-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +      G   I   W   A  IG++IT + +  S  G F  VD  G L+L    G +  
Sbjct: 183 ETQFVTYGFAPIREAWLARAAKIGEVITARTTRDSHEGTFETVDATGNLVLSTAHGRI-A 241

Query: 245 IFTGDIF 251
           I   D+F
Sbjct: 242 IPAADVF 248


>gi|163746991|ref|ZP_02154347.1| biotin--acetyl-CoA-carboxylase ligase, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161379552|gb|EDQ03965.1| biotin--acetyl-CoA-carboxylase ligase, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 243

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 116/247 (46%), Gaps = 15/247 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +    +DT+ ST  E  +  L  +L    WI+A  QTA RGRR   W + +GN  A+
Sbjct: 5   PEGYGRRVYDTLDSTLSEAAR--LQQELTAPTWILALEQTAARGRRGRSWTTPRGNFAAT 62

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++          L SF  ++A+     +         +KWPND+L+   K+AGIL+E++
Sbjct: 63  LMMPRKEPPGVAALRSFVTSLALYRAFVAVTGREDAFALKWPNDVLLRGGKVAGILLESV 122

Query: 130 NLKNGLQAVVVGIGLNVKHCP-----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
                   + +GIG+N+ H P          P  +L+  G  +  +D  ++L Q+ A + 
Sbjct: 123 G-----DHLAIGIGVNLAHAPEAGTLEARALPAVTLREAGANVTAEDFLNVLAQEYAGLE 177

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D +    G   I + W   A  +G++IT +     I G F  VD  G L+L  + G V  
Sbjct: 178 DQFTT-YGFATIRSAWLAHAARLGEVITARTMRDEITGVFEDVDSAGNLILRTRDGAV-S 235

Query: 245 IFTGDIF 251
           I   D+F
Sbjct: 236 ITAADVF 242


>gi|254237139|ref|ZP_04930462.1| BirA bifunctional protein [Pseudomonas aeruginosa C3719]
 gi|126169070|gb|EAZ54581.1| BirA bifunctional protein [Pseudomonas aeruginosa C3719]
          Length = 323

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 85  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  D  +KWPND+L   +KIAGIL+E       L
Sbjct: 145 GGARELEGLSLVVGLAVLRALES-LGV-RDAGLKWPNDLLQGGKKIAGILLELSGDPADL 202

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 203 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 262

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 263 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVDG--VEQGFSG 314


>gi|312110477|ref|YP_003988793.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y4.1MC1]
 gi|311215578|gb|ADP74182.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y4.1MC1]
          Length = 329

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 117/241 (48%), Gaps = 11/241 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            F + ++ST    +K A  G      ++A  QTAGRGR D KW S KG  ++ SL+L   
Sbjct: 91  HFEEEVTSTQQIALKLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMSLILRPP 150

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E     + +
Sbjct: 151 IPPQKAPQLTLLTAVAIAQAIQEITDIVPD--IKWPNDILINGKKCVGILTELQADPDRI 208

Query: 136 QAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK-- 189
            +V+VGIG+NV       P +     TSL  E G  +      L+ + + R+  L+K+  
Sbjct: 209 HSVIVGIGINVNQTIEQFPEEIRAIATSLSIEKG--ERIQRAKLIQEILLRLEYLYKQYL 266

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G   I  LW  +A  IG  I  +   G++ G  +G+ D G L+LE++   +  I + D
Sbjct: 267 QYGFRPIKLLWEGYAASIGKEIVARTLTGTMKGIAIGITDEGVLMLEDENKQIHYIHSAD 326

Query: 250 I 250
           I
Sbjct: 327 I 327


>gi|229172274|ref|ZP_04299838.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus MM3]
 gi|228611262|gb|EEK68520.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus MM3]
          Length = 290

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT GRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTTGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGEPIVRAELMQQIFLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEITARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|229010947|ref|ZP_04168143.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides DSM
           2048]
 gi|229058274|ref|ZP_04196661.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH603]
 gi|229132446|ref|ZP_04261300.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST196]
 gi|229166484|ref|ZP_04294240.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH621]
 gi|228617058|gb|EEK74127.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH621]
 gi|228651152|gb|EEL07133.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST196]
 gi|228720045|gb|EEL71631.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus AH603]
 gi|228750347|gb|EEM00177.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides DSM
           2048]
          Length = 286

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     + A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWYSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + K+ 
Sbjct: 166 AVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLKN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 225 GFSVIKILWESYAVSIGKEITARTMKETINGLAKGITEDGVLLLEDHQGQVHHIHSADI 283


>gi|228914212|ref|ZP_04077828.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228932925|ref|ZP_04095790.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945236|ref|ZP_04107592.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228984716|ref|ZP_04144888.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228774914|gb|EEM23308.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228814471|gb|EEM60736.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826728|gb|EEM72497.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228845416|gb|EEM90451.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 286

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 48  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 166 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 225 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 283


>gi|229155202|ref|ZP_04283314.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           4342]
 gi|228628329|gb|EEK85044.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus ATCC
           4342]
          Length = 290

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|261417982|ref|YP_003251664.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC61]
 gi|297529650|ref|YP_003670925.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus sp. C56-T3]
 gi|319767206|ref|YP_004132707.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC52]
 gi|261374439|gb|ACX77182.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC61]
 gi|297252902|gb|ADI26348.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus sp. C56-T3]
 gi|317112072|gb|ADU94564.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. Y412MC52]
          Length = 329

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 114/240 (47%), Gaps = 9/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            FFD + ST     + A  G      +VA  Q AGRGR D KW S KG  ++ SL+L  +
Sbjct: 91  HFFDEVDSTQRIAARLAYEGAPEGTLVVAEEQKAGRGRLDRKWFSPKGTGIWMSLILRPA 150

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPNDIL+  RK  GIL E     + +
Sbjct: 151 IPPQRAPQLTLLAAVAVSQAIQEVTGLVPD--IKWPNDILLDGRKCVGILTELQADPDRV 208

Query: 136 QAVVVGIGLNVKHC----PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
            +V++GIG+NV       P D     TSL  E GG +    +   +   + R+ + +   
Sbjct: 209 HSVIIGIGINVNQTIEQFPEDIRAIATSLAIEKGGPVKRAPLIQEILFRLERLYEQYLAH 268

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW  +A  IG  +T +   G I G   G+ D G L+LE+++  +  I + DI
Sbjct: 269 -GFRPIKLLWEGYAVSIGKPVTARTLNGVIHGIARGITDDGLLILEDEQKNIHYIHSADI 327


>gi|301156028|emb|CBW15499.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Haemophilus parainfluenzae T3T1]
          Length = 304

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 88/233 (37%), Positives = 119/233 (51%), Gaps = 18/233 (7%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           +S   +PYS  Y    TISSTN+   ++      G+L  +A  QTAGRGRR  +W+S   
Sbjct: 65  ISTTLSPYSVHYH--RTISSTNEFISRQIEQLKKGDL-CLAEYQTAGRGRRGRQWLSPFA 121

Query: 64  GNLYASLL-LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           G L  S    ID   K +L  LS  I +A    IA  L    +VK+KWPNDIL+  RK+ 
Sbjct: 122 GQLIFSFYWTIDP--KKALDGLSLVIGLA----IAEAL----NVKVKWPNDILLSGRKLG 171

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDV 180
           GIL+E +N KNGL  +V+GIG+NVK  P  T    P   L  +   ID + I   + Q +
Sbjct: 172 GILVEIINNKNGLLNLVIGIGINVK-LPQSTEISQPYAQLTEQDPNIDRETILIKVIQRI 230

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
              L  +++    EE M  W       GD + +    G+I G   G+D  GYL
Sbjct: 231 YSRLAKFEEKGIDEEFMQQWINHNEFFGDEVNVFTEQGAISGIEQGIDKRGYL 283


>gi|157827311|ref|YP_001496375.1| biotin-(acetyl-CoA carboxylase) ligase [Rickettsia bellii OSU
           85-389]
 gi|157802615|gb|ABV79338.1| Biotin-(acetyl-CoA carboxylase) ligase [Rickettsia bellii OSU
           85-389]
          Length = 266

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 124/248 (50%), Gaps = 28/248 (11%)

Query: 15  RYEFF--DTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYASLL 71
           RY+ F  D + STN E ++ A S      +I+ A  QT GRGR    W S  GNL+ SLL
Sbjct: 5   RYKLFVFDELDSTNLEAIRIAKSNKPDRDYIILAKSQTKGRGRSGKNWQSTLGNLHVSLL 64

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLP----------------------VGTDVKIK 109
           +  +   + L  LSF  A+A+   +   +P                      V   +++K
Sbjct: 65  IKPNKELELLPQLSFVTALAVYDSMVHVIPWLDHGIQKINEIPIQARGMTPLVLKKIQLK 124

Query: 110 WPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL-QREGGCID 168
           WPND+LV  +KI+GIL+E++ +++    +++G+G+N+ + P++   P TSL   E   I 
Sbjct: 125 WPNDVLVGGKKISGILLESVKVEDAY-YLIIGVGINITYHPINIDQPTTSLVAEELPIIT 183

Query: 169 LKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
            + +  +L ++  +   +W+K+ G   I   W   A  +   I++K     + G F G+D
Sbjct: 184 PQALLEILIENFEKYYQIWEKN-GFSFIRGTWLKHAYKLHKNISVKYQNNIVTGTFQGID 242

Query: 229 DFGYLLLE 236
             G ++L+
Sbjct: 243 SIGRIILQ 250


>gi|163939454|ref|YP_001644338.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus weihenstephanensis
           KBAB4]
 gi|163861651|gb|ABY42710.1| biotin--acetyl-CoA-carboxylase ligase [Bacillus weihenstephanensis
           KBAB4]
          Length = 326

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     + A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAARLAYEGAEEGTIVVAEEQTAGRGRLSRKWYSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + K+ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLKN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEITARTMKETINGLAKGITEDGVLLLEDHQGQVHHIHSADI 323


>gi|331091973|ref|ZP_08340805.1| hypothetical protein HMPREF9477_01448 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402872|gb|EGG82439.1| hypothetical protein HMPREF9477_01448 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 545

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 131/256 (51%), Gaps = 46/256 (17%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLIDSIS 77
           ++ I STN E ++ A +G+     +VA  Q AGRGRR   W S D+ N+Y SLLL    S
Sbjct: 303 YEEIDSTNAEALRLAKAGESHGTLVVAKKQYAGRGRRGRTWESEDEENIYMSLLLRPEFS 362

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                +L+  +A ++  V+     +  DV IKWPND+++ ++KI GIL E    +N + +
Sbjct: 363 AGKAPMLTLVMAYSVAKVLREQENL--DVIIKWPNDLVIGKKKICGILTEMKMEENKISS 420

Query: 138 VVVGIGL--NVKHCPVDTPYPVTSLQREGG----CIDLKDIFSLLFQDVARVLDLWKKDT 191
           V++G+G+  NV+  P +     TSL+RE G    C DL          +A++++ ++++ 
Sbjct: 421 VIIGVGINVNVESFPRELRDKATSLRREAGREFCCTDL----------IAKIMESFEQNY 470

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSIL---GRFV--------------GVDDFGYLL 234
                      +   + DL  I+  Y  IL   G+ V              G+++ G LL
Sbjct: 471 N----------YFSEVEDLSFIQEEYNEILVNCGKQVRILEPHNEYEAVALGINEEGELL 520

Query: 235 LEEKKGCVRQIFTGDI 250
           +E++ G + ++F G++
Sbjct: 521 VEKETGEIERVFAGEV 536


>gi|116052314|ref|YP_788839.1| biotin--protein ligase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296387163|ref|ZP_06876662.1| biotin--protein ligase [Pseudomonas aeruginosa PAb1]
 gi|115587535|gb|ABJ13550.1| BirA bifunctional protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 312

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E   T+ STN E M+R  +G      IVA  QTAGRGRR   W+S  G NLY SL +   
Sbjct: 74  EIMPTVDSTNSEAMRRLAAGASTPFVIVAEQQTAGRGRRGRAWVSPYGENLYYSLAITVR 133

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   + S L V  +  +KWPND+L   +KIAGIL+E       L
Sbjct: 134 GGARELEGLSLVVGLAVLRALES-LGV-REAGLKWPNDVLQGGKKIAGILLELSGDPADL 191

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
             VV+GIG+NV      D   P TSL+   G  +D   + S L + +A  LD   ++   
Sbjct: 192 CHVVIGIGINVNMKTATDIGQPWTSLREALGELVDRSRLLSALNRQLADYLDRHSREGFA 251

Query: 191 TGREEIM--NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             REE    NLW+      G  + +  +  SI GR +GVD  G L LE     V Q F+G
Sbjct: 252 ASREEWESCNLWQ------GAQVILSTALSSIEGRVLGVDSRGALRLEVD--GVEQGFSG 303


>gi|254511677|ref|ZP_05123744.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535388|gb|EEE38376.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacteraceae bacterium
           KLH11]
          Length = 249

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 114/247 (46%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +       + ST +E  + A +   G +WI+A  QTA RGRR   W + KGNL A+L
Sbjct: 5   PQGYGLHVLQEVDSTLNEAARLAPTAS-GPVWIMAHRQTAARGRRGRAWSNPKGNLAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           L+      +   L SF  A+A+     +       + +KWPND+++   K+AGIL+E+  
Sbjct: 64  LMRPPGDPEQAALRSFVAALALFDACVAVTGRAAGLSLKWPNDVVLNGGKLAGILLESTG 123

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
              G+  + +GIG+N+   P           PV+ L   G  +  +D  + L    A   
Sbjct: 124 QGRGVSHLAIGIGVNLSEAPGAESVEPGAVRPVSLLSETGAHVTPEDFLAELAVAYAH-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +      G + I   W   A  +G++IT + +    +G F  VD  G L+L   KG V  
Sbjct: 183 ETQFMTYGFQPIRTAWLNRAARLGEVITARTAVSETVGTFETVDAGGSLVLNTAKGRV-S 241

Query: 245 IFTGDIF 251
           I   D++
Sbjct: 242 IPAADVY 248


>gi|56420715|ref|YP_148033.1| biotin [acetyl-CoA carboxylase] synthetase; transcriptional
           repressor of the biotin operon [Geobacillus kaustophilus
           HTA426]
 gi|56380557|dbj|BAD76465.1| biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Geobacillus kaustophilus
           HTA426]
          Length = 329

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 114/240 (47%), Gaps = 9/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            FFD + ST     + A  G      +VA  Q AGRGR D KW S KG  ++ SL+L  +
Sbjct: 91  HFFDEVDSTQRIAARLAYEGAPEGTLVVAEEQKAGRGRLDRKWFSPKGTGIWMSLILRPA 150

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPNDIL+  RK  GIL E     + +
Sbjct: 151 IPPQRAPQLTLLAAVAVSQAIQEVTGLVPD--IKWPNDILLDGRKCVGILTELQADPDRV 208

Query: 136 QAVVVGIGLNVKHC----PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
            +V++GIG+NV       P D     TSL  E GG +    +   +   + R+ + +   
Sbjct: 209 HSVIIGIGINVNQTIEQFPEDIRTIATSLAIEKGGPVKRAPLIQEILFRLERLYEQYLAH 268

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW  +A  IG  +T +   G I G   G+ D G L+LE+++  +  I + DI
Sbjct: 269 -GFRPIKLLWEGYAVSIGKPVTARTLNGVIHGIARGITDDGLLILEDEQKDIHYIHSADI 327


>gi|313632657|gb|EFR99636.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria seeligeri FSL
           N1-067]
          Length = 326

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  D+++ST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHDSVTSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SLQ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWEAKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGVVHSIYSADIL 320


>gi|206974884|ref|ZP_03235799.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus H3081.97]
 gi|206746903|gb|EDZ58295.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus H3081.97]
          Length = 326

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I +    G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVQHAPQLTLLAAVSVAQAIENF--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|30261633|ref|NP_844010.1| birA bifunctional protein [Bacillus anthracis str. Ames]
 gi|47526834|ref|YP_018183.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|47566000|ref|ZP_00237038.1| biotin protein ligase C terminal domain family [Bacillus cereus
           G9241]
 gi|49184464|ref|YP_027716.1| birA bifunctional protein [Bacillus anthracis str. Sterne]
 gi|65318902|ref|ZP_00391861.1| COG0340: Biotin-(acetyl-CoA carboxylase) ligase [Bacillus anthracis
           str. A2012]
 gi|165869555|ref|ZP_02214214.1| birA bifunctional protein [Bacillus anthracis str. A0488]
 gi|167633380|ref|ZP_02391705.1| birA bifunctional protein [Bacillus anthracis str. A0442]
 gi|167639042|ref|ZP_02397315.1| birA bifunctional protein [Bacillus anthracis str. A0193]
 gi|170686025|ref|ZP_02877247.1| birA bifunctional protein [Bacillus anthracis str. A0465]
 gi|170706401|ref|ZP_02896861.1| birA bifunctional protein [Bacillus anthracis str. A0389]
 gi|177650433|ref|ZP_02933400.1| birA bifunctional protein [Bacillus anthracis str. A0174]
 gi|190568631|ref|ZP_03021536.1| birA bifunctional protein [Bacillus anthracis Tsiankovskii-I]
 gi|196033378|ref|ZP_03100790.1| birA bifunctional protein [Bacillus cereus W]
 gi|218902748|ref|YP_002450582.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH820]
 gi|227815616|ref|YP_002815625.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CDC 684]
 gi|229602333|ref|YP_002866040.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A0248]
 gi|254683125|ref|ZP_05146986.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CNEVA-9066]
 gi|254723713|ref|ZP_05185499.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A1055]
 gi|254734473|ref|ZP_05192185.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Western North America USA6153]
 gi|254740885|ref|ZP_05198573.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Kruger B]
 gi|254755123|ref|ZP_05207157.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Vollum]
 gi|254759660|ref|ZP_05211684.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Australia 94]
 gi|301053174|ref|YP_003791385.1| biotin operon repressor [Bacillus anthracis CI]
 gi|30255861|gb|AAP25496.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. Ames]
 gi|47501982|gb|AAT30658.1| birA bifunctional protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|47556917|gb|EAL15247.1| biotin protein ligase C terminal domain family [Bacillus cereus
           G9241]
 gi|49178391|gb|AAT53767.1| birA bifunctional protein [Bacillus anthracis str. Sterne]
 gi|164714995|gb|EDR20513.1| birA bifunctional protein [Bacillus anthracis str. A0488]
 gi|167512832|gb|EDR88205.1| birA bifunctional protein [Bacillus anthracis str. A0193]
 gi|167531418|gb|EDR94096.1| birA bifunctional protein [Bacillus anthracis str. A0442]
 gi|170128499|gb|EDS97366.1| birA bifunctional protein [Bacillus anthracis str. A0389]
 gi|170669722|gb|EDT20463.1| birA bifunctional protein [Bacillus anthracis str. A0465]
 gi|172083577|gb|EDT68637.1| birA bifunctional protein [Bacillus anthracis str. A0174]
 gi|190560231|gb|EDV14211.1| birA bifunctional protein [Bacillus anthracis Tsiankovskii-I]
 gi|195993812|gb|EDX57768.1| birA bifunctional protein [Bacillus cereus W]
 gi|218536589|gb|ACK88987.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH820]
 gi|227006228|gb|ACP15971.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. CDC 684]
 gi|229266741|gb|ACQ48378.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus anthracis str. A0248]
 gi|300375343|gb|ADK04247.1| biotin operon repressor [Bacillus cereus biovar anthracis str. CI]
 gi|324325653|gb|ADY20913.1| biotin operon repressor [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 326

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|49480998|ref|YP_035753.1| biotin operon repressor [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|49332554|gb|AAT63200.1| biotin operon repressor [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 326

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGRPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|229195838|ref|ZP_04322597.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1293]
 gi|228587611|gb|EEK45670.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus m1293]
          Length = 317

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVQHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|229084644|ref|ZP_04216912.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-44]
 gi|228698667|gb|EEL51384.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-44]
          Length = 286

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  +I
Sbjct: 48  FEESVESTQHIAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPAI 107

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I     +G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 108 PVHHAPQLTLLAAVSVAQAIEKC--IGVNVGIKWPNDILIEGKKAVGILTEMQADPDKIN 165

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + K+ 
Sbjct: 166 AVIMGIGINANQSKEHFADEIKEIATSLAIESGKPIVRAELMQQIFLQMEKLYEEYIKN- 224

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+   G L+LE++ G +  I + DI
Sbjct: 225 GFSVIKLLWESYAISIGKEITARTMKETITGTAKGITADGVLILEDRTGHIHHIHSADI 283


>gi|229138331|ref|ZP_04266925.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST26]
 gi|228645096|gb|EEL01334.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           BDRD-ST26]
          Length = 317

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVQHAPQLTLLAAVSVAQAIEKF--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIHSADI 314


>gi|313637212|gb|EFS02728.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria seeligeri FSL
           S4-171]
          Length = 326

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  D+++ST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHDSVTSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SLQ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGVVHSIYSADIL 320


>gi|229115084|ref|ZP_04244494.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-3]
 gi|228668224|gb|EEL23656.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock1-3]
          Length = 317

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDEEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIHSADI 314


>gi|217959118|ref|YP_002337666.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH187]
 gi|222095267|ref|YP_002529327.1| bira bifunctional protein [Bacillus cereus Q1]
 gi|217062936|gb|ACJ77186.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus AH187]
 gi|221239325|gb|ACM12035.1| bira bifunctional protein [Bacillus cereus Q1]
          Length = 326

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVQHAPQLTLLAAVSVAQAIEKF--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|162148798|ref|YP_001603259.1| biotin--[acetyl-CoA-carboxylase] synthetase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787375|emb|CAP56970.1| putative biotin--[acetyl-CoA-carboxylase] synthetase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 260

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 14/246 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R E  D + ST+D C+ RA  G+   L ++A  QT GRG R   W    GNL  S+LL 
Sbjct: 18  WRLEIHDELDSTSDTCLARAGQGERSGLAVMARRQTRGRGSRGRDWQDPGGNLAFSVLLR 77

Query: 74  DSISKD-SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                +  + L  F   +A    IA  +P    +++KWPND+L+  RK AGILIE     
Sbjct: 78  PGGKGEWPVGLWPFIAGLAFHGAIAPWIPHPISLRLKWPNDLLLEGRKAAGILIEAGTDS 137

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK--- 189
           +G + +V+G G N++  P  T   +  +   G   + +    ++ + +   LD W     
Sbjct: 138 SG-RLLVIGFGANLRAAPAITGRDLACVAEYGTAPEPE----IVARAICAGLDHWMAVCG 192

Query: 190 ----DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G E +   W   A  +G  + ++   G + G F G+D  G LLL    G +++I
Sbjct: 193 GQGDGLGFEAVRQAWLAHAHPMGTRLVVRAESGQVEGSFAGLDAQGMLLLRCADG-LKRI 251

Query: 246 FTGDIF 251
            TG+I 
Sbjct: 252 STGEIL 257


>gi|239827471|ref|YP_002950095.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. WCH70]
 gi|239807764|gb|ACS24829.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. WCH70]
          Length = 329

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 121/244 (49%), Gaps = 12/244 (4%)

Query: 15  RY-EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL 72
           RY  F + ++ST    ++ A  G      ++A  QTAGRGR D KW S KG  ++ SL+L
Sbjct: 88  RYIHFEEEVTSTQKIALRLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMSLIL 147

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E     
Sbjct: 148 RPPIPPQKAPQLTLLTAVAIAQAIQEKANIVPD--IKWPNDILINGKKCVGILTELQADP 205

Query: 133 NGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           + + +V++G+G+NV       P +     TSL  E G  +      L+ + + R+  L++
Sbjct: 206 DRIHSVIIGMGINVNQTLDQFPEEIRTIATSLAIEKG--ERIQRAQLVQEILLRLERLYQ 263

Query: 189 K--DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           +    G   I  LW  +A  IG  IT +   G+I G  +G+ D G L+LE+++  +  I 
Sbjct: 264 QYLQYGFRPIKLLWEGYATSIGKEITARTLNGTIKGIALGITDEGVLMLEDEEKHIHYIH 323

Query: 247 TGDI 250
           + DI
Sbjct: 324 SADI 327


>gi|229102240|ref|ZP_04232949.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-28]
 gi|228681141|gb|EEL35309.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus
           Rock3-28]
          Length = 317

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  SI
Sbjct: 79  FEESVESTQHIAAKLAYEGVEEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPSI 138

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 139 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 196

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 197 AVIMGIGINANQKQEHFDKEIQQIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+ + G LLLE+ +G +  I + DI
Sbjct: 256 GFSVIKILWESYAVSIGKEITARTMRQTITGLAKGITEEGVLLLEDHEGKIHHIHSADI 314


>gi|295398916|ref|ZP_06808898.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978382|gb|EFG53978.1| biotin/acetyl-CoA-carboxylase ligase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 329

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 117/241 (48%), Gaps = 11/241 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            F + ++ST    +K A  G      ++A  QTAGRGR D KW S KG  ++ SL+L   
Sbjct: 91  HFEEEVTSTQQIALKLAYEGAKEGTLVIAEQQTAGRGRMDRKWFSPKGTGIWMSLILRPP 150

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPNDIL+  +K  GIL E     + +
Sbjct: 151 IPPQKAPQLTLLTAVAIAQAIQEITDIVPD--IKWPNDILINGKKCVGILTELQADPDRI 208

Query: 136 QAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK-- 189
            +V+VGIG+NV       P +     TSL  E G  +      L+ + + R+  L+K+  
Sbjct: 209 HSVIVGIGINVNQTIEQFPEEIRAIATSLSIEKG--ERIQRAKLIQEILLRLEYLYKQYL 266

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G   I  LW  +A  IG  I  +   G++ G  +G+ D G L+LE++   +  I + D
Sbjct: 267 QYGFRPIKLLWEGYAASIGKEIVARTLTGTMKGIALGITDEGVLMLEDENKQIHYIHSAD 326

Query: 250 I 250
           I
Sbjct: 327 I 327


>gi|157825805|ref|YP_001493525.1| biotin--protein ligase [Rickettsia akari str. Hartford]
 gi|157799763|gb|ABV75017.1| biotin--protein ligase [Rickettsia akari str. Hartford]
          Length = 267

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 122/248 (49%), Gaps = 27/248 (10%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FDT+ ST+ E M+   +  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDTLDSTSSEAMRIVQNAKVDSNYAVLAKSQTNGRGRNGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIAS-------TLPVGTD----------------VKIK 109
                   L  LSF  A+A+   ++S       + P   D                +++K
Sbjct: 66  KPDKELALLPQLSFVTALAIYDCMSSRGLTTGSSKPTTNDTVSCVLEPVVKPRDDIIQLK 125

Query: 110 WPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCID 168
           WPND+LV  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+
Sbjct: 126 WPNDVLVNGRKIAGILLESVKIENNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPIE 184

Query: 169 LKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVD 228
            + +   L ++  +   +W  + G   I   W   A  + + I++K     I G F  +D
Sbjct: 185 TQALLQKLIENFEKYYQIW-HNNGFSFIRQKWLEHAYKLHENISVKHQNDIITGLFKDID 243

Query: 229 DFGYLLLE 236
           + G ++L+
Sbjct: 244 NTGRIILQ 251


>gi|209545454|ref|YP_002277683.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533131|gb|ACI53068.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 260

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 14/246 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +R E  D + ST+D C+ RA  G+   L ++A  QT GRG R   W    GNL  S+LL 
Sbjct: 18  WRLEIHDELDSTSDTCLARAGQGERSGLAVMARRQTRGRGSRGRDWQDPGGNLAFSVLLR 77

Query: 74  DSISKD-SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                +  + L  F   +A    IA  +P    +++KWPND+L+  RK AGILIE     
Sbjct: 78  PGGKGEWPVGLWPFIAGLAFHGAIAPWIPHPISLRLKWPNDLLLEGRKAAGILIEAGTDS 137

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK--- 189
           +G + +V+G G N++  P  T   +  +   G   + +    ++ + +   LD W     
Sbjct: 138 SG-RWLVIGFGANLRAAPAITGRDLACVAEYGTAPEPE----IVARAICAGLDHWMAVCG 192

Query: 190 ----DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G E +   W   A  +G  + ++   G + G F G+D  G LLL    G +++I
Sbjct: 193 GQGDGLGFEAVRQAWLAHAHPMGTRLVVRAESGQVEGSFAGLDAQGMLLLRCADG-LKRI 251

Query: 246 FTGDIF 251
            TG+I 
Sbjct: 252 STGEIL 257


>gi|238019649|ref|ZP_04600075.1| hypothetical protein VEIDISOL_01523 [Veillonella dispar ATCC 17748]
 gi|237863690|gb|EEP64980.1| hypothetical protein VEIDISOL_01523 [Veillonella dispar ATCC 17748]
          Length = 324

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 117/249 (46%), Gaps = 18/249 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L    +       +   AVA+         +G TD  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFAPVEAPKCTLMAAVALTKAFHK---MGLTDAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR--- 182
                +  +V+GIG+NVK      P +     TSL  EG  I+  + F ++ + +     
Sbjct: 195 GSMEEISYIVMGIGVNVKTKQEELPEELKLIATSLTMEGIDIERTEAFKIILESLEHQYY 254

Query: 183 -VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            VL     D+G EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G 
Sbjct: 255 EVL-----DSGFEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGT 309

Query: 242 VRQIFTGDI 250
           V++I  GD+
Sbjct: 310 VKRIMAGDV 318


>gi|229183831|ref|ZP_04311048.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus BGSC
           6E1]
 gi|228599680|gb|EEK57283.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus cereus BGSC
           6E1]
          Length = 290

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT+GRGR   KW S KG  ++ S++L  SI
Sbjct: 52  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSIILRPSI 111

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 112 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 169

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 170 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 228

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 229 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 287


>gi|126736044|ref|ZP_01751788.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. CCS2]
 gi|126714601|gb|EBA11468.1| biotin--acetyl-CoA-carboxylase ligase [Roseobacter sp. CCS2]
          Length = 264

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 83/253 (32%), Positives = 128/253 (50%), Gaps = 18/253 (7%)

Query: 9   QNPYSFRYE--FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL 66
           Q P+   Y     DT+ ST  E  +RA + +    WI+A  QT  RGRR  +W+  +GNL
Sbjct: 19  QGPWPEGYARVVLDTVDSTMAEAARRAKNLERPT-WIMAKTQTDARGRRGREWVVPEGNL 77

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
            A+L+     +       SF  A A+   +A  + V   + +KWPND+L+   K+AGIL+
Sbjct: 78  NATLIFRPEATAAEAAKRSFLAANALYQALAIYVNV-DKLALKWPNDVLLSGGKVAGILL 136

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCP---VDTPYPVTSLQR-EGGCIDLKD-IFSL---LFQ 178
           E+      +  + +GIG+N++H P    DT +P TSL    GG +D +D +F+L      
Sbjct: 137 ESSGQGPFVDWLSIGIGVNLQHTPEGVTDTLFPPTSLADGGGGTVDPQDFLFTLADAYAT 196

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
             A++L L     G + I + W   A  +G++IT + +   I G F  +D  G L+L   
Sbjct: 197 QEAKLLRL-----GFDRIRDDWLASAARLGEVITARTTREEITGIFDSIDHDGNLVLITG 251

Query: 239 KGCVRQIFTGDIF 251
            G  R I   D+F
Sbjct: 252 TGP-RAIPAADVF 263


>gi|325578651|ref|ZP_08148727.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325159690|gb|EGC71821.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 304

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 87/231 (37%), Positives = 117/231 (50%), Gaps = 24/231 (10%)

Query: 10  NPYSFRYEFFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGN 65
           +PY   Y  + TISSTN+     + +   GDL     +A  QTAGRGRR  +W+S   G 
Sbjct: 70  SPYFVHY--YRTISSTNEFITNHINQLKKGDL----CLAEYQTAGRGRRGRQWLSPFAGQ 123

Query: 66  LYASLL-LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           L  S    ID   K +L  LS  I +A    IA  L    +VK+KWPNDIL+  RK+ GI
Sbjct: 124 LIFSFYWTIDP--KKALDGLSLVIGLA----IAEAL----NVKVKWPNDILLSGRKLGGI 173

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           L+E +N KNG   +VVGIG+NVK  P  T    P   L  +   ID + I   + Q +  
Sbjct: 174 LVEIINHKNGQLNLVVGIGINVK-LPQSTEISQPYAQLTEQNPNIDRETILVKVIQRIYS 232

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            L  +++    EE M  W  +    GD + +    G+I G   G+D  GYL
Sbjct: 233 RLAQFEEKGIDEEFMQQWINYNEFFGDEVNVFTEQGAISGIEQGIDKRGYL 283


>gi|157964572|ref|YP_001499396.1| biotin-(acetyl-CoA carboxylase) ligase [Rickettsia massiliae MTU5]
 gi|157844348|gb|ABV84849.1| Biotin-(acetyl-CoA carboxylase) ligase [Rickettsia massiliae MTU5]
          Length = 270

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 125/257 (48%), Gaps = 21/257 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD + ST+ E M+ A +  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDKLDSTHSEAMRMAQNTKVDANYAVLAKSQTNGRGRSGKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-----------------VKIKWPNDIL 115
                 + L  LSF  A+++   I S     +                  +++KWPND+L
Sbjct: 66  KPDKELELLPQLSFVTALSVYDSITSLCHSHSALCHSRESRHDIRNENNIIQLKWPNDVL 125

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFS 174
           +  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E    I+ + +  
Sbjct: 126 INGRKIAGILLESVKVENNY-YLIIGIGINITYHPDNIDQPTTSLISENLPPIEAQALLE 184

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           +L ++      +W  + G   I   W   A  + + I++K     + G F  +D+ G ++
Sbjct: 185 ILIENFEEYYQIWHSN-GFPFIRKKWLEHAYKLYENISVKYQNDIVTGLFKDIDNTGRII 243

Query: 235 LEEKKGCVRQIFTGDIF 251
           L+     +    T ++F
Sbjct: 244 LQLPSKKIISFSTAELF 260


>gi|149204774|ref|ZP_01881737.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. TM1035]
 gi|149141743|gb|EDM29796.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. TM1035]
          Length = 252

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 117/249 (46%), Gaps = 13/249 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +      ++ STN E  +  L+  L G  WI+A  QTA RGRR   W +  GN  A+
Sbjct: 8   PQGYGRRVLASVDSTNAEAAR--LAPHLAGPEWILAHQQTAARGRRGRAWANPAGNFAAT 65

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++  + S D + L SF  ++A+   + +         +KWPND+L+   K+AGIL+E+ 
Sbjct: 66  LVMRPTESPDRVALRSFVASLALFDALVAATGRAEVFALKWPNDVLLNGGKLAGILLESA 125

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPY------PVTSLQREGGCIDLKDIFSLLFQDVARV 183
                L    +GIG+N+   P  +        PV+ L   G  ID +    LL    AR 
Sbjct: 126 GAGGSLSHFAIGIGVNLHSAPEVSEVEPGALRPVSLLSETGIAIDPEAFLDLLAPAYARA 185

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +      G   I   W   A  +G++IT + +     GRF  VD+ G L+L   +G  R
Sbjct: 186 -EAQFVTYGFAPIRTAWLARAARLGEVITARTTREVYEGRFETVDEAGNLVLLTAQG--R 242

Query: 244 Q-IFTGDIF 251
           Q I   ++F
Sbjct: 243 QAIAAAEVF 251


>gi|118477090|ref|YP_894241.1| biotin operon repressor [Bacillus thuringiensis str. Al Hakam]
 gi|118416315|gb|ABK84734.1| biotin operon repressor [Bacillus thuringiensis str. Al Hakam]
          Length = 334

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT+GRGR   KW S KG  ++ S++L  SI
Sbjct: 96  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSIILRPSI 155

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 156 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 213

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 214 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 272

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 273 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKVHHIHSADI 331


>gi|297565563|ref|YP_003684535.1| biotin/acetyl-CoA-carboxylase ligase [Meiothermus silvanus DSM
           9946]
 gi|296850012|gb|ADH63027.1| biotin/acetyl-CoA-carboxylase ligase [Meiothermus silvanus DSM
           9946]
          Length = 248

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 123/259 (47%), Gaps = 30/259 (11%)

Query: 1   MFSNLSE------CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGR 54
           MF  LS        + P    Y + +  SST D     A  G      +VA  Q  GRGR
Sbjct: 1   MFGELSPEALLPLLETPLGRTYRYLERTSSTQDVAKAWAEEGAPEGALVVAETQQKGRGR 60

Query: 55  RDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPND 113
           R   W S  G +L  SLLL   I  +   LLSFA  VA+R        VG    +KWPND
Sbjct: 61  RGRPWQSAPGESLTFSLLLRPQIPSERFPLLSFAAGVALREACG----VG---GLKWPND 113

Query: 114 ILVFQ-RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI 172
           +L    RK+AGIL+E      G   VV+GIGLNV   P     P  +   E G ++   +
Sbjct: 114 LLAPDGRKLAGILLEA-----GRGYVVLGIGLNVHKAP-----PGAAALAEFGLVERPKV 163

Query: 173 FSLLFQDVARVLDLWKKDTGR-EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
            +       R+  L+    G+  +I++ WR ++  +G  ++++   GS+ GR + + + G
Sbjct: 164 LAGFLN---RLGHLYPALEGQASQILSAWRRYSLTLGREVSLETPQGSLQGRAMDIAEDG 220

Query: 232 YLLLEEKKGCVRQIFTGDI 250
            L + E  G +R++ +GD+
Sbjct: 221 SLWV-EVSGTIRRVTSGDV 238


>gi|325958520|ref|YP_004289986.1| biotin/acetyl-CoA-carboxylase ligase [Methanobacterium sp. AL-21]
 gi|325329952|gb|ADZ09014.1| biotin/acetyl-CoA-carboxylase ligase [Methanobacterium sp. AL-21]
          Length = 323

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 119/242 (49%), Gaps = 16/242 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
            +F+ + STN+     A  G      +VA  Q  G+GRR   WIS  G ++ S++L   I
Sbjct: 83  HYFNEVDSTNEVAKYLAEEGAEDGTVVVAEIQNKGKGRRGKTWISPPGGIWMSVILRPEI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + L+    V +   I   L +  DV IKWPNDIL+ ++K+ GIL E     + + 
Sbjct: 143 PPHRASQLTLVTGVVVAKTIKEELNI--DVGIKWPNDILIGKKKVCGILTEVNATLDKVN 200

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD---VARVLDLWK----- 188
            +VVGIG+++    VD P   + LQ+  G   LK+  +        V R L  ++     
Sbjct: 201 YLVVGIGIDMN---VDVPMLPSDLQK--GATSLKNELNTEINGALLVQRFLQNFENIYND 255

Query: 189 -KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            KD    EI++ WR  +  IG  + ++     + G  VG++  G L++E + G +R++ +
Sbjct: 256 FKDGKFPEILDEWRAMSSTIGTSVEVRTRGKRVQGYAVGINKEGILIIEMEDGSLRKMIS 315

Query: 248 GD 249
           G+
Sbjct: 316 GE 317


>gi|124441841|gb|ABN11538.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441845|gb|ABN11541.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441849|gb|ABN11544.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441869|gb|ABN11559.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441873|gb|ABN11562.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441877|gb|ABN11565.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
 gi|124441881|gb|ABN11568.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus subtilis]
          Length = 319

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 130/263 (49%), Gaps = 23/263 (8%)

Query: 4   NLSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
            LSE +  +  + E       + D ISST     + A +       +VA  QTAGRGR  
Sbjct: 61  KLSESEIRFGLKTEVMGQHLIYQDVISSTQKTAHELANNNAPEGTLVVADKQTAGRGRMS 120

Query: 57  NKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
             W S +GN ++ SL+L   I       L+   AVA+   I +   + TD  IKWPNDIL
Sbjct: 121 RVWHSQEGNGIWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEAAAGIQTD--IKWPNDIL 178

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLK 170
           +  +K  GIL E    ++ +++V++GIG+NV     D P  +    TSL Q  G  ID  
Sbjct: 179 INGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQSDDFPDELKDIATSLSQASGEKIDRA 238

Query: 171 DIFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
            +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+
Sbjct: 239 GVIQHILLCFE--KRYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGI 294

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           DD G LLLE ++G +++I++ DI
Sbjct: 295 DDEGVLLLETQEG-IKKIYSADI 316


>gi|296333018|ref|ZP_06875475.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674878|ref|YP_003866550.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|317374855|sp|E0U174|BIRA_BACPZ RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|773349|gb|AAB60184.1| BirA protein [Bacillus subtilis]
 gi|296149869|gb|EFG90761.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305413122|gb|ADM38241.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon repressor
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 325

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 130/263 (49%), Gaps = 23/263 (8%)

Query: 4   NLSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
            LSE +  +  + E       + D ISST     + A +       +VA  QTAGRGR  
Sbjct: 67  KLSESEIRFGLKTEVMGQHLIYQDVISSTQKTAHELANNNAPEGTLVVADKQTAGRGRMS 126

Query: 57  NKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
             W S +GN ++ SL+L   I       L+   AVA+   I +   + TD  IKWPNDIL
Sbjct: 127 RVWHSQEGNGIWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEAAAGIQTD--IKWPNDIL 184

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLK 170
           +  +K  GIL E    ++ +++V++GIG+NV     D P  +    TSL Q  G  ID  
Sbjct: 185 INGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQSDDFPDELKDIATSLSQASGEKIDRA 244

Query: 171 DIFS---LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
            +     L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+
Sbjct: 245 GVIQHILLCFEK--RYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGI 300

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           DD G LLLE ++G +++I++ DI
Sbjct: 301 DDEGVLLLETQEG-IKKIYSADI 322


>gi|212638966|ref|YP_002315486.1| biotin operon repressor containing HTH and biotin-(acetyl-CoA
           carboxylase) ligase domains [Anoxybacillus flavithermus
           WK1]
 gi|212560446|gb|ACJ33501.1| Biotin operon repressor containing HTH and biotin-(acetyl-CoA
           carboxylase) ligase domains [Anoxybacillus flavithermus
           WK1]
          Length = 329

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 120/243 (49%), Gaps = 9/243 (3%)

Query: 14  FRYEFFD--TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           F +  +D  ++ ST     + A  G      ++A  QTAGRGR +  W S KG  ++ S+
Sbjct: 85  FGWSVYDQESVPSTQQLAHQLAHEGAEEGTVVIAEEQTAGRGRLNRSWHSPKGTGIWMSI 144

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  SI       L+  +AVA+   I     +  D  IKWPNDIL+  +K+ GIL E   
Sbjct: 145 ILRPSIPLQQAPQLTLLVAVAVAETIQEITNIVPD--IKWPNDILINGKKVVGILTELQA 202

Query: 131 LKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLW 187
             + ++AV+VGIG+NV  K  P D     TSL  E G       I   L Q + ++ + +
Sbjct: 203 DPDQVRAVIVGIGMNVNQKQFPNDIAPIATSLAIETGRTFHRPKIVQTLLQKLEQLYEQY 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   I  LW  ++  IG  I  +   G+I G  +G+ D G L ++ + G +  I++
Sbjct: 263 LQH-GFLPIKLLWEGYSVTIGQQIVARTLNGAIRGVALGITDSGTLKVQTEDGAIHYIYS 321

Query: 248 GDI 250
            DI
Sbjct: 322 ADI 324


>gi|84502630|ref|ZP_01000749.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola batsensis
           HTCC2597]
 gi|84389025|gb|EAQ01823.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola batsensis
           HTCC2597]
          Length = 252

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 108/241 (44%), Gaps = 13/241 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            +T+ ST +E  +R   G     WI+A  QTA RGRR   W    GN  A+L+L  +   
Sbjct: 16  LETVDSTLNEAQRRFAGGINRPTWILALAQTAARGRRGRPWSMPPGNFAATLILPTTERP 75

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
           D + L SF  ++A+             + +KWPND+L+   K+AGIL+ETL         
Sbjct: 76  DRIALRSFTTSLALFDACVGATGRTEGLALKWPNDVLLNGGKLAGILLETLQSGGRTAGA 135

Query: 139 VVGIGLNVKHCPVDT--------PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            +GIG+N+   P  +        P  +T +   G     +D   LL Q   R    ++  
Sbjct: 136 AIGIGVNLASAPEVSEVEERALRPVALTGM---GASPPPEDFLELLAQAFDRYETQFRH- 191

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I   W   A  +G++IT +       GRF  +D+ G L+L    G  R I   DI
Sbjct: 192 YGFAPIRTAWLDRAAHLGEVITARTGMSETTGRFETIDETGQLVL-STDGSRRTIAAADI 250

Query: 251 F 251
           +
Sbjct: 251 Y 251


>gi|313608007|gb|EFR84107.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes FSL
           F2-208]
          Length = 325

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKNKASSLKLELGESISRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|313618191|gb|EFR90273.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria innocua FSL
           S4-378]
          Length = 325

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 122/239 (51%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E +++++ST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIYESVNSTQIIAHQQMNSSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKEKASSLKLELGESVSRKALLQAILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEVHSIYSADIL 320


>gi|46908137|ref|YP_014526.1| birA bifunctional protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47094229|ref|ZP_00231941.1| BirA bifunctional protein [Listeria monocytogenes str. 4b H7858]
 gi|226224508|ref|YP_002758615.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes Clip81459]
 gi|254825601|ref|ZP_05230602.1| birA [Listeria monocytogenes FSL J1-194]
 gi|254852808|ref|ZP_05242156.1| birA [Listeria monocytogenes FSL R2-503]
 gi|254931925|ref|ZP_05265284.1| birA [Listeria monocytogenes HPB2262]
 gi|255520918|ref|ZP_05388155.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes FSL J1-175]
 gi|300763786|ref|ZP_07073783.1| BirA bifunctional protein [Listeria monocytogenes FSL N1-017]
 gi|46881407|gb|AAT04703.1| birA bifunctional protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017401|gb|EAL08222.1| BirA bifunctional protein [Listeria monocytogenes str. 4b H7858]
 gi|225876970|emb|CAS05679.1| Putative transcriptional regulator and biotin
           acetyl-CoA-carboxylase synthetase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258606135|gb|EEW18743.1| birA [Listeria monocytogenes FSL R2-503]
 gi|293583477|gb|EFF95509.1| birA [Listeria monocytogenes HPB2262]
 gi|293594844|gb|EFG02605.1| birA [Listeria monocytogenes FSL J1-194]
 gi|300515522|gb|EFK42572.1| BirA bifunctional protein [Listeria monocytogenes FSL N1-017]
 gi|328466254|gb|EGF37411.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Listeria monocytogenes 1816]
 gi|332312345|gb|EGJ25440.1| BirA bifunctional protein [Listeria monocytogenes str. Scott A]
          Length = 325

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 122/239 (51%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I ++  +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENSTKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|88658376|ref|YP_507644.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599833|gb|ABD45302.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 251

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 123/252 (48%), Gaps = 10/252 (3%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
           NLS    P  +  E    + STN E +K A  G      I++  Q  GRGR +  W S  
Sbjct: 4   NLSNINLPNGYTLEHHKILYSTNYEAIKLAECGAEDGTIIISDKQIKGRGRYERTWYSPT 63

Query: 64  GNLYASLLLIDSISKDSLTLL-SFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           GNLY S+++        L  + + ++   +  ++ +     + V+ KWPNDILV  +KI+
Sbjct: 64  GNLYFSIIITKFKETFPLPFIAALSVGKTLEEILINNNNTTSKVEYKWPNDILVNSKKIS 123

Query: 123 GILIETLNLKNGLQA-VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           GIL+E+  L N LQ  +VVGIG+N+   P       T+++       L ++  LL + + 
Sbjct: 124 GILLESKTLNNTLQKWIVVGIGINMYKAPT----YATTIKEHNQNFTLSNL-ELLEKVIN 178

Query: 182 RVLDLWKK--DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
              +  K     G  +I NLW    C +   IT+K    +  G+F+ +D  G +L+++  
Sbjct: 179 NFYNFRKHYIYHGFADIRNLWLKQTCHLNREITVKSYKHTYTGQFITIDTQGNMLMKQND 238

Query: 240 GCVRQIFTGDIF 251
             +  I +G+IF
Sbjct: 239 KTI-CITSGEIF 249


>gi|290894258|ref|ZP_06557226.1| birA protein [Listeria monocytogenes FSL J2-071]
 gi|290556197|gb|EFD89743.1| birA protein [Listeria monocytogenes FSL J2-071]
          Length = 325

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIESSSEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|313901917|ref|ZP_07835335.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467812|gb|EFR63308.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 352

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 123/240 (51%), Gaps = 10/240 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
            +   + STND   + A +G      +VA  Q AGRGR    W S  G L+ SL+L  ++
Sbjct: 102 HWLAEVGSTNDVARRLAEAGAPEGTVVVADRQAAGRGRLRRAWWSPPGGLWMSLILRPAL 161

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             + L LL+ A A A+          G  V++KWPND+L+  RK+AGIL+ET++  +G +
Sbjct: 162 PPEHLPLLTLAAAAAVAEAAEGL--AGRPVQVKWPNDVLIDDRKVAGILLETVSHPHGAE 219

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDV-ARVLDLWKKD 190
            VV GIG+N+    +  P +    +T L RE G  +   ++   + Q +  R   L ++ 
Sbjct: 220 YVVAGIGVNLDVEGEPVPAELAGRLTWLAREAGRRVTRNELAEAILQRLEERYAQLHQEG 279

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   ++  WR  A  +G+ + + L  G + G  + V   G L++E+  G  ++I  GD+
Sbjct: 280 PG--PVLAAWRSRAAWLGEPVRVALPTGEVAGIALDVAPDGSLVVEQAGGRRQRILAGDV 337


>gi|196046596|ref|ZP_03113820.1| birA bifunctional protein [Bacillus cereus 03BB108]
 gi|196022529|gb|EDX61212.1| birA bifunctional protein [Bacillus cereus 03BB108]
          Length = 326

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT+GRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGPGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +     I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMREMITGVAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|16801084|ref|NP_471352.1| hypothetical protein lin2018 [Listeria innocua Clip11262]
 gi|16414519|emb|CAC97248.1| birA [Listeria innocua Clip11262]
          Length = 325

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 122/239 (51%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E +++++ST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIYESVNSTQIIAHQQMNSSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKEKASSLKLELGESVSRKALLQAILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G +  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEIHSIYSADIL 320


>gi|217963944|ref|YP_002349622.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes
           HCC23]
 gi|217333214|gb|ACK39008.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes
           HCC23]
 gi|307571486|emb|CAR84665.1| bifunctional biotin operon
           repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Listeria monocytogenes L99]
          Length = 325

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|320161292|ref|YP_004174516.1| biotin--[acetyl-CoA-carboxylase] ligase [Anaerolinea thermophila
           UNI-1]
 gi|319995145|dbj|BAJ63916.1| biotin--[acetyl-CoA-carboxylase] ligase [Anaerolinea thermophila
           UNI-1]
          Length = 258

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 125/246 (50%), Gaps = 25/246 (10%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL---- 72
           ++     STND+ M  A +G    + ++A  Q  GRGR    W++  G   A  ++    
Sbjct: 19  QYLPETYSTNDDAMAWAQAGAPEGVVVIADKQLKGRGRLGRMWVTQPGTSLAFSMIFRPT 78

Query: 73  IDSISKDSL--TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++ I K SL   L + A+AVA+  +       G   +IKWPND+L+ ++K+ G+L ET+ 
Sbjct: 79  LEEIEKLSLFSPLGALAVAVALEDL-------GLSPEIKWPNDVLLSRKKVCGVLAETVW 131

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTP----YPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           + + +  VV+GIG+NV    V       +P T ++ E G     D  SLL + V R L  
Sbjct: 132 MGSHINGVVLGIGINVATGSVPDSNMLLFPATCVESELG--KPVDRLSLL-ESVLRHLIE 188

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL--EEKKGCVRQ 244
           W+K    E  +  W+     +G+ +T++   G I GRF  VD+ G L+L  EE+      
Sbjct: 189 WRKQIRTERFIEEWKKRLAFLGEKVTVQKPDGEITGRFQDVDEHGALVLSVEEQ---YHT 245

Query: 245 IFTGDI 250
           IF GD+
Sbjct: 246 IFAGDV 251


>gi|16272182|ref|NP_438391.1| biotin--protein ligase [Haemophilus influenzae Rd KW20]
 gi|260580895|ref|ZP_05848720.1| biotin-[acetyl-CoA-carboxylase] ligase [Haemophilus influenzae
           RdAW]
 gi|1168673|sp|P46363|BIRA_HAEIN RecName: Full=Bifunctional protein BirA; Includes: RecName:
           Full=Biotin operon repressor; Includes: RecName:
           Full=Biotin--[acetyl-CoA-carboxylase] synthetase;
           AltName: Full=Biotin--protein ligase
 gi|1573184|gb|AAC21889.1| biotin operon repressor/biotin acetyl coenzyme A carboxylase
           synthetase (birA) [Haemophilus influenzae Rd KW20]
 gi|260092518|gb|EEW76456.1| biotin-[acetyl-CoA-carboxylase] ligase [Haemophilus influenzae
           RdAW]
          Length = 302

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 118/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 69  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 125

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 126 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 176

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 177 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 233

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       I +    G I G   G+D+ GYL
Sbjct: 234 IFEQNGIDEEFQQAWQSYNAFSNSEINVLTEQGVISGIEQGIDERGYL 281


>gi|301168873|emb|CBW28466.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase/
           DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Haemophilus influenzae 10810]
          Length = 301

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 118/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+G+G+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       I +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEINVLTEQGVISGIEQGIDERGYL 280


>gi|254463933|ref|ZP_05077344.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           Y4I]
 gi|206684841|gb|EDZ45323.1| biotin-(acetyl-CoA-carboxylase) ligase [Rhodobacterales bacterium
           Y4I]
          Length = 248

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 116/248 (46%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +       + ST +E  +  ++G+L G  WI+A  QT GRGRR   W   KGN  A+
Sbjct: 4   PAGYGKRVLAEVDSTLNEAAR--IAGELAGPEWILALRQTQGRGRRGRDWKDPKGNFAAT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L++    + D   L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+ 
Sbjct: 62  LVMRPDGAPDQAALRSFVAALAVYDACVAVTGRSEGLSLKWPNDVLLKGGKLAGILLESA 121

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD------TPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
               G+  + VGIG+N+   P+         YPV+ L   G  +  ++    +    AR 
Sbjct: 122 GNGQGVNHLFVGIGVNLVETPMQEWLEPGAVYPVSLLSETGVQVTPEEFLVAVAGAFARY 181

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              +    G E I   W   A  +G++IT + +     G F  VD  G L+L   KG V 
Sbjct: 182 EQQFAT-YGFEPIRTEWLARAAKLGEVITARTANSETEGTFETVDASGNLVLNTAKGRV- 239

Query: 244 QIFTGDIF 251
            I   DI+
Sbjct: 240 SIPAADIY 247


>gi|225863500|ref|YP_002748878.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus 03BB102]
 gi|225787725|gb|ACO27942.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus cereus 03BB102]
          Length = 326

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QT+GRGR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQHIAAKLAYEGAEEGTIVVAEEQTSGRGRLSRKWYSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G +  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGVAKGITEDGVLLLEDHEGKLHHIHSADI 323


>gi|154686491|ref|YP_001421652.1| hypothetical protein RBAM_020590 [Bacillus amyloliquefaciens FZB42]
 gi|154352342|gb|ABS74421.1| BirA [Bacillus amyloliquefaciens FZB42]
          Length = 325

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 129/263 (49%), Gaps = 23/263 (8%)

Query: 4   NLSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
            LSE +  +  + E       + D + ST     + A  G      +VA  QTAGRGR  
Sbjct: 67  KLSESEIRFGLKTEVLGKQLHYRDVLPSTQKTAHELANDGAPEGTLVVADKQTAGRGRMA 126

Query: 57  NKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
             W S +GN ++ SL+L   +       L+   AVA+   I +    G    IKWPND++
Sbjct: 127 RVWHSQEGNGIWMSLILRPDVPLQKTPQLTLLSAVAVVQAIEAF--TGVQPAIKWPNDLM 184

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLK 170
           +  +K  GIL E    ++ +++V++GIG+NV     D P  +    TSL  E G  ID  
Sbjct: 185 IHGKKAVGILTELQAEEDRVRSVILGIGINVNQQETDFPGELQDIATSLSMEAGEKID-- 242

Query: 171 DIFSLLFQDVARVLDLWKKD---TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
              + L Q++    +   +D    G   I  LW  +A G+G+ +  +   G+  G+ +G+
Sbjct: 243 --RAGLIQEILLTFEKRYQDYLNHGFTPIKLLWESYAVGLGNELRARTLQGTFYGKSLGI 300

Query: 228 DDFGYLLLEEKKGCVRQIFTGDI 250
           DD G LLLE + G +++I++ DI
Sbjct: 301 DDEGVLLLETRDG-IKKIYSADI 322


>gi|254992072|ref|ZP_05274262.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria monocytogenes FSL
           J2-064]
          Length = 325

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|148827361|ref|YP_001292114.1| biotin--protein ligase [Haemophilus influenzae PittGG]
 gi|148718603|gb|ABQ99730.1| biotin--protein ligase [Haemophilus influenzae PittGG]
          Length = 301

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 118/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+G+G+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       I +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEINVLTEQGVISGIEQGIDERGYL 280


>gi|313894610|ref|ZP_07828173.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella sp. oral taxon
           158 str. F0412]
 gi|313440800|gb|EFR59229.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella sp. oral taxon
           158 str. F0412]
          Length = 324

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 117/246 (47%), Gaps = 12/246 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + D   STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDVTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L    +       +   AVA+         +G TD  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFAPVEAPKCTLMAAVALTKAFHK---MGLTDAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA-RVL 184
                +  +V+GIG+NVK      P +     TSL  EG  I+  + F ++ + +  +  
Sbjct: 195 GSMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEGIDIERTEAFRIILEALEYQYY 254

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D+   D+G EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G V++
Sbjct: 255 DVL--DSGFEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGTVKR 312

Query: 245 IFTGDI 250
           +  GD+
Sbjct: 313 VMAGDV 318


>gi|126727172|ref|ZP_01743009.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2150]
 gi|126703600|gb|EBA02696.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacterales bacterium
           HTCC2150]
          Length = 250

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 115/239 (48%), Gaps = 15/239 (6%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           I STN E  + A S   G  WI+A  QTA RGRR   W   +GN  A+L++  + + D +
Sbjct: 17  IDSTNAEAARIAASLS-GPTWILALSQTAARGRRGRPWAHQQGNFSATLVMQPTETPDRV 75

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
            L SF  ++A+     +       + +KWPND+L+   K+AGIL+E++ + +G+  + +G
Sbjct: 76  ALRSFVTSLALYDAFVAVTGRTDGLALKWPNDVLMQGGKVAGILLESIGIGSGVNHLAIG 135

Query: 142 IGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD---TG 192
           +G+N+   P           PV+     G  +  +D   +L    A+    W+      G
Sbjct: 136 VGVNLLTAPDSELLETKAVAPVSLAGAMGVQVSPEDFLDVLAASYAK----WEAQFVTYG 191

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            E I   W   A  +G+ I  + +     G F  VD+ G L+L   +G V  I  GD+F
Sbjct: 192 FEPIRTAWLARAARLGERIIARTTREEFEGTFDTVDEQGALVLLTAQGRV-SIPAGDVF 249


>gi|282850017|ref|ZP_06259399.1| biotin-(acetyl-CoA-carboxylase) ligase [Veillonella parvula ATCC
           17745]
 gi|282580206|gb|EFB85607.1| biotin-(acetyl-CoA-carboxylase) ligase [Veillonella parvula ATCC
           17745]
          Length = 324

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 116/249 (46%), Gaps = 18/249 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L            +   AVA+         +G TD  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK---MGLTDAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR--- 182
                +  +V+GIG+NVK      P +     TSL  E   I+  + F L+ +++     
Sbjct: 195 GSMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYY 254

Query: 183 -VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            VL     D+G EE +N WR  +  +G+ I ++    +  G    +D+ G LL+    G 
Sbjct: 255 EVL-----DSGFEETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRISDGT 309

Query: 242 VRQIFTGDI 250
           +++I  GD+
Sbjct: 310 IKRIVAGDV 318


>gi|289435253|ref|YP_003465125.1| birA bifunctional protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171497|emb|CBH28041.1| birA bifunctional protein [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 326

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  D+++ST     ++  S   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHDSVTSTQIIAHQQIESSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SLQ E G  +  K +   +   + +  +L+  + G
Sbjct: 203 HAVIIGMGINVNQQKFPEEIKDKASSLQLELGTSVSRKALLQEILTSLEKYYELF-LNKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|145640139|ref|ZP_01795723.1| biotin--protein ligase [Haemophilus influenzae R3021]
 gi|145274725|gb|EDK14587.1| biotin--protein ligase [Haemophilus influenzae 22.4-21]
          Length = 301

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 118/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGVDEEFQQAWQSYNAFSNSEVKVLTGKGVISGIEQGIDERGYL 280


>gi|42780740|ref|NP_977987.1| birA bifunctional protein [Bacillus cereus ATCC 10987]
 gi|42736660|gb|AAS40595.1| birA bifunctional protein [Bacillus cereus ATCC 10987]
          Length = 326

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAG+GR   KW S KG  ++ S++L  SI
Sbjct: 88  FEESVESTQYIAAKLAYEGAEEGTIVVAEEQTAGKGRLSRKWHSPKGTGIWMSIILRPSI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I      G +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 148 PVHHAPQLTLLAAVSVAQAIEKC--TGVNVGIKWPNDILIQGKKAVGILTEMQADPDKIN 205

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +  +  TSL  E G  I   ++   +F  + ++ + + ++ 
Sbjct: 206 AVIMGIGINANQKQEHFDEEIQHIATSLAIESGKPIVRAELMQQIFLQLEKLYEEYLQN- 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  I  +    +I G   G+ + G LLLE+ +G V  I + DI
Sbjct: 265 GFSVIKILWESYAVSIGKEINARTMRETITGIAKGITEDGVLLLEDHEGKVHHIHSADI 323


>gi|319896558|ref|YP_004134751.1| bira bifunctional protein [Haemophilus influenzae F3031]
 gi|317432060|emb|CBY80409.1| BirA bifunctional protein [Haemophilus influenzae F3031]
          Length = 301

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++K+   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEKNGIDEEFQQAWQSYNAFSNSEVNVLTEQGVISGIEQGIDERGYL 280


>gi|294793388|ref|ZP_06758533.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 6_1_27]
 gi|294455819|gb|EFG24184.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 6_1_27]
          Length = 324

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 117/249 (46%), Gaps = 18/249 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L            +   AVA+         +G TDV IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK---MGLTDVGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR--- 182
                +  +V+GIG+NVK      P +     TSL  E   I+  + F L+ +++     
Sbjct: 195 GSMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYY 254

Query: 183 -VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            VL     D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G 
Sbjct: 255 EVL-----DSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRIPDGT 309

Query: 242 VRQIFTGDI 250
           +++I  GD+
Sbjct: 310 IKRIVAGDV 318


>gi|108763373|ref|YP_632327.1| BirA bifunctional protein [Myxococcus xanthus DK 1622]
 gi|108467253|gb|ABF92438.1| BirA bifunctional protein [Myxococcus xanthus DK 1622]
          Length = 334

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 114/240 (47%), Gaps = 10/240 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
              +++ STN++  + A  G      +VA  QTAG+GRR   W+S  G NLY S +L   
Sbjct: 92  HHHESLPSTNEKAFRLAQDGARHGEVVVAEQQTAGKGRRGRTWVSPPGLNLYFSAILRPG 151

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +       L+   AVA+     S    G +  IKWPND+ +   K+AGIL E       +
Sbjct: 152 LPPQRAPELTLVAAVAL---AESLRDAGVEAAIKWPNDVHIDGLKVAGILTELSAEPERV 208

Query: 136 QAVVVGIGLN----VKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
             V+VG+G+N    V+H P +     TSL    G  +      + L+  +   LDL+  D
Sbjct: 209 HFVIVGVGVNLNSQVEHFPEELRATATSLSLALGQPVHRARFAASLWTRLEEWLDLY-LD 267

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           TG + +   W+  +  +G  + ++     + GR   +D  G LL+   +G + ++  GD+
Sbjct: 268 TGFDAVRARWKALSSTLGQDVLVRTDRHELRGRAEDIDPSGALLVRTAEGSLERVLAGDV 327


>gi|71909369|ref|YP_286956.1| biotin--acetyl-CoA-carboxylase ligase [Dechloromonas aromatica RCB]
 gi|71848990|gb|AAZ48486.1| Biotin--acetyl-CoA-carboxylase ligase [Dechloromonas aromatica RCB]
          Length = 267

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 126/243 (51%), Gaps = 11/243 (4%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLL 72
           F  +  D   ST+ E M+RA  G      IVA  Q+AGRGRR   W+S  + +L  SLL 
Sbjct: 20  FDVDALDECDSTSSELMRRADRGAPAGTVIVADRQSAGRGRRGRSWLSSPERSLTFSLLW 79

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGILIET 128
             + +   L+ LS A+ + +   +     VG  V++KWPND+L+       K+AGILIE 
Sbjct: 80  RFAGNASRLSGLSLAVGLGLAKALEKLGAVG--VRLKWPNDVLLQSGSDFAKLAGILIEL 137

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            + + G QA ++GIGLN++    D P PV  L++     D  ++ + +   +  VLD++ 
Sbjct: 138 SSDRRGTQA-IIGIGLNLETPDSDLPQPVAGLKQCCAQADRHEVLAAILVSLVGVLDIFA 196

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFT 247
            + G   + + W  +      L+ +       L GR +GVD  G LLLE  +G V  IF+
Sbjct: 197 AE-GFVGLRDEWLGYHAWQDQLVQVLGDDAEPLPGRCLGVDGDGSLLLETARG-VEHIFS 254

Query: 248 GDI 250
           GD+
Sbjct: 255 GDV 257


>gi|15604390|ref|NP_220906.1| biotin--protein ligase [Rickettsia prowazekii str. Madrid E]
 gi|3861082|emb|CAA14982.1| BIOTIN-PROTEIN LIGASE (birA) [Rickettsia prowazekii]
          Length = 268

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 125/267 (46%), Gaps = 22/267 (8%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDK 63
           +++  N   F+   FD I ST+ E M+ A    +  +  I A  QT GRGR    W S  
Sbjct: 3   INKIMNIGKFKLIVFDEIDSTSSEAMRIARHNKVYADYAIFAKSQTRGRGRSGKNWQSRL 62

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL------------------PVGTD 105
           GNL+ SLL+      + L  L F  A+A+   I S +                  P    
Sbjct: 63  GNLHVSLLMRPDKELELLPQLCFVTALAVYDTILSCILYAGSNQLINNFNAVSVCPQNYS 122

Query: 106 VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG- 164
           +++KWPNDIL+  RKIAGIL+E++ + N    +++GIG+N+ + P +   P TSL  E  
Sbjct: 123 IQLKWPNDILMNGRKIAGILLESVKMDNNY-YLIIGIGINITYHPENIDQPTTSLITENL 181

Query: 165 GCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRF 224
             +  K +  +L ++  +   +W  + G   I   W   A  + + I IK     + G F
Sbjct: 182 MHVVPKALLKILIKNFEKYYKIWHHN-GFPFIRKKWIEHAYKLNENINIKYRNDIVTGLF 240

Query: 225 VGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             +D+ G ++L+     +    T +++
Sbjct: 241 KDIDNTGNIILQLNTQEIISFSTAELY 267


>gi|145639867|ref|ZP_01795468.1| biotin--protein ligase [Haemophilus influenzae PittII]
 gi|145271085|gb|EDK11001.1| biotin--protein ligase [Haemophilus influenzae PittII]
          Length = 301

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++K+    E    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEKNGINTEFQQAWQSYNAFSNSEVKVLTEQGVISGIEKGIDERGYL 280


>gi|309750361|gb|ADO80345.1| Biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Haemophilus influenzae R2866]
          Length = 302

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 69  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 125

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 126 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 176

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 177 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 233

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++K+    E    W+ +       + +    G I G   G+D+ GYL
Sbjct: 234 IFEKNGINTEFQQAWQSYNAFSNSEVKVLTEQGVISGIEKGIDERGYL 281


>gi|77463088|ref|YP_352592.1| putative biotin protein ligase [Rhodobacter sphaeroides 2.4.1]
 gi|77387506|gb|ABA78691.1| putative biotin protein ligase [Rhodobacter sphaeroides 2.4.1]
          Length = 242

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 112/239 (46%), Gaps = 9/239 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D++ STN     R  S   G  WIVA+ QTAGRGRR   W S +GN Y + LL  +  +
Sbjct: 6   LDSVDSTN-AVAARLASSLSGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTHLLHPTEPR 64

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
           + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L     +Q +
Sbjct: 65  EVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLGQGGRVQHL 124

Query: 139 VVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            +GIG+N+   P           PV+ L   G  +  +     L    AR  + + +  G
Sbjct: 125 AIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARREESFTR-LG 183

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
                  W   A  +G+ I  +  +    G F  VD  G L+L+   G V  I   ++F
Sbjct: 184 FGPTREAWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTGSGRV-AIPAAEVF 241


>gi|126461960|ref|YP_001043074.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103624|gb|ABN76302.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 251

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 112/247 (45%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P        D++ STN     R  S   G  WIVA+ QTAGRGRR   W S +GN Y + 
Sbjct: 7   PEGVARHALDSVDSTN-AVAARLASSLSGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTH 65

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL  +   + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L 
Sbjct: 66  LLHPTEPPEVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLG 125

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
               +Q + +GIG+N+   P           PV+ L   G  +  +     L    AR  
Sbjct: 126 QGGRVQHLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARRE 185

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           + + +  G       W   A  +G+ I  +  +    G F  VD  G L+L+   G V  
Sbjct: 186 ESFTR-LGFGPTREAWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTGSGRV-A 243

Query: 245 IFTGDIF 251
           I   ++F
Sbjct: 244 IPAAEVF 250


>gi|329850714|ref|ZP_08265559.1| biotin--acetyl-CoA-carboxylase synthetase [Asticcacaulis
           biprosthecum C19]
 gi|328841029|gb|EGF90600.1| biotin--acetyl-CoA-carboxylase synthetase [Asticcacaulis
           biprosthecum C19]
          Length = 250

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 118/244 (48%), Gaps = 13/244 (5%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           +E FDT+ ST D  + R  +G  G  WI+A  QT G GR    WI  KGN  AS      
Sbjct: 4   FEIFDTLPSTQDLALSRLRAGRKGPGWILAREQTKGIGRHGRGWIGQKGNFMASRWDAMP 63

Query: 76  ISKDSLTLLSFAIAVA----MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET-LN 130
           +       LSF  A+A    +R +I  T      ++IKWPNDIL   RK+ GIL++T  +
Sbjct: 64  LDVRRAPQLSFVTALAVYEMLRPLIHDT---DASMRIKWPNDILHRGRKLCGILVQTEAS 120

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG----CIDLKDIFSLLFQDVARVLDL 186
            +     +V+GIG+N++  P+   Y   +L+         +D   +   L   +  VLDL
Sbjct: 121 QEPDSLGIVIGIGMNLRVAPILEGYLTVALKEINPDAVRTLDAVGMLHKLNGHLDGVLDL 180

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           W ++    +I   W   A G   ++++ +    + G  VG+D+FG L +    G +  + 
Sbjct: 181 W-RNKAFSDIAKAWLKRAYGRDRVVSVTVDGVKVSGDIVGLDEFGGLQVRAGDGQIYTVT 239

Query: 247 TGDI 250
            GD+
Sbjct: 240 GGDV 243


>gi|292572147|gb|ADE30062.1| Biotin-(acetyl-CoAcarboxylase) ligase [Rickettsia prowazekii Rp22]
          Length = 262

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 121/258 (46%), Gaps = 22/258 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD I ST+ E M+ A    +  +  I A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDEIDSTSSEAMRIARHNKVYADYAIFAKSQTRGRGRSGKNWQSRLGNLHVSLLM 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTL------------------PVGTDVKIKWPNDI 114
                 + L  L F  A+A+   I S +                  P    +++KWPNDI
Sbjct: 66  RPDKELELLPQLCFVTALAVYDTILSCILYAGSNQLINNFNAVSVCPQNYSIQLKWPNDI 125

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIF 173
           L+  RKIAGIL+E++ + N    +++GIG+N+ + P +   P TSL  E    +  K + 
Sbjct: 126 LMNGRKIAGILLESVKMDNNY-YLIIGIGINITYHPENIDQPTTSLITENLMHVVPKALL 184

Query: 174 SLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            +L ++  +   +W  + G   I   W   A  + + I IK     + G F  +D+ G +
Sbjct: 185 KILIKNFEKYYKIWHHN-GFPFIRKKWIEHAYKLNENINIKYRNDIVTGLFKDIDNTGNI 243

Query: 234 LLEEKKGCVRQIFTGDIF 251
           +L+     +    T +++
Sbjct: 244 ILQLNTQEIISFSTAELY 261


>gi|330507534|ref|YP_004383962.1| bifunctional protein birA [Methanosaeta concilii GP-6]
 gi|328928342|gb|AEB68144.1| Bifunctional protein birA [Methanosaeta concilii GP-6]
          Length = 289

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 118/234 (50%), Gaps = 9/234 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            F  ++STN+  +  A  G+ G + I+A  QT GRGR    W S  G ++ SL+L   I 
Sbjct: 53  LFAQLASTNELAISLAQKGESGTV-ILAEVQTRGRGRLSRHWESPSGGIWMSLILRPDIP 111

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                 ++ AI VA+   I++ L  G +  IKWPND+L+ +RK+ GIL+E       L+ 
Sbjct: 112 IALAYQINMAICVAVCRAISNLL--GLNPGIKWPNDLLIGERKVGGILMEVQAEGERLEY 169

Query: 138 VVVGIGLNVKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
            VVG+G+N    P   P  +  TSL REGG    +   + L Q     ++   ++ G  E
Sbjct: 170 AVVGVGINANIDPSAFPDDWMATSLSREGGS---EVSRTALIQRTLLEIERAYENLGSME 226

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           I + WR  +  IG ++ I  + G ++G    + + G LLL      VR +  GD
Sbjct: 227 IYDEWRRRSVTIGRMVRISANSGELVGEVEDLAEDGALLLRRDDELVR-VLAGD 279


>gi|303228835|ref|ZP_07315648.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303230985|ref|ZP_07317728.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514367|gb|EFL56366.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302516455|gb|EFL58384.1| biotin--[acetyl-CoA-carboxylase] ligase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 324

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 117/246 (47%), Gaps = 12/246 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L            +   AVA+         +G  D  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFPPAEAPKCTLMAAVALTKAFHK---MGLADAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQDVA-RVL 184
                +  +V+GIG+NVK    + P  +    TSL  EG  I+  + F ++ +++  +  
Sbjct: 195 GSMEEISYIVMGIGVNVKTKQEELPEEIKQIATSLLMEGVDIERTEAFKIILEELEHQYY 254

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D+   D+G E+ +N WR  +  +   I ++    +  G    +DD G LL++   G V++
Sbjct: 255 DVL--DSGFEDTLNEWRKLSVTLNQEIEVRAPGNTYEGVATDIDDDGNLLVKTTNGEVKR 312

Query: 245 IFTGDI 250
           I  GD+
Sbjct: 313 IVAGDV 318


>gi|57238983|ref|YP_180119.1| biotin-protein ligase [Ehrlichia ruminantium str. Welgevonden]
 gi|58578920|ref|YP_197132.1| biotin-protein ligase [Ehrlichia ruminantium str. Welgevonden]
 gi|57161062|emb|CAH57969.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417546|emb|CAI26750.1| Biotin-protein ligase [Ehrlichia ruminantium str. Welgevonden]
          Length = 252

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 121/248 (48%), Gaps = 13/248 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +  E  + + STN E +K A  G      I++  Q  G+GR +  W S +GNLY S+
Sbjct: 11  PSGYSLEHHEVLYSTNYEAIKLAQCGGNDGTIIISDKQIKGKGRNNRTWYSPQGNLYFSI 70

Query: 71  LLIDSISKDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++ +      L  +S  ++   +  ++         V+ KWPNDILV  +KI+GIL+E+ 
Sbjct: 71  IIRELSEVFHLPFISALSVGTTLEQILNKENNTNAKVQYKWPNDILVNSKKISGILLESN 130

Query: 130 NLKNGLQA-VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
              N  Q  VV+GIG+N+ H P    Y  T++Q     I L ++   L + +    D  +
Sbjct: 131 IEHNKSQEWVVIGIGVNIYHAP---EY-ATTIQNNIPNISLSNL--ELLEKIIYNFDKLR 184

Query: 189 KD---TGREEIMNLW-RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           KD    G   I NLW +       D ITI+      +G FV +D  G L++E+  G    
Sbjct: 185 KDYLNNGFSNIRNLWLKNTYHNFNDQITIQSCNNIYVGNFVTLDLNGSLVIEQ-DGQAVH 243

Query: 245 IFTGDIFT 252
           I +G+IF 
Sbjct: 244 ITSGEIFN 251


>gi|228990653|ref|ZP_04150618.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus
           pseudomycoides DSM 12442]
 gi|228996751|ref|ZP_04156388.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides
           Rock3-17]
 gi|228763070|gb|EEM11980.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus mycoides
           Rock3-17]
 gi|228769179|gb|EEM17777.1| Biotin--[acetyl-CoA-carboxylase] synthetase [Bacillus
           pseudomycoides DSM 12442]
          Length = 318

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 116/239 (48%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F +++ ST     K A  G      +VA  QTAGRGR   KW S KG  ++ S++L  +I
Sbjct: 80  FKESVESTQHIAAKLAYEGAAEGTIVVAEEQTAGRGRLSRKWHSPKGTGIWMSIILRPAI 139

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AV++   I     V  +V IKWPNDIL+  +K  GIL E     + + 
Sbjct: 140 PVHHAPQLTLLAAVSVAQAIEKCTSV--NVGIKWPNDILIEGKKAVGILTEMQADPDKIN 197

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           AV++GIG+N     +H   +     TSL  E G  I   ++   +F  + ++   + K+ 
Sbjct: 198 AVIMGIGINANQGQEHFADEIKEIATSLAIESGKPIVRAELMQQIFLQMEKLYQEYVKN- 256

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +    +I G   G+   G L+LE+ KG +  I + DI
Sbjct: 257 GFSVIKLLWESYAISIGKEITARTMKDTITGVAKGITADGVLMLEDDKGQLHHIHSADI 315


>gi|58616979|ref|YP_196178.1| biotin-protein ligase [Ehrlichia ruminantium str. Gardel]
 gi|58416591|emb|CAI27704.1| Biotin-protein ligase [Ehrlichia ruminantium str. Gardel]
          Length = 252

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 121/248 (48%), Gaps = 13/248 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +  E  + + STN E +K A  G      I++  Q  G+GR +  W S +GNLY S+
Sbjct: 11  PSGYSLEHHEVLYSTNYEAIKLAQCGGNDGTIIISDKQIKGKGRNNRTWYSPQGNLYFSI 70

Query: 71  LLIDSISKDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++ +      L  +S  ++   +  ++         V+ KWPNDILV  +KI+GIL+E+ 
Sbjct: 71  IIRELSEVFHLPFISALSVGTTLEQILNKENNTNAKVQYKWPNDILVNSKKISGILLESN 130

Query: 130 NLKNGLQA-VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
              N  Q  VV+GIG+N+ H P    Y  T++Q     I L ++   L + +    D  +
Sbjct: 131 IEHNKSQEWVVIGIGVNIYHAP---EY-ATTIQNNIPNISLSNL--ELLEKIIYNFDKLR 184

Query: 189 KD---TGREEIMNLW-RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           KD    G   I NLW +       D ITI+      +G FV +D  G L++E+  G    
Sbjct: 185 KDYLNNGFSNIRNLWLKNTYHNFNDQITIQSCNNIYVGNFVTLDLNGSLVIEQ-DGQAVH 243

Query: 245 IFTGDIFT 252
           I +G+IF 
Sbjct: 244 ITSGEIFN 251


>gi|53804169|ref|YP_114219.1| birA bifunctional protein [Methylococcus capsulatus str. Bath]
 gi|53757930|gb|AAU92221.1| birA bifunctional protein [Methylococcus capsulatus str. Bath]
          Length = 331

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 118/241 (48%), Gaps = 13/241 (5%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
           E  + + STND  M+RA  G       +A  Q+AGRGR    W+S   GN+Y SLL    
Sbjct: 92  EVHEQLDSTNDHLMRRAAEGAPAGTVCLAERQSAGRGRIGRTWVSPLSGNVYLSLLW--R 149

Query: 76  ISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
             +   + LS A+ VA+ R++ A  +    D  +KWPNDIL  +RK+ GILIE     N 
Sbjct: 150 FGRAGFSGLSLAVGVAVVRALRAQGI---GDAALKWPNDILWSRRKLGGILIEVRGEAND 206

Query: 135 LQAVVVGIGLNV-----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
             AVV+GIGLNV         +D  +   +    G  +    + + +  ++A +L  ++ 
Sbjct: 207 QYAVVIGIGLNVNLPDSHAVAIDQDWIDLARIPGGAAVSRNRLIAGMLNELAPLLTDYET 266

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            TG    +  WR +    G   +++       GR VGV   G LLL  + G VR+  +GD
Sbjct: 267 -TGLAPYLEEWRGYHGFEGAQASVQQGDWVWTGRIVGVSAEGLLLLACEDGPVREFASGD 325

Query: 250 I 250
           +
Sbjct: 326 V 326


>gi|114765014|ref|ZP_01444161.1| biotin--acetyl-CoA-carboxylase ligase [Pelagibaca bermudensis
           HTCC2601]
 gi|114542561|gb|EAU45586.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. HTCC2601]
          Length = 248

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 117/249 (46%), Gaps = 13/249 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  +       I STN E  +  L+G L G  WI A  QTAGRGRR   W + +GN  A+
Sbjct: 4   PAGYGRRVLAEIDSTNAEAAR--LAGTLAGPEWICALRQTAGRGRRGRAWANPEGNFAAT 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+ +   +   + L SF  ++A+    ++       + +KWPND+L+   K+AGIL+E+L
Sbjct: 62  LVTMPREAPQLVALRSFVASLALFDAFSAATGRVDGLALKWPNDVLLNGGKVAGILLESL 121

Query: 130 NLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
             + G+  + +GIG+N+   P           PV+ L   G  ++ +    LL    A  
Sbjct: 122 GQRRGVAHLAIGIGVNLVAAPGADEVEPGALRPVSLLSETGVHVEPEAFLELLASAYAE- 180

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            +      G   +   W   A  +G++IT +     I G F  VD  G L+L+   G  R
Sbjct: 181 HEARFVTYGFAPLREAWLARAARLGEVITARTGTAEITGTFETVDAGGNLVLKSSAG--R 238

Query: 244 Q-IFTGDIF 251
           Q I   D+F
Sbjct: 239 QAIAAADVF 247


>gi|327399203|ref|YP_004340072.1| biotin/acetyl-CoA-carboxylase ligase [Hippea maritima DSM 10411]
 gi|327181832|gb|AEA34013.1| biotin/acetyl-CoA-carboxylase ligase [Hippea maritima DSM 10411]
          Length = 324

 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 139/250 (55%), Gaps = 22/250 (8%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGD--LGNLWIVASCQTAGRGRRDNKWISDKG-NLYA 68
           +  R E+F   SST DE  +  +  D  +    ++A  QT+GRGR+  KW+S +G N+Y 
Sbjct: 79  FGRRIEYFRLTSSTMDEA-EYLIEKDENVDGAIVIAEEQTSGRGRQKRKWLSPQGENVYV 137

Query: 69  SLLLID---SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           SL+      ++S DS+ L+ FAI++A++  + S   V  D KIKWPND++V  +KIAG+L
Sbjct: 138 SLIFKPKGMNVS-DSIALM-FAISIAIKEAL-SDFGV-EDAKIKWPNDVMVNDKKIAGVL 193

Query: 126 IETLNLKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGC-IDLKDIFS---LLFQD 179
           +ET +    L   ++G G+NV  +H P +     TS++ E G  +D   + S     F++
Sbjct: 194 VETKSESGILSHAIIGFGINVNMEHMPDELKDKATSIKIETGIHVDRATLLSNILFYFEN 253

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + ++LD      G++ I +LWR +   +G  + +     +  G    +D+ G+LL+ +  
Sbjct: 254 LIKMLD----RDGKKAIFDLWRKYNNTLGRKVEVLSDKENFSGFAKDIDENGFLLV-DIG 308

Query: 240 GCVRQIFTGD 249
           G ++++ T +
Sbjct: 309 GNIKKVITAE 318


>gi|315282931|ref|ZP_07871226.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria marthii FSL
           S4-120]
 gi|313613419|gb|EFR87268.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria marthii FSL
           S4-120]
          Length = 325

 Score =  104 bits (260), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIEASPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENVTKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESISRKALLQEILVALEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDSLGEVHSIYSADIL 320


>gi|311068758|ref|YP_003973681.1| hypothetical protein BATR1942_09085 [Bacillus atrophaeus 1942]
 gi|310869275|gb|ADP32750.1| hypothetical protein BATR1942_09085 [Bacillus atrophaeus 1942]
          Length = 327

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 129/261 (49%), Gaps = 19/261 (7%)

Query: 4   NLSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRD 56
            LSE +  +  + E       + D + ST     + A +G      +VA  QTAGRGR  
Sbjct: 67  KLSESEIRFGLKTELLGRQLYYHDVLPSTQKTAHELANNGAPEGTLVVADKQTAGRGRMS 126

Query: 57  NKWISDKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
             W S +GN ++ SL+L   I       L+   AVA+   I     V  D  IKWPND+L
Sbjct: 127 RVWHSQEGNGIWMSLILRPDIPLQQTPQLTLLSAVAVVQAIEEAAGVQAD--IKWPNDLL 184

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLK 170
           +  +K  GIL E    ++ ++++++GIG+NV     D P  +    TSL +E G  ID  
Sbjct: 185 IHGKKAVGILTEMQAEEDRVRSIIIGIGINVNQQSADFPQELQQIATSLSQEAGEKIDRA 244

Query: 171 D-IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDD 229
             I  +L     R  D  K   G   I  LW  +A GIG  +  +   G+  G+ +G+DD
Sbjct: 245 GLIQQILLSFEKRYHDYLKH--GFTPIKLLWESYALGIGQELRARTLKGTFYGKSLGIDD 302

Query: 230 FGYLLLEEKKGCVRQIFTGDI 250
            G LLLE K+G +++I++ DI
Sbjct: 303 EGVLLLETKEG-IKKIYSADI 322


>gi|148825496|ref|YP_001290249.1| biotin--protein ligase [Haemophilus influenzae PittEE]
 gi|148715656|gb|ABQ97866.1| biotin--protein ligase [Haemophilus influenzae PittEE]
          Length = 301

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 280


>gi|332557961|ref|ZP_08412283.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           WS8N]
 gi|332275673|gb|EGJ20988.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           WS8N]
          Length = 251

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 111/247 (44%), Gaps = 9/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P        D++ STN     R  S   G  WIVA+ QTAGRGRR   W S +GN Y + 
Sbjct: 7   PEGVARHALDSVDSTN-AVAARLASSLSGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTH 65

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           LL  +   + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L 
Sbjct: 66  LLHPTEPPEVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLG 125

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
               +Q + +GIG+N+   P           PV+ L   G  +  +     L    AR  
Sbjct: 126 QGGRVQHLAIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARRE 185

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           + + +  G       W   A  +G+ I  +       G F  VD  G L+L+   G V  
Sbjct: 186 ESFTR-LGFGPTREAWLAHAARLGEQIRARTGRELREGMFETVDAHGALVLKTGSGRV-A 243

Query: 245 IFTGDIF 251
           I   ++F
Sbjct: 244 IPAAEVF 250


>gi|229846309|ref|ZP_04466417.1| biotin--protein ligase [Haemophilus influenzae 7P49H1]
 gi|229810402|gb|EEP46120.1| biotin--protein ligase [Haemophilus influenzae 7P49H1]
          Length = 301

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 280


>gi|85703317|ref|ZP_01034421.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. 217]
 gi|85672245|gb|EAQ27102.1| biotin--acetyl-CoA-carboxylase ligase [Roseovarius sp. 217]
          Length = 252

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 117/250 (46%), Gaps = 15/250 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRA--LSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           P  +      T+ STN E  + A  L+G     WI+A  QTA RGRR   W++  GN  A
Sbjct: 8   PSGYGRRVLTTVDSTNAEAARLAPYLTGPE---WILAHQQTAARGRRGRAWVNPAGNFAA 64

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           +L++  + S D + L SF  ++A+   + +         +KWPND+L+   K+AGIL+E+
Sbjct: 65  TLVMRPTESPDRVALRSFVASLALFEALVAATGRAEVFALKWPNDVLLNGGKLAGILLES 124

Query: 129 LNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
                 L    +GIG+N+   P           PV+ L   G  +D ++   LL    AR
Sbjct: 125 AGAGGSLSHFAIGIGVNLCSAPDVSEVEQGALRPVSLLSETGIVLDPEEFLDLLAPAYAR 184

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L+      G   I   W   A  +G++IT + +     G F  VD+ G L+L    G  
Sbjct: 185 -LESQFVTYGFAPIRTAWLARAARLGEVITARTTREVYEGTFQTVDEAGNLVLLTAMG-- 241

Query: 243 RQ-IFTGDIF 251
           RQ I   ++F
Sbjct: 242 RQTIAAAEVF 251


>gi|294795207|ref|ZP_06760341.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 3_1_44]
 gi|294453999|gb|EFG22374.1| biotin-[acetyl-CoA-carboxylase] ligase [Veillonella sp. 3_1_44]
          Length = 324

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 116/249 (46%), Gaps = 18/249 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E  + A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARRLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L            +   AVA+         +G TD  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK---MGLTDAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR--- 182
                +  +V+GIG+NVK      P +     TSL  E   I+  + F L+ +++     
Sbjct: 195 GSMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYY 254

Query: 183 -VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            VL     D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G 
Sbjct: 255 EVL-----DSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVATDIDEDGNLLVRISDGT 309

Query: 242 VRQIFTGDI 250
           +++I  GD+
Sbjct: 310 IKRIVAGDV 318


>gi|309972633|gb|ADO95834.1| Biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Haemophilus influenzae R2846]
          Length = 302

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 69  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 125

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 126 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 176

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+GIG+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 177 NHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 233

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 234 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 281


>gi|163793201|ref|ZP_02187177.1| birA biofunctional protein, putative [alpha proteobacterium BAL199]
 gi|159181847|gb|EDP66359.1| birA biofunctional protein, putative [alpha proteobacterium BAL199]
          Length = 248

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 112/233 (48%), Gaps = 8/233 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD +SST DE  + A+ G      + A  QT GRGR    W+S  GN+Y + +L  +IS 
Sbjct: 23  FDRVSSTMDEARRLAVEGAPDRTVVRADVQTGGRGRLGRPWVSSIGNVYTTAILRPAIST 82

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
                LS   AVA+   +A        V++KWPND+L+   K++G+L+E +     L AV
Sbjct: 83  ARAAELSLVAAVAVADTVAR---FSESVRLKWPNDVLLNGGKVSGVLLEAVAEGVSLSAV 139

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMN 198
           +VGIG+NV   P     P + ++      D   +F+ L     +    W +  G   I  
Sbjct: 140 LVGIGVNVGSHPDLPDRPTSRIE----TADADTVFAALLDAFDQRYRQWSQH-GLGGIRF 194

Query: 199 LWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            W      +G  + + L    + G F G++  G L LE   G VRQI +G++ 
Sbjct: 195 AWLERGPDLGSPMIVGLGADRVRGTFAGLEPDGSLRLELADGSVRQISSGEVL 247


>gi|116873339|ref|YP_850120.1| bifunctional protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742217|emb|CAK21341.1| bifunctional protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 325

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 120/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++SST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVSSTQIIAHQQIDTSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + +IKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPRIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNVKHC--PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV     P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQVFPEEIKDKASSLKLELGESISRKALLQEILASLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIYGKVQGISDEGVLLLQDNLGEVHSIYSADIL 320


>gi|145637234|ref|ZP_01792896.1| biotin--protein ligase [Haemophilus influenzae PittHH]
 gi|145269679|gb|EDK09620.1| biotin--protein ligase [Haemophilus influenzae PittHH]
          Length = 301

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+G+G+NV   K   +  PY  V  +  +   ++ + + + L Q +   L+
Sbjct: 176 NHKNGMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLTKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++K+    E    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEKNGINAEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 280


>gi|313623172|gb|EFR93433.1| biotin-(acetyl-CoA-carboxylase) ligase [Listeria innocua FSL
           J1-023]
          Length = 325

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 120/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  +++ ST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EIHESVKSTQIIAHQQIETSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  I  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKEKASSLKLELGESISRKALLQAILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ + G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISEEGVLLLQDSLGEVHSIYSADIL 320


>gi|300710759|ref|YP_003736573.1| biotin--[acetyl-CoA-carboxylase] ligase [Halalkalicoccus jeotgali
           B3]
 gi|299124442|gb|ADJ14781.1| biotin--[acetyl-CoA-carboxylase] ligase [Halalkalicoccus jeotgali
           B3]
          Length = 307

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 119/241 (49%), Gaps = 15/241 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           PY    E+ + I STN    + A +G  G + ++A  QTAGRGR +  W +  G +Y S+
Sbjct: 73  PYEI--EYHEAIDSTNARARELAKAG-AGRVAVLAGEQTAGRGRLERAWSAPSGGIYLSI 129

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ--RKIAGILIET 128
           +L  +++     LL+ A AVA    +      G D  IKWPNDIL+     K+ GIL E 
Sbjct: 130 VLRPTMTPMQAPLLTLAGAVATTRALRE---AGVDAGIKWPNDILLASSGEKLVGILTEM 186

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               + +  VV GIG+N        P   TS++ + G ID +     L ++   +    +
Sbjct: 187 EGEADRVSWVVCGIGVNANVDAAALPEGATSVREQVGDIDRRVFTQRLLEEFTTL----R 242

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            D   + I++ WR  A  +G  + ++   G ++GR + ++  G L++   +G VR +  G
Sbjct: 243 ADP--DAILDRWREHALTLGQRVRVETGAGDVVGRALDIESPGRLVIGTDEGEVR-VHAG 299

Query: 249 D 249
           D
Sbjct: 300 D 300


>gi|126654220|ref|ZP_01726016.1| transcriptional repressor of the biotin operon [Bacillus sp.
           B14905]
 gi|126589302|gb|EAZ83458.1| transcriptional repressor of the biotin operon [Bacillus sp.
           B14905]
          Length = 327

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 117/240 (48%), Gaps = 8/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            +FD + ST     K A  G      I+   QTAGRGR    W S  G+ ++ ++++   
Sbjct: 87  HYFDVVDSTQTIAHKLAQEGAPHGTVIIGEEQTAGRGRMARPWESVHGSGIWMTVIVRPD 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++    +  +  +AVA+   I  TL    +  IKWPND+L+  +K  GIL E     + +
Sbjct: 147 VTPQQASSFTLVVAVAVTMAI-KTLYSDIEPTIKWPNDLLINGKKCTGILTEMQAEADLV 205

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
           QA++VGIG+NV     D    +    TSL+ E G  I+   + +L+ Q + +  +L+ ++
Sbjct: 206 QALLVGIGINVNQEAADFSPDIADIATSLRLEAGEEINRAALVALILQYLEQFTELYIEE 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW   +C IG  I +        G   G+ D G L L +  G VR I+ GDI
Sbjct: 266 -GFASIKTLWEQLSCTIGQRIEVTTIRERFEGIASGITDDGVLQLTQDDGLVRTIYAGDI 324


>gi|87200300|ref|YP_497557.1| biotin--acetyl-CoA-carboxylase ligase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135981|gb|ABD26723.1| Biotin--acetyl-CoA-carboxylase ligase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 243

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 112/234 (47%), Gaps = 13/234 (5%)

Query: 22  ISSTNDECMKRALSGDLGNL--WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKD 79
           I STN   + R   G+L N   W+VA  QTAGRGR    W    GN   S ++    +  
Sbjct: 8   IPSTNAALLARLGGGELLNEGDWLVADRQTAGRGRAGRSWSDGFGNFMGSTVVQLRGADP 67

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+    +A    + +  P  +D+++KWPND+LV + K+AGIL+E         AVV
Sbjct: 68  LPQTLALVTGLAAHQAVMALAPRLSDLRLKWPNDLLVGEAKLAGILLE-----RHANAVV 122

Query: 140 VGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD-VARVLDLWKKDTGREEIM- 197
           VGIG+N+   P D P   T+     G    +D F+    D  A  L  W    G   ++ 
Sbjct: 123 VGIGVNLAQAP-DVPDRKTASLSGLGYAIARDAFATELADRFADALARWH--LGEWPLLR 179

Query: 198 NLWRCFACGIGDLITIK-LSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             W   A   G L+++K    G+I+G F G+D+ G  L+    G VR I  GDI
Sbjct: 180 EQWLARALPTGTLVSVKDRDQGTIIGAFGGIDEDGVALMRLADGSVRAIHAGDI 233


>gi|16803943|ref|NP_465428.1| hypothetical protein lmo1904 [Listeria monocytogenes EGD-e]
 gi|47096487|ref|ZP_00234079.1| BirA bifunctional protein [Listeria monocytogenes str. 1/2a F6854]
 gi|224501297|ref|ZP_03669604.1| hypothetical protein LmonFR_02030 [Listeria monocytogenes FSL
           R2-561]
 gi|254831495|ref|ZP_05236150.1| hypothetical protein Lmon1_09078 [Listeria monocytogenes 10403S]
 gi|254899399|ref|ZP_05259323.1| hypothetical protein LmonJ_06284 [Listeria monocytogenes J0161]
 gi|254912462|ref|ZP_05262474.1| BirA [Listeria monocytogenes J2818]
 gi|254936789|ref|ZP_05268486.1| birA [Listeria monocytogenes F6900]
 gi|255029020|ref|ZP_05300971.1| hypothetical protein LmonL_07411 [Listeria monocytogenes LO28]
 gi|284802349|ref|YP_003414214.1| hypothetical protein LM5578_2105 [Listeria monocytogenes 08-5578]
 gi|284995491|ref|YP_003417259.1| hypothetical protein LM5923_2056 [Listeria monocytogenes 08-5923]
 gi|16411357|emb|CAC99982.1| birA [Listeria monocytogenes EGD-e]
 gi|47015140|gb|EAL06081.1| BirA bifunctional protein [Listeria monocytogenes str. 1/2a F6854]
 gi|258609384|gb|EEW21992.1| birA [Listeria monocytogenes F6900]
 gi|284057911|gb|ADB68852.1| hypothetical protein LM5578_2105 [Listeria monocytogenes 08-5578]
 gi|284060958|gb|ADB71897.1| hypothetical protein LM5923_2056 [Listeria monocytogenes 08-5923]
 gi|293590444|gb|EFF98778.1| BirA [Listeria monocytogenes J2818]
          Length = 325

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  ++++ST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EVHESVNSTQIIAHQQIETSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDTLGEVHSIYSADIL 320


>gi|169827542|ref|YP_001697700.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus sphaericus C3-41]
 gi|168992030|gb|ACA39570.1| Bifunctional protein birA [Lysinibacillus sphaericus C3-41]
          Length = 327

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 119/245 (48%), Gaps = 8/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  +  +FD + ST     K A  G      I+   QTAGRGR    W S  G+ ++ ++
Sbjct: 82  FGRKIHYFDVVDSTQTIAHKLAQEGAPHGTVIIGEEQTAGRGRMARPWESVHGSGIWMTI 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++   ++    +  +  +AVA+   I +TL    +  IKWPND+L+  +K  GIL E   
Sbjct: 142 IVRPDVTPQQASSYTLVVAVAVTMAI-TTLYKDIEPAIKWPNDLLINGKKCTGILTEMQA 200

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLD 185
             + +QA++VGIG+N      D    +    TSL+ E G  I+   + +L+ Q + +  +
Sbjct: 201 EADLVQALLVGIGINANQEAADFSSNIAEIATSLRLEAGEEINRAALVALILQYLEQFTE 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L+ ++ G   I  LW   +C IG  I +        G   G+ D G L L +  G VR I
Sbjct: 261 LYVEE-GFASIKTLWEQLSCTIGQRIEVTTIRERFEGIASGITDDGVLQLTQDDGLVRTI 319

Query: 246 FTGDI 250
           + GDI
Sbjct: 320 YAGDI 324


>gi|83592904|ref|YP_426656.1| biotin--acetyl-CoA-carboxylase ligase [Rhodospirillum rubrum ATCC
           11170]
 gi|83575818|gb|ABC22369.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodospirillum rubrum ATCC
           11170]
          Length = 259

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 109/212 (51%), Gaps = 5/212 (2%)

Query: 43  IVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV 102
           + A  Q+ GRGR+   W S  GNLY S LL           LSF  AVA+   +    P+
Sbjct: 33  VWAGEQSGGRGRQARVWHSPPGNLYHSYLLRAPKPVGQCAQLSFVAAVALAEAVERLCPL 92

Query: 103 GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA-VVVGIGLNVKHCPVDTP-YPVTSL 160
             D + KWPNDI+    KI+G+L+E +    G    +V+GIG+N+   PV    +P  +L
Sbjct: 93  -ADPRCKWPNDIVCHGGKISGMLLELIEEGEGGNPWLVLGIGVNIITAPVTGALFPALAL 151

Query: 161 QREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSI 220
              G  + ++D+   +   +   L  W+ + G   I   W   A GIG  I ++LS  + 
Sbjct: 152 ADLGCAVTVEDMLGAIAARLDHWLARWQAE-GFAGIRAAWIARALGIGFPIEVRLSEETR 210

Query: 221 L-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           L G F G+D  G+LLLEE  G VR+I  GD+F
Sbjct: 211 LPGIFQGLDAEGHLLLEEPSGRVRRISAGDVF 242


>gi|34495941|ref|NP_900156.1| biotin acetyl-CoA-carboxylase synthetase [Chromobacterium violaceum
           ATCC 12472]
 gi|34101795|gb|AAQ58163.1| biotin acetyl-CoA-carboxylase synthetase [Chromobacterium violaceum
           ATCC 12472]
          Length = 314

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 117/240 (48%), Gaps = 8/240 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLL 71
           +F     +   STN + M RA +G L  L +    QTAGRGR   +W +  G+ L  SLL
Sbjct: 75  AFTLAVAERTDSTNSQLMARAGNGGLHGLVLACELQTAGRGRLGRRWQARLGSGLTFSLL 134

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                    L  LS AI VA+   + +   +G  V++KWPND+L+  RK+AGILIE    
Sbjct: 135 WRFERGLAELAGLSLAIGVALGRALRT---LGAPVELKWPNDVLLEGRKLAGILIEVSGD 191

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             G  A VVGIGLNV   P     PV +L++ G   D   + S +  ++ RVL  + +D 
Sbjct: 192 ALGPAAAVVGIGLNVAD-PGAVDQPVAALEQAGVAPDRNRVLSAMLNELERVLSDFDRD- 249

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   + + W          + +  S+G  + G   GV + G LL +  +G  R    G++
Sbjct: 250 GFAPLRDEWWRLCAHRDAPVRLSFSHGEPVDGVACGVAENGALLAQTAQG-TRSFHIGEV 308


>gi|221638944|ref|YP_002525206.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           KD131]
 gi|221159725|gb|ACM00705.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides
           KD131]
          Length = 242

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D++ STN     R  S   G  WIVA+ QTAGRGRR   W S +GN Y + LL  +   
Sbjct: 6   LDSVDSTN-AVAARLASSLSGPAWIVAAEQTAGRGRRGRPWSSRRGNFYGTHLLHPAELP 64

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
           + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E+L     +Q +
Sbjct: 65  EVVALRSFVAALALRDACVALTGLPEAFSLKWPNDVLLNGGKLAGILLESLGQGGRVQHL 124

Query: 139 VVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            +GIG+N+   P           PV+ L   G  +  +     L    AR  + + +  G
Sbjct: 125 AIGIGVNLIAAPDAAEVEPGAVRPVSLLAETGVRVTPETFLEALAPAYARREESFTR-LG 183

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
                  W   A  +G+ I  +  +    G F  VD  G L+L+   G V  I   ++F
Sbjct: 184 FGPTRETWLSHAARLGEQIRARTGHELREGLFETVDAHGALVLKTGSGRV-AIPAAEVF 241


>gi|224500254|ref|ZP_03668603.1| hypothetical protein LmonF1_11484 [Listeria monocytogenes Finland
           1988]
          Length = 325

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  ++++ST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EVHESVNSTQIIAHQQIETSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDTLGEVHSIYSADIL 320


>gi|255027109|ref|ZP_05299095.1| hypothetical protein LmonocytFSL_13668 [Listeria monocytogenes FSL
           J2-003]
          Length = 325

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  ++++ST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EVHESVNSTQIIAHQQIETSPEGTV-IVADEQTAGKGRLLRPWNSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGESVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|114771833|ref|ZP_01449226.1| biotin--acetyl-CoA-carboxylase ligase [alpha proteobacterium
           HTCC2255]
 gi|114547649|gb|EAU50540.1| biotin--acetyl-CoA-carboxylase ligase [alpha proteobacterium
           HTCC2255]
          Length = 242

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 122/246 (49%), Gaps = 13/246 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P  F     DTI STN E  +  L+ D+    WI+A  QT+G GRR  KW S KGN  ++
Sbjct: 4   PDGFGRITLDTIDSTNKEASR--LASDITQPTWILAEEQTSGVGRRGRKWSSQKGNFSST 61

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LL+  S    S+ L SF  ++A+R              +KWPND+L+   K+AGIL+ET 
Sbjct: 62  LLMPISGDLSSVALHSFVASLALRDTFLHITNEPNKFNLKWPNDVLMDGCKVAGILLETC 121

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK----DIFSLLFQDVARVLD 185
            +  G   + +GIG+N+   P      + +L  +  C+ ++    D  ++L    A  L+
Sbjct: 122 GI--GPSHLNIGIGVNLSILPESD--KIETLSTKPICLGIEILPIDFLTILANFFAIRLE 177

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            +   +G  +I   W   A  IG +IT ++    I G+FV VD+ G ++L+        I
Sbjct: 178 QFDT-SGFRQIRLDWLKSAANIGKVITARMPNSEITGKFVTVDEQGAVVLQADD-MKHTI 235

Query: 246 FTGDIF 251
              DIF
Sbjct: 236 HAADIF 241


>gi|260582894|ref|ZP_05850679.1| biotin-[acetyl-CoA-carboxylase] ligase [Haemophilus influenzae
           NT127]
 gi|260094107|gb|EEW78010.1| biotin-[acetyl-CoA-carboxylase] ligase [Haemophilus influenzae
           NT127]
          Length = 301

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 116/228 (50%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++   S   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNIPSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+G+G+NV   K   +  PY  V  +  +   ++ + +   L Q +   L+
Sbjct: 176 NHKNGMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLPKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       I +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGINEEFQQAWQSYNAFSNSEINVLTEQGVISGIEQGIDERGYL 280


>gi|254827211|ref|ZP_05231898.1| birA [Listeria monocytogenes FSL N3-165]
 gi|258599594|gb|EEW12919.1| birA [Listeria monocytogenes FSL N3-165]
          Length = 325

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (50%), Gaps = 8/239 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E  ++++ST     ++  +   G + IVA  QTAG+GR    W S KG  ++ S++L   
Sbjct: 86  EVHESVNSTQIIAHQQIETSPEGTV-IVADEQTAGKGRLLRPWSSKKGEGIWMSVILKPQ 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I    +   +F  ++A+   I +   +  + KIKWPNDI + +RKI G+L E       +
Sbjct: 145 IPIQKVPQFTFIASLAITEAIENITKL--EPKIKWPNDIYIGKRKICGVLTEMQAEAETI 202

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            AV++G+G+NV  +  P +     +SL+ E G  +  K +   +   + +  +L+  D G
Sbjct: 203 HAVIIGMGINVNQQEFPEEIKDKASSLKLELGENVSRKALLQEILTSLEKYYELF-LDKG 261

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I  LW   A   G+ +T   + G I G+  G+ D G LLL++  G V  I++ DI 
Sbjct: 262 FAPIKLLWETKAIPFGEKLTASTTKGKIHGQVKGISDEGVLLLQDALGEVHSIYSADIL 320


>gi|52080752|ref|YP_079543.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus licheniformis ATCC 14580]
 gi|52786123|ref|YP_091952.1| hypothetical protein BLi02379 [Bacillus licheniformis ATCC 14580]
 gi|319645290|ref|ZP_07999523.1| BirA protein [Bacillus sp. BT1B_CT2]
 gi|52003963|gb|AAU23905.1| transcriptional regulator and biotin acetyl-CoA-carboxylase
           synthetase [Bacillus licheniformis ATCC 14580]
 gi|52348625|gb|AAU41259.1| BirA [Bacillus licheniformis ATCC 14580]
 gi|317393099|gb|EFV73893.1| BirA protein [Bacillus sp. BT1B_CT2]
          Length = 327

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 118/243 (48%), Gaps = 16/243 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            F D +SST     + A +G      IVA  QT GRGR    W S +GN ++ S++L   
Sbjct: 87  HFQDVVSSTQKIAHELANNGAPEGTIIVADKQTEGRGRMARAWHSPEGNGIWMSIILRPE 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I      G   +IKWPNDIL+  +K+ GIL E     + +
Sbjct: 147 IPVQKTPQLTLLAAVAIVQAIEEQ--TGIAAEIKWPNDILINGKKVVGILTELQAEADQV 204

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            +V+VG G+NV     D P  +    TSL+   G  ID     + L Q +    +   +D
Sbjct: 205 HSVIVGTGINVNQLAADFPEELQETATSLRLASGEKID----RAALVQTIMSTFEKRYED 260

Query: 191 ---TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G E I  LW  +A  +   +T +   G+  G+ +G+D+ G L+LE   G +++I++
Sbjct: 261 YLAYGFEPIKLLWESYALTLNRELTARTLNGTFHGKALGIDEEGVLILETSDG-IKKIYS 319

Query: 248 GDI 250
            DI
Sbjct: 320 ADI 322


>gi|313125883|ref|YP_004036153.1| bira, biotin-(acetyl-CoA-carboxylase) ligase [Halogeometricum
           borinquense DSM 11551]
 gi|312292248|gb|ADQ66708.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Halogeometricum
           borinquense DSM 11551]
          Length = 318

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 117/245 (47%), Gaps = 19/245 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           SF  EF D I STND   + A + D  ++ ++A+ QT  RGR   +W + +G ++ SL+L
Sbjct: 74  SFEIEFHDEIGSTNDRGRELA-AADASDVVVIAAEQTGSRGRLKREWTAPEGGVWMSLVL 132

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ--------RKIAGI 124
              I      L + A AVA+          G D  IKWPND+LV          RK+AGI
Sbjct: 133 RPEIPPAHAPLYTLAAAVAVTRAAREA---GVDASIKWPNDVLVVSDDDTDRGGRKLAGI 189

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
           L E     + +  VVVGIG+N        P   TS++ E G +D +    +  Q +    
Sbjct: 190 LTEMEGEADRVSWVVVGIGVNANVDSDTLPPGATSVRDEAGDVDRR----VFVQRILETF 245

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D    D   + I++ WR +A  +G  + ++   G + G  V V   G L+++ + G  R 
Sbjct: 246 DELTDDP--DAILSAWRDYAATLGQYVRVETQSGVVEGEAVDVQVPGALVIQTEDGE-RV 302

Query: 245 IFTGD 249
           +  GD
Sbjct: 303 VHAGD 307


>gi|226312088|ref|YP_002771982.1| BirA bifunctional protein [Brevibacillus brevis NBRC 100599]
 gi|226095036|dbj|BAH43478.1| BirA bifunctional protein [Brevibacillus brevis NBRC 100599]
          Length = 327

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 116/240 (48%), Gaps = 13/240 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSIS 77
           +D + ST     + A  G +    ++A  QT G+GR    W S KG  ++ SL++  SI 
Sbjct: 87  YDEVVSTQPLAHEAAAKGAVEGTIVLAELQTGGKGRLGRPWHSPKGTGIWMSLIIRPSIP 146

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                 ++   AVA+   I      G  VKIKWPNDI +  +K+ GIL E     + +  
Sbjct: 147 LPKTPQMTLLTAVAVAKTIREE--TGLPVKIKWPNDIFIGDKKVCGILTELNAESDRVNY 204

Query: 138 VVVGIGLNVKHCPVDTPYP----VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD--- 190
           +V+GIGLN      D P      VTSL+ E G   LK +     Q + R+ +        
Sbjct: 205 LVIGIGLNANSLESDFPSELAQIVTSLRIESGE-SLKRV--TFIQRLCRIFEEEYDHYLR 261

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G E +   W   +  IG  +T++     + GR VG+D+ G L++E++ G + ++++ D+
Sbjct: 262 AGFERVKQEWENHSYTIGKWVTLQTISQQLEGRAVGLDEEGVLMVEDQAGQIHKVYSADV 321


>gi|149183106|ref|ZP_01861557.1| BirA [Bacillus sp. SG-1]
 gi|148849183|gb|EDL63382.1| BirA [Bacillus sp. SG-1]
          Length = 317

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 118/244 (48%), Gaps = 17/244 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           ++ +++ ST       A  G      ++A  QT GRGR    W S KG  ++ S++L   
Sbjct: 78  KYIESVPSTQKIAHALAQEGAEEGTTVIADEQTEGRGRLLRSWHSPKGTGIWMSIILKPQ 137

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +        +   AVA+   I      G   +IKWPNDIL+  RK+ GIL E     + +
Sbjct: 138 LPPQRAPQFTLIAAVAVVQAIEEV--CGLSPEIKWPNDILLNGRKLTGILTELQAEADKI 195

Query: 136 QAVVVGIGLNVKHCPVDTPYPVTS------LQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            ++++GIG+NV     D P  + S      ++++     +K     L Q V   L+++  
Sbjct: 196 NSIIIGIGMNVNQKAEDFPEELQSVATSLFMEKQEKVSRVK-----LIQRVMEKLEIYYD 250

Query: 190 ---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
              + G   I  LW  +A  IG  IT +   GSI G+ +G+++ G L +E+ +G V +++
Sbjct: 251 LYMEKGFTPIKLLWESYAISIGRQITARTITGSIHGKALGINEDGVLRIEDAEGQVHEVY 310

Query: 247 TGDI 250
           + DI
Sbjct: 311 SADI 314


>gi|256380376|ref|YP_003104036.1| biotin/acetyl-CoA-carboxylase ligase [Actinosynnema mirum DSM
           43827]
 gi|255924679|gb|ACU40190.1| biotin/acetyl-CoA-carboxylase ligase [Actinosynnema mirum DSM
           43827]
          Length = 253

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (46%), Gaps = 17/258 (6%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           MF +L     PY+       +  STN + +  A +     + ++A  Q+AG+GRR   W+
Sbjct: 1   MFEHLVAPTGPYA-EIRVVPSTGSTNADLVAAAPTTPDRTV-LIAEAQSAGQGRRGRSWV 58

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           S  G LY S+LL   +    L  ++    +A+   + +T   G    +KWPND+L+   K
Sbjct: 59  SSGGGLYLSVLLRPDVPPARLPWITLLTGLAL---VRATARAGVTATLKWPNDLLIGDAK 115

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTP-----YPVTSLQREGGCI-DLKDIFS 174
            AG+L ET N      AVVVGIGLN    P          P TSL   G  + D   +  
Sbjct: 116 AAGVLAETTN-----DAVVVGIGLNTAPLPPGVQPGAGGLPPTSLAEAGARVTDRFAVAE 170

Query: 175 LLFQDVARVLDLWKKDTGRE-EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +L  ++A +   W+   G    ++  +R  +  IG  + ++L+   +LG    V + G L
Sbjct: 171 VLLTELAALESEWRAAHGLPGALLAEYREHSATIGRDVRVELTGRELLGTAEDVLEDGTL 230

Query: 234 LLEEKKGCVRQIFTGDIF 251
           ++ +++G    +  GD+ 
Sbjct: 231 VVRDREGASHTVSAGDVV 248


>gi|115373043|ref|ZP_01460346.1| biotin-[acetyl-CoA-carboxylase] ligase [Stigmatella aurantiaca
           DW4/3-1]
 gi|310821849|ref|YP_003954207.1| bira bifunctional protein [Stigmatella aurantiaca DW4/3-1]
 gi|115369955|gb|EAU68887.1| biotin-[acetyl-CoA-carboxylase] ligase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309394921|gb|ADO72380.1| BirA bifunctional protein [Stigmatella aurantiaca DW4/3-1]
          Length = 336

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 112/239 (46%), Gaps = 16/239 (6%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKD 79
           T++STN+   + A  G      +VA  QTAG+GRR   W+S  G NLY S +L   +   
Sbjct: 94  TLASTNELAFRLAHEGAEHGEVVVAEQQTAGKGRRGRVWVSPPGLNLYFSAILRPELPPQ 153

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+   AVA+   +      G +  IKWPND+ +  RK+AGIL E       +  VV
Sbjct: 154 HAPELTLVAAVALAETLRE---AGAEAAIKWPNDVQIDGRKVAGILTEMSAEPERVHFVV 210

Query: 140 VGIGLNV----KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLW---KKDT 191
           +GIG+N+    +H P +     TSL  E G  +      + L+      L+ W    ++ 
Sbjct: 211 LGIGVNLNAQREHFPEELRAQATSLSLELGRPVPRASFAAALWLR----LEEWLARHQEV 266

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   +   W+  +C +G  + ++ +     G    VD+ G LL+    G + ++  GD+
Sbjct: 267 GFGPVRRRWKELSCTLGQDVLVRTARLEFRGMAEDVDESGALLVRTPSGSIERVLAGDV 325


>gi|145631108|ref|ZP_01786883.1| biotin--protein ligase [Haemophilus influenzae R3021]
 gi|144983393|gb|EDJ90875.1| biotin--protein ligase [Haemophilus influenzae R3021]
          Length = 301

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KN +  +V+G+G+NV   K   +  PY  V  +  +   ++ + + + L Q +   L+
Sbjct: 176 NHKNSMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLTKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGINEEFQQAWQSYNAFSNSEVKVLTEKGVISGIEQGIDERGYL 280


>gi|294055645|ref|YP_003549303.1| biotin/acetyl-CoA-carboxylase ligase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614978|gb|ADE55133.1| biotin/acetyl-CoA-carboxylase ligase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 342

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 107/239 (44%), Gaps = 7/239 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           +F  I STN E  ++   G      I +SCQ  GRGR   +W S    NLY S+L    I
Sbjct: 98  YFPVIDSTNSEADRQISFGRQSPFAIASSCQLKGRGRLGREWYSASADNLYLSVLFEPKI 157

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               L   +    V +   +   +P    +KIKWPND+    RK AG+L E     +G++
Sbjct: 158 PAQQLQHFTLWAGVHICRALQRFVP-DAPLKIKWPNDLHCDGRKFAGMLTEAKMDADGIK 216

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQR-----EGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +V G+G+N+   P+D P  + +L        G  + L D+ + + + +          +
Sbjct: 217 TIVFGVGINLNSNPMDYPDELRNLATSLYAIHGEELPLNDVTAAVLKAIQTAYQYCIGSS 276

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             E +   W       G  +T  +S  +I G   G+D+ G LLLE + G    +  GD+
Sbjct: 277 DGECLSEAWAPLNALAGKSVTALMSGNAISGIATGIDESGALLLENEDGTTHTVLAGDV 335


>gi|146278027|ref|YP_001168186.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556268|gb|ABP70881.1| biotin--acetyl-CoA-carboxylase ligase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 251

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 114/248 (45%), Gaps = 11/248 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P        +T+ STN   M   L+  L G  WI A  QTAGRGRR   W S +GN YA+
Sbjct: 7   PEGVARHALETVDSTN--AMAARLAPSLSGPAWIQAGEQTAGRGRRGRHWTSPRGNFYAT 64

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
            L+  + + + + L SF  A+A+R    +   +     +KWPND+L+   K+AGIL+E++
Sbjct: 65  YLMHPTETPEVVALRSFVAALALRDACVALTGLPQAFALKWPNDVLLNGGKLAGILLESI 124

Query: 130 NLKNGLQAVVVGIGLNVKHCPV------DTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
                +Q + +GIG+N+   P           PV+ L   G  +D       L    AR 
Sbjct: 125 GQGARVQHLAIGIGVNLIGAPAVAEVEPGAVPPVSLLAETGLRVDPVAFLDRLAPAYARR 184

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            + + +  G       W   A  +G+ I  +  +    G F  VD  G L+L+   G V 
Sbjct: 185 EESFAR-YGFAPTREAWLAHAARLGEPIRARTGHDLREGIFETVDASGALVLKTCDGRV- 242

Query: 244 QIFTGDIF 251
            I   ++F
Sbjct: 243 AIPAAEVF 250


>gi|148555906|ref|YP_001263488.1| biotin--acetyl-CoA-carboxylase ligase [Sphingomonas wittichii RW1]
 gi|148501096|gb|ABQ69350.1| biotin--acetyl-CoA-carboxylase ligase [Sphingomonas wittichii RW1]
          Length = 261

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 108/230 (46%), Gaps = 10/230 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STND+    A  G     W+ A  Q  GRGR+   W+S  GNL+AS L+           
Sbjct: 38  STNDDMTALAREGAAEGTWLRADRQEGGRGRQGRAWVSPPGNLHASTLVRRLGGDPPAPS 97

Query: 84  LSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
           L+   AVA+  ++ + L  G D + IKWPND+L    KI+GIL+E         AVVVGI
Sbjct: 98  LAMVAAVALDELLQAWL--GPDRLAIKWPNDLLADGAKISGILLEGAG-----DAVVVGI 150

Query: 143 GLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWR 201
           G+N+ H P     P TSL   G    +  D  + L    A  L  W+ + G   ++  W+
Sbjct: 151 GVNLAHRPEGIDRPATSLAALGLSPPEPGDFAAELAAVFAAWLARWRTE-GLGVVLARWQ 209

Query: 202 CFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             A   G  + ++   G I G + G+   G L L    G +  +  GD+F
Sbjct: 210 ARAHPPGTALRVRAPEGEIEGLYEGLAADGALRLRTSDGRIHLVHAGDVF 259


>gi|288560103|ref|YP_003423589.1| biotin-acetyl-CoA-carboxylase ligase BirA [Methanobrevibacter
           ruminantium M1]
 gi|288542813|gb|ADC46697.1| biotin-acetyl-CoA-carboxylase ligase BirA [Methanobrevibacter
           ruminantium M1]
          Length = 303

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 122/240 (50%), Gaps = 10/240 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           F  + STN      A  G      +++  QT  RGR   KW +  G ++ S++L   +  
Sbjct: 67  FRKVFSTNSISKFLANHGAKEGTVLISEIQTNARGRSGKKWEAPDGGVWMSMILRPDVPP 126

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
             + L++ A  VA+   I S      D KIKWPNDIL+   KI+G+L E +   N ++ V
Sbjct: 127 AKIGLITLATGVAIARAIRS---FDVDAKIKWPNDILIHGNKISGVLTEVIATFNQIEYV 183

Query: 139 VVGIG----LNVKHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
           +VG+G    L ++    D     T+L+ E    +D  ++  +   +  ++ D++  +   
Sbjct: 184 IVGVGIDSNLKLEDFSEDIREGTTTLEEEIPVKVDENELIGIFLNEFEKIYDIY-LNGDV 242

Query: 194 EEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT 252
           EEI++ WR  +  IG  ++I  + G +  G  VG++  G L++E++ G + +I +G++ T
Sbjct: 243 EEILSEWRALSDTIGKYVSITQTGGKTTQGYVVGINKEGSLIIEKQDGNLEKIISGELRT 302


>gi|229844926|ref|ZP_04465063.1| biotin--protein ligase [Haemophilus influenzae 6P18H1]
 gi|229812060|gb|EEP47752.1| biotin--protein ligase [Haemophilus influenzae 6P18H1]
          Length = 301

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KN +  +V+G+G+NV   K   +  PY  V  +  +   ++ + + + L Q +   L+
Sbjct: 176 NHKNSMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLTKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 280


>gi|145632463|ref|ZP_01788197.1| biotin--protein ligase [Haemophilus influenzae 3655]
 gi|145635127|ref|ZP_01790832.1| biotin--protein ligase [Haemophilus influenzae PittAA]
 gi|144986658|gb|EDJ93210.1| biotin--protein ligase [Haemophilus influenzae 3655]
 gi|145267548|gb|EDK07547.1| biotin--protein ligase [Haemophilus influenzae PittAA]
          Length = 301

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 117/228 (51%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWAFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KN +  +V+G+G+NV   K   +  PY  V  +  +   ++ + + + L Q +   L+
Sbjct: 176 NHKNSMLNLVIGVGINVSLSKQTEISQPYAEVCEIDPD---VERQTLLTKLIQHLYTRLN 232

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ GYL
Sbjct: 233 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGYL 280


>gi|239947723|ref|ZP_04699476.1| biotin-[acetyl-CoA-carboxylase] ligase [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921999|gb|EER22023.1| biotin-[acetyl-CoA-carboxylase] ligase [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 285

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 119/253 (47%), Gaps = 32/253 (12%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD + ST+ E M+ A +  +  N  ++A  QT+GRGR    W S   NL+ SLL+
Sbjct: 19  FKLIVFDKLDSTSSEAMRIARNAKVDSNYAVLAKSQTSGRGRSGKNWQSRSDNLHVSLLI 78

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTL----------------------------PVGT 104
                 + L  LSF  A+A+   I                                P   
Sbjct: 79  KPDKELELLPQLSFVTALAVYESIELLTMSSSSLTTGSSKSTTNDAASYFLDPVVKPWDD 138

Query: 105 DVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG 164
            V++KWPND+L+  RKIAGIL+E++ ++N    +++GIG+N+ + P +   P TSL  E 
Sbjct: 139 SVQLKWPNDVLINGRKIAGILLESVKVENNY-YLIIGIGINITYHPDNIDQPTTSLIGEN 197

Query: 165 -GCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGR 223
              I+ + +  +L ++  +   +W  + G   I   W   A  + + I++K     + G 
Sbjct: 198 LPPIEPQALLKILIENFEKYYQIW-YNNGFPFIREKWLEHAYKLHENISVKYQNDIVTGF 256

Query: 224 FVGVDDFGYLLLE 236
           F  +D  G ++L+
Sbjct: 257 FKDIDSTGRIILQ 269


>gi|310642528|ref|YP_003947286.1| biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Paenibacillus polymyxa
           SC2]
 gi|309247478|gb|ADO57045.1| Biotin [acetyl-CoA carboxylase] synthetase ; transcriptional
           repressor of the biotin operon [Paenibacillus polymyxa
           SC2]
          Length = 324

 Score =  101 bits (252), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 131/261 (50%), Gaps = 20/261 (7%)

Query: 3   SNLSECQNPYSF--RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           S L++  N  SF  R    D+  ST  + M+ A  G      ++A  QTAGRGR   KW 
Sbjct: 69  SKLADMLNTQSFGQRIVVLDSTVSTQQDAMRLAEEGAPEGTLVLAEEQTAGRGRLGRKWY 128

Query: 61  SDKGN-LYASLLLIDSIS---KDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDIL 115
           S +G  ++ S++L  +        LTLL+  A+  A+R +       G +  IKWPND+L
Sbjct: 129 SPRGKGIWMSIVLRPTQPLAFTPQLTLLTGVAVCRAIRRL------TGVEAGIKWPNDLL 182

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIG----LNVKHCPVDTPYPVTSLQREGGC-IDLK 170
           +  RK++GIL+E+      ++  + GIG    LNV+  P +  +  TSL+ E G  +D  
Sbjct: 183 IHGRKVSGILLESATEDQRVRYCIAGIGIDVNLNVEDYPEELSHVGTSLKIEAGLEVDRT 242

Query: 171 DIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDD 229
            + + + +++  +  L+  + G + I  LW   +  +   +      G ++ G  VG+D 
Sbjct: 243 ALIAAVLEEMELLSKLY-AEQGFQPIAMLWEALSVTMNRSVRAHTGQGIAVEGTAVGLDP 301

Query: 230 FGYLLLEEKKGCVRQIFTGDI 250
            G L++E  +G   Q+ +GDI
Sbjct: 302 SGALVIETNQGERIQVISGDI 322


>gi|77919567|ref|YP_357382.1| biotin-(acetyl-CoA carboxylase) holoenzyme synthetase and biotin
           operon repressor [Pelobacter carbinolicus DSM 2380]
 gi|77545650|gb|ABA89212.1| biotin-(acetyl-CoA carboxylase) holoenzyme synthetase and biotin
           operon repressor [Pelobacter carbinolicus DSM 2380]
          Length = 327

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           ++    STN    +   +G      ++A  Q AGRGR   +W S  G NLYAS+LL   +
Sbjct: 89  YYAETDSTNLCAHELGKAGAPEGSVVLADSQIAGRGRLGRRWCSPPGVNLYASVLLRPPV 148

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           +    + L+F  A A+   +A T  +   VK  WPND+LV  RKIAG+L E       + 
Sbjct: 149 APRYASQLTFLSAAAVARTVAETGNLAATVK--WPNDVLVGGRKIAGLLNELDAETEQIH 206

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +V+GIG+N+    +  P D  YP TS+  E G  +   D    L + +  +  L+  + 
Sbjct: 207 YLVLGIGVNLNMRTEQFPEDLRYPATSMMLECGRKVSRLDFVRCLLRHLDHLYALYLSE- 265

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   ++ +W+ +   +G  + + L    I+G+  G+D  G LLL+   G   ++  GD+
Sbjct: 266 GFPPVLAVWQQYFDLVGRSVEVDLQDRRIIGKVAGLDSDGALLLDLTDGTRERVLAGDV 324


>gi|103486781|ref|YP_616342.1| biotin--acetyl-CoA-carboxylase ligase [Sphingopyxis alaskensis
           RB2256]
 gi|98976858|gb|ABF53009.1| Biotin--acetyl-CoA-carboxylase ligase [Sphingopyxis alaskensis
           RB2256]
          Length = 266

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 111/236 (47%), Gaps = 11/236 (4%)

Query: 17  EFFDTISSTNDECMKRALSGD-LG-NLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           E      STN + + R   G+ +G   W+VA  QTAGRGR    W   +GN   S ++  
Sbjct: 31  ERIAQTGSTNADLLARLAGGEHVGEGHWLVADRQTAGRGRLGRSWNDGQGNFMGSTVVHL 90

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           ++   S   L+    VA+   +A+  P  +  ++KWPND+LV   K AGIL+E +     
Sbjct: 91  AVGDPSAATLALVAGVALARTVAALAP-DSGAQLKWPNDLLVDGAKCAGILMERIG---- 145

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             +VV+GIG+N+   P     P  +L   G  ID       L   +   L  W+++ G  
Sbjct: 146 -DSVVIGIGVNLTSAPELPDRPTATLSSNGAAIDRDHFAGALGIAMIDALRTWRQE-GVA 203

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            I+  W  FA  +G    +++S   I G F G+ + G L L  + G    I  GD+
Sbjct: 204 SILRAWLPFAHPVG--TPLRVSEQGIDGFFDGLAEDGALRLRREGGETMLIHAGDV 257


>gi|269797569|ref|YP_003311469.1| biotin/acetyl-CoA-carboxylase ligase [Veillonella parvula DSM 2008]
 gi|269094198|gb|ACZ24189.1| biotin/acetyl-CoA-carboxylase ligase [Veillonella parvula DSM 2008]
          Length = 324

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 115/249 (46%), Gaps = 18/249 (7%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           +  RY + DT  STN E    A  G      +V   Q AGRGR    W S  G  L+ SL
Sbjct: 78  FGKRYVYMDTTESTNLEARCLAQQGAEEGTVVVTEEQAAGRGRLSRGWYSPFGKGLWFSL 137

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L            +   AVA+         +G TD  IKWPNDILV  RK+ GIL E  
Sbjct: 138 ILRPDFPPVEAPKCTLMAAVALTKAFHK---IGLTDAGIKWPNDILVNGRKLVGILTEMS 194

Query: 130 NLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR--- 182
                +  +V+GIG+NVK      P +     TSL  E   I+  + F L+ +++     
Sbjct: 195 GSMEEISHIVMGIGVNVKTKQEELPEELKLIATSLAMEDIDIERTEAFRLILEELEHQYY 254

Query: 183 -VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            VL     D+G +E +N WR  +  +G+ I ++    +  G    +D+ G LL+    G 
Sbjct: 255 EVL-----DSGFDETLNEWRQLSVTLGEEIEVRAPGNTYEGVAKDIDEDGNLLVRISDGT 309

Query: 242 VRQIFTGDI 250
           +++I  GD+
Sbjct: 310 IKRIVAGDV 318


>gi|190571390|ref|YP_001975748.1| biotin-[acetyl-coa-carboxylase] ligase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213018789|ref|ZP_03334597.1| biotin-[acetyl-coa-carboxylase] ligase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190357662|emb|CAQ55106.1| biotin-[acetyl-coa-carboxylase] ligase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995740|gb|EEB56380.1| biotin-[acetyl-coa-carboxylase] ligase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 278

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 123/275 (44%), Gaps = 44/275 (16%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR   +  + STN E +     G      I+A  QT GRGR    WIS +GNLYASL++ 
Sbjct: 6   FRIYHYKEVPSTNKEALGLIEKGISNETVIIADKQTEGRGRTGKSWISPEGNLYASLIIN 65

Query: 74  DSISKDSLTLLSFAIAVAMRSVIAS-----------TLPV-------------------- 102
                  LT L+F  A+A+ + + S            +PV                    
Sbjct: 66  QEKDVSKLTELTFVTALAVGNTLLSLNFLNNQTHCGVIPVRDTGIHTFSSGSQCQSTGMT 125

Query: 103 ------GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP 156
                   +++ KWPNDIL+  +KI+GIL+E  +  N L   ++GIG+NV H P+     
Sbjct: 126 RDQFINDLNLQHKWPNDILIDGKKISGILVEKKSNSNWL---IIGIGINVNHAPLP---G 179

Query: 157 VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLS 216
            T +   G  +   D+   L  +  ++   W  D G   I  +W   A  + + I++KL+
Sbjct: 180 TTCISNYGESVSNMDLLKELIINFNKLRKQWLFD-GFYAIREMWLKKAFKMNEQISVKLA 238

Query: 217 YGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
                G F  +D  G L+L++K G +     G++F
Sbjct: 239 DKLYEGIFADIDKSGKLVLQQKDGSLIYFDAGELF 273


>gi|161528492|ref|YP_001582318.1| biotin--acetyl-CoA-carboxylase ligase [Nitrosopumilus maritimus
           SCM1]
 gi|160339793|gb|ABX12880.1| biotin--acetyl-CoA-carboxylase ligase [Nitrosopumilus maritimus
           SCM1]
          Length = 335

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 126/246 (51%), Gaps = 19/246 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +FD+  ST ++ +K A+  +     IVA  QT GRGR   KW+S KG ++ S++L     
Sbjct: 93  YFDSTDSTQNQALKMAIEPENNGAIIVAEKQTGGRGRSGRKWVSPKGGIWFSIILHPRFD 152

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
               TL   A A+A+   +  T  +  +  +KWPNDI +  +K+AG+L++     N ++ 
Sbjct: 153 ISITTLFPIASALALSIALEKTFKISPE--LKWPNDITIKGKKLAGMLVDVSLESNKIEN 210

Query: 138 VVVGIGLN----VKHCPVD---TP--YPVTSLQREG---GCIDLKDIFSLLFQDVARVLD 185
           +V+G+G+N    VK    +   TP  Y V SL  +      ++L   F +  + + ++LD
Sbjct: 211 LVLGVGINFDVDVKQIEKNLKGTPNFYGVASLNEKKIKIRPVELVQSFLVELEKIYKLLD 270

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              K T  ++I++ W   +  IG  + +    G I G+ + +DD G L++ + K   R +
Sbjct: 271 T--KQT--KKIISEWTKRSSTIGKNVKLNTVDGEIKGKAIRIDDDGALVVSDNKDTNR-V 325

Query: 246 FTGDIF 251
             GDI 
Sbjct: 326 IAGDII 331


>gi|224823391|ref|ZP_03696500.1| biotin/acetyl-CoA-carboxylase ligase [Lutiella nitroferrum 2002]
 gi|224603846|gb|EEG10020.1| biotin/acetyl-CoA-carboxylase ligase [Lutiella nitroferrum 2002]
          Length = 322

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 113/226 (50%), Gaps = 7/226 (3%)

Query: 20  DTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISK 78
           + I STN + M+ A S DL  L + A  Q+AGRGR   +W +  G  L  SLL       
Sbjct: 90  ERIDSTNSQLMQHATSSDLHGLVLAAELQSAGRGRLGRRWQARLGAGLTFSLLWRFDKGL 149

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
             L  LS A+ VA+   + +   +G  V +KWPND+L+  +K+AGILIE      G  AV
Sbjct: 150 AGLAGLSLAVGVALARALRA---LGAPVMLKWPNDVLLDGKKLAGILIELSGEAMGPAAV 206

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMN 198
           V+GIGLN++  P +   PV +L + G  +    + + L  ++ +VLD + K  G   +  
Sbjct: 207 VIGIGLNLQ-SPGEVDQPVAALDQAGVRVGRNALLAALLNELQQVLDAFAKQ-GFAAVRE 264

Query: 199 LWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVR 243
            W   +      + +  S+G  I G   GV D G L +E   G  R
Sbjct: 265 EWLALSAHRDSPVRLSFSHGEPIEGIARGVADDGALEVETAAGMQR 310


>gi|157803737|ref|YP_001492286.1| biotin--protein ligase [Rickettsia canadensis str. McKiel]
 gi|157785000|gb|ABV73501.1| biotin--protein ligase [Rickettsia canadensis str. McKiel]
          Length = 259

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 117/240 (48%), Gaps = 19/240 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F+   FD I STN E ++ A S  +  N  ++A  QT GRGR    W S  GNL+ SLL+
Sbjct: 6   FKLIVFDEIDSTNSEAIRIAKSNKVDSNYALLAKSQTKGRGRSSKNWQSRSGNLHVSLLI 65

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTL---------------PVGTDVKIKWPNDILVF 117
                 + L+ LSF  A+A+   ++S+                P    +K+KWPND+LV 
Sbjct: 66  KPDKELELLSQLSFVTALAVYDSMSSSRDRVAGSSNYMDILVKPWYDSLKLKWPNDVLVN 125

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFSLL 176
            RKIAGIL+E++ + +    ++        H P+D   P TSL  E    I+ + +  +L
Sbjct: 126 GRKIAGILLESVKVGDNYYIIIGIGINITYH-PIDIDQPTTSLISENLPLIEPQALLKIL 184

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            ++  +   +W  ++    I   W   A  + + I+IK     + G F  +D+ G ++L+
Sbjct: 185 IENFEKYYQIWDNNSF-SFIREKWLEHAYKLHENISIKQKNDIVTGLFKDIDNTGRIILQ 243


>gi|304321902|ref|YP_003855545.1| biotin protein ligase [Parvularcula bermudensis HTCC2503]
 gi|303300804|gb|ADM10403.1| biotin protein ligase [Parvularcula bermudensis HTCC2503]
          Length = 258

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 18  FFDTISSTNDECMKRA-LSGDL--GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
            +  + STND   + A + G++     W++A  QTAGRGRR   W SD  + ++  LL  
Sbjct: 17  HYRAVGSTNDTAAELARMQGEMDRSPCWVIADHQTAGRGRRGRAW-SDHADNFSGTLLWP 75

Query: 75  SISKDSLT--LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +   T  L SF  A+A+     +     T + +KWPND+L+   K+ GIL+ET+   
Sbjct: 76  LAPEHGRTPALFSFLAALAIVDSFEAVGIPRTIIGLKWPNDVLLEGGKVCGILVETVAGL 135

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK--KD 190
            GL A  +GIG+N+   P   P    +L +    I      + L    AR  + W     
Sbjct: 136 EGLMAATIGIGVNLAQVPPHAPPEGRALSQ---WITPPPPTAFLETLDARFDEWWAIYGA 192

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I + W   A G+   + ++LS  ++ G F G+D  G LLLE  +G V +   GD+
Sbjct: 193 HGFSRIRSAWLERATGLNQALVVRLSDRTLEGIFRGLDKDGALLLEH-QGEVTRFLAGDV 251

Query: 251 F 251
           F
Sbjct: 252 F 252


>gi|85860938|ref|YP_463140.1| biotin-(acetyl-CoA carboxylase) ligase [Syntrophus aciditrophicus
           SB]
 gi|85724029|gb|ABC78972.1| biotin-(acetyl-CoA carboxylase) ligase [Syntrophus aciditrophicus
           SB]
          Length = 333

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 113/250 (45%), Gaps = 31/250 (12%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
            F    +TN++    A  G      ++A  Q+ GRGRR   W S     +YA+++L   I
Sbjct: 93  HFQQTDNTNNQGKALAYEGAPEGALVIAEEQSQGRGRRGRTWFSPHSQGIYATVILRPLI 152

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AVA    + +    G  ++IKWPNDIL   RK+AGIL E     + + 
Sbjct: 153 PLSETPKLTLLAAVAATEALETQ--TGLPIRIKWPNDILANGRKLAGILTEIGTEMDAVD 210

Query: 137 AVVVGIGLNVK----HCPVDTPYPVTSLQREGG------------CIDLKDIFSLLFQDV 180
             V+G+GLNV       P D  YP TS+  E G               L+  +SLL Q  
Sbjct: 211 FAVIGMGLNVNVPQASFPSDLRYPATSILIETGRPFPRIRLLQSWLEALEKYYSLLLQG- 269

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
               D        + I++ W+     +G  I +++     +G    VD  G L+L+E  G
Sbjct: 270 ----DF-------DNILSRWKFLTDIVGSRIAVEMPGRRYIGEVQDVDGNGVLILKESDG 318

Query: 241 CVRQIFTGDI 250
            +++IF+GD+
Sbjct: 319 ALQRIFSGDV 328


>gi|222479889|ref|YP_002566126.1| biotin/acetyl-CoA-carboxylase ligase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222452791|gb|ACM57056.1| biotin/acetyl-CoA-carboxylase ligase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 329

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 122/262 (46%), Gaps = 37/262 (14%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           PY+   E++D +SSTND    R L+GD  + + +VA  QT  RGR D +W++  G ++ S
Sbjct: 73  PYAV--EYYDRLSSTNDRA--RELAGDGADGVAVVADEQTGSRGRLDREWVAPSGGVWLS 128

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV------------- 116
           L++          L + A AVA   ++ +    G +  IKWPND+LV             
Sbjct: 129 LVIRPDAPPARAPLFTLAAAVA---IVDACREAGVNAHIKWPNDVLVGGLGDETDTDTDA 185

Query: 117 -----FQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDT---PYPVTSLQRE-GGCI 167
                  RK+AGIL E     + +  ++ GIG+N     VD+   P   TSLQ   G  I
Sbjct: 186 DSEGRGGRKVAGILTEMEGEADRVSWLIPGIGVNAN---VDSDLLPADATSLQEVLGEPI 242

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGV 227
           D +   + L +   R   L       + I+  WR  A  IG  + +  S G + G  V V
Sbjct: 243 DRRRFAATLLE---RFAALAGTPDRMDRILPAWRERASTIGRRVRVDTSNGPVTGTAVDV 299

Query: 228 DDFGYLLLEEKKGCVRQIFTGD 249
           +  G L++E   G  R++  GD
Sbjct: 300 EPPGALVIETNDGT-RRVHAGD 320


>gi|138895758|ref|YP_001126211.1| BirA bifunctional protein [Geobacillus thermodenitrificans NG80-2]
 gi|196248640|ref|ZP_03147340.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. G11MC16]
 gi|134267271|gb|ABO67466.1| BirA bifunctional protein [Geobacillus thermodenitrificans NG80-2]
 gi|196211516|gb|EDY06275.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Geobacillus sp. G11MC16]
          Length = 329

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 119/245 (48%), Gaps = 13/245 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL 72
            +  FF+ + ST     K A  G      ++A  Q AGRGR D KW S +G  ++ SL+L
Sbjct: 88  HQIHFFEEVDSTQRIAAKLAYEGAPEGTLVIAEEQKAGRGRLDRKWFSPQGTGIWMSLIL 147

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       L+  +AVA+   I     +  D  IKWPNDIL+  +K  GIL E     
Sbjct: 148 RPPIPPQQAPQLTLLVAVAVSQAIQEVTGLVPD--IKWPNDILLHGKKCVGILTELQADP 205

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQDVARVLD-LW 187
           + +++V++GIG+NV       P  +    TSL  E G    +   + L Q++   L+ L+
Sbjct: 206 DRVRSVIIGIGINVNQTSAQFPEDICDIATSLAIEKGE---RIKRAPLIQEILLQLERLY 262

Query: 188 KK--DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           K+  + G   I  LW  +A  IG  +T +     I G   G+ D G L+LE+++  +  I
Sbjct: 263 KQYLEHGFRPIKLLWEGYAVSIGKPVTARTLGKVIRGIARGITDDGLLILEDEQNQLHYI 322

Query: 246 FTGDI 250
            + DI
Sbjct: 323 HSADI 327


>gi|319775907|ref|YP_004138395.1| BirA bifunctional protein [Haemophilus influenzae F3047]
 gi|317450498|emb|CBY86715.1| BirA bifunctional protein [Haemophilus influenzae F3047]
          Length = 301

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 113/231 (48%), Gaps = 26/231 (11%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++   S   G+L  V   QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYGIHYQ--PIISSTNEWILQNIPSLKKGDL-CVGEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+         V++KWPNDIL   RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVLK--------VQVKWPNDILFNGRKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQDVAR 182
           N KNG+  +V+G+G+NV   K   +  PY       E G ID     + +   L Q +  
Sbjct: 176 NHKNGMLNLVIGVGINVSLPKQTEISQPYA------EVGEIDPDVERQTLLPKLIQHLYA 229

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            L++++K+   +E    W+ +     + + +    G I G   G+D+ GYL
Sbjct: 230 RLNIFEKNGINDEFQQAWQSYNAFSNNEVNVLTEQGVISGIEQGIDERGYL 280


>gi|73666871|ref|YP_302887.1| biotin--acetyl-CoA-carboxylase ligase [Ehrlichia canis str. Jake]
 gi|72394012|gb|AAZ68289.1| Biotin--acetyl-CoA-carboxylase ligase [Ehrlichia canis str. Jake]
          Length = 247

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 125/248 (50%), Gaps = 18/248 (7%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +  E    + STN E +K A  G      I++  Q  GRGR +  W S KGNLY S+
Sbjct: 8   PNGYSLEHHKILYSTNYEAIKLAECGAKDGTIIISDEQIKGRGRYERIWHSPKGNLYFSI 67

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG--TDVKIKWPNDILVFQRKIAGILIET 128
           ++   +    +  + F  A+++   +   L     + V+ KWPND+L+  +KI+GIL+E+
Sbjct: 68  IITKFV---EIFPIPFIAALSVGKTLEEILENKEISKVQYKWPNDVLINSKKISGILLES 124

Query: 129 LNLKNGLQA-VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
             L N  Q  +VVGIG+N+       P   T++++      L ++  LL + +    +L 
Sbjct: 125 KTLNNAPQKWIVVGIGINM----YKAPEYATTIKQHNINFTLSNL-ELLEKVINHFNNLR 179

Query: 188 KK--DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL--EEKKGCVR 243
           K   + G  +I +LW    C +   IT+K    +  G+FV +D  G +++  E+K  C  
Sbjct: 180 KYYINYGFTKIKDLWLKQTCHLNSKITVKSHNNTYTGKFVTIDMKGNMIMQQEDKTTC-- 237

Query: 244 QIFTGDIF 251
            I +G+IF
Sbjct: 238 -ITSGEIF 244


>gi|329123762|ref|ZP_08252322.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Haemophilus aegyptius ATCC 11116]
 gi|327469961|gb|EGF15426.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Haemophilus aegyptius ATCC 11116]
          Length = 302

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 113/231 (48%), Gaps = 26/231 (11%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++   S   G+L  V   QTAGRGRR  +W+S   G +  S
Sbjct: 69  PYGIHYQ--PIISSTNEWILQNIPSLKKGDL-CVGEYQTAGRGRRGRQWLSPFAGQIMFS 125

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+         V++KWPNDIL   RK+ GIL+E  
Sbjct: 126 FYWTFD-PKKSIEGLSLVIGLAIAEVLK--------VQVKWPNDILFNGRKLGGILVEIA 176

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCID----LKDIFSLLFQDVAR 182
           N KNG+  +V+G+G+NV   K   +  PY       E G ID     + +   L Q +  
Sbjct: 177 NHKNGMLNLVIGVGINVSLPKQTEISQPYA------EVGEIDPDVERQTLLPKLIQHLYA 230

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            L++++K+   +E    W+ +     + + +    G I G   G+D+ GYL
Sbjct: 231 RLNIFEKNGINDEFQQAWQSYNAFSNNEVNVLTEQGVISGIEQGIDERGYL 281


>gi|317122126|ref|YP_004102129.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter marianensis
           DSM 12885]
 gi|315592106|gb|ADU51402.1| biotin/acetyl-CoA-carboxylase ligase [Thermaerobacter marianensis
           DSM 12885]
          Length = 362

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 117/238 (49%), Gaps = 6/238 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
            +   + STND   + A  G      ++A  Q AGRGR    W S  G L+ SL+L  ++
Sbjct: 100 HWLPEVGSTNDVARRLADDGAPEGTLVIADRQLAGRGRLRRAWWSPPGGLWMSLILRPTL 159

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             + L LL+ A A A+   +      G  V +KWPND+L+  RKIAGIL+ET+   +G +
Sbjct: 160 PPERLPLLTLAAAAAVAEALERH--AGRPVAVKWPNDVLIDDRKIAGILLETVAHPHGAE 217

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            VV GIG+N+    +  P      +T L RE      ++  +    D   V      D G
Sbjct: 218 YVVAGIGINLDVEGEPVPPGLEGRLTWLAREVVEPVTRNEVAEAVLDRLEVRYRQLHDQG 277

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            + +++ WR  A  +G+ + + L  G ++G  + V   G L++E+  G   ++  GD+
Sbjct: 278 PDPVLDAWRARAAWLGEPVRVTLPAGEVVGIALDVAPDGSLVVEQAGGRRERVLAGDV 335


>gi|134102934|ref|YP_001108595.1| biotin--[acetyl-CoA-carboxylase] ligase [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291009689|ref|ZP_06567662.1| biotin--[acetyl-CoA-carboxylase] ligase [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133915557|emb|CAM05670.1| biotin--[acetyl-CoA-carboxylase] ligase [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 276

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 18/256 (7%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYA 68
            PY+   +      STN +  K    G      ++A  Q  GRGR   +WIS +G  L+ 
Sbjct: 20  GPYAA-LDVVTVTGSTNTDLAKAVHEGAADRTVLIAEEQQQGRGRMQRQWISPRGYGLHV 78

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGI 124
           S+LL   +   S+  L     VA+   +  T   G    +KWPND+L+       K AGI
Sbjct: 79  SVLLRPEVPATSMAWLPLLAGVALAETVERT--TGVRAALKWPNDLLLGGGDDWHKGAGI 136

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSLLFQD 179
           L E +   +G+ AVV+G+G+NV H   + P      P TSL  EG  +D +D  + L + 
Sbjct: 137 LAEAIATADGM-AVVLGMGVNVHHSREELPAGAGGLPATSLAAEGADVDREDFAACLLEA 195

Query: 180 VARVLDLWKKDTG---REEIMNLWRCFACGIGDLITIKLSY-GSILGRFVGVDDFGYLLL 235
            A V D W+  +G      ++  ++ +   IG  + ++L     +LG    VD  G L++
Sbjct: 196 FAAVDDEWRAGSGDVVSTGLLERYQRWCATIGKRVRVELGRDDDLLGTAESVDRDGRLVV 255

Query: 236 EEKKGCVRQIFTGDIF 251
               G    +  GD+ 
Sbjct: 256 RGPGGVSTAVSAGDVV 271


>gi|158423306|ref|YP_001524598.1| biotin--acetyl-CoA-carboxylase ligase [Azorhizobium caulinodans ORS
           571]
 gi|158330195|dbj|BAF87680.1| biotin--acetyl-CoA-carboxylase ligase [Azorhizobium caulinodans ORS
           571]
          Length = 189

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 2/182 (1%)

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIAGILIET 128
           +L +     +L  L F   +A+R  + +  P+ +   +++KWPND+++   K+AGIL+E 
Sbjct: 1   MLPNPAPVANLAQLCFVAGLALRDAVVAAAPLISIDGLRLKWPNDLMLDGGKLAGILVEG 60

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            N + G  A V+G G+N  H P   PY  TSL+  G       +   L   +   L+ W 
Sbjct: 61  ANDRYGRPAAVIGFGVNCLHHPEGLPYRATSLEEAGAPTAPDRLLEALDLAMTVRLNQWN 120

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   I   W  +A  IGD IT+K+    + GRF  +D+ G ++L  + G    +  G
Sbjct: 121 GGNGFASIRTEWMRYALAIGDTITVKIGEREVTGRFESIDNRGAMMLRRRDGIAEIVTAG 180

Query: 249 DI 250
           ++
Sbjct: 181 EV 182


>gi|329765334|ref|ZP_08256914.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329138240|gb|EGG42496.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 333

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 125/245 (51%), Gaps = 14/245 (5%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F++I ST ++ MK A   D G + I+A  QT+G+GR   KW+S KG ++ S+++  
Sbjct: 89  RAYYFESIDSTQNQAMKMASDVDDGTI-IIAEKQTSGKGRSGRKWVSPKGGIWFSIIMHP 147

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                ++TL   A ++ +   I  TL  G   ++KWPNDI +  +K+AG+L++     N 
Sbjct: 148 KFDISAITLFPLASSLGLAYAIEKTL--GIKSELKWPNDITIKGKKVAGMLVDASIESNK 205

Query: 135 LQAVVVGIGLN-------VKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           ++ +++G+G+N       ++    DT   Y V SL  +   I    +      ++ +V +
Sbjct: 206 IEKLILGVGINFNVDVKQIEKTLKDTENFYGVASLSEQNKTIKPISLLQSFLIELEQVYN 265

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L      + +I+  +   +  +G  + +      I G  + +DD G L++ E K  +R +
Sbjct: 266 LLNSGDSK-KIIREYTKRSSTVGQKVELNTDNRKIKGIAIKIDDDGALVVSENKKNIR-V 323

Query: 246 FTGDI 250
            +GDI
Sbjct: 324 TSGDI 328


>gi|68248829|ref|YP_247941.1| biotin--protein ligase [Haemophilus influenzae 86-028NP]
 gi|68057028|gb|AAX87281.1| BirA bifunctional protein [Haemophilus influenzae 86-028NP]
          Length = 302

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 115/228 (50%), Gaps = 20/228 (8%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PY   Y+    ISSTN+  ++   S   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 69  PYGIHYQ--PIISSTNEWILQNIPSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 125

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 126 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 176

Query: 130 NLKNGLQAVVVGIGLNV---KHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           N KNG+  +V+G+G+N    K   +  PY  V  +  +   +D + +   L Q +   L+
Sbjct: 177 NHKNGMLNLVIGVGINASLSKQTEISQPYAEVCEIDPD---VDRQTLLPKLIQHLYTRLN 233

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           +++++   EE    W+ +       + +    G I G   G+D+ G+L
Sbjct: 234 IFEQNGIDEEFQQAWQSYNAFSNSEVKVLTEQGVISGIEQGIDERGHL 281


>gi|84516718|ref|ZP_01004076.1| biotin--acetyl-CoA-carboxylase ligase [Loktanella vestfoldensis
           SKA53]
 gi|84509186|gb|EAQ05645.1| biotin--acetyl-CoA-carboxylase ligase [Loktanella vestfoldensis
           SKA53]
          Length = 261

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 117/246 (47%), Gaps = 10/246 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           P ++     D + ST  E  +RA  GD+    WI+A  QTA RGRR   W +  GNL A+
Sbjct: 20  PDAYGRIMLDNVDSTMAEAARRA--GDIDRPTWIIAQTQTAARGRRGRVWQAPAGNLNAT 77

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+     +       SF  A A+ + ++  +P    + +KWPND+L+   K+AGIL+E+ 
Sbjct: 78  LIFKPDATPAEAARRSFLAANALFAALSIYVPA-EKLSLKWPNDVLLSGGKVAGILLESS 136

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP----YPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
                +  + +G+G+N++H P D       PV+  Q  G  ++  D  + L  D     +
Sbjct: 137 GQGGNVDWLSIGVGVNLRHAPQDLADAAFAPVSLTQMGGWEVEPVDFLTTL-ADAYATQE 195

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G   I   W   A  +G++IT +     I+G F  +DD G L+L    G  R I
Sbjct: 196 ARLAQMGFARIRQDWLAHAARLGEVITARTMREEIIGTFDTIDDDGNLVLTTGAGP-RVI 254

Query: 246 FTGDIF 251
              D++
Sbjct: 255 SAADVY 260


>gi|298489112|ref|ZP_07007134.1| Biotin-protein ligase / Biotin operon repressor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156424|gb|EFH97522.1| Biotin-protein ligase / Biotin operon repressor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 319

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 126/246 (51%), Gaps = 24/246 (9%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 65  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 183 AGILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 240

Query: 178 QDVARVLDLWKKD-----TGREEIMNLWRCFACGIGDLITIKLSYG--SILGRFVGVDDF 230
             +  +L + +K+      G  E  +LW+  A        ++L  G  ++ G  +GVD  
Sbjct: 241 SQLESLLAVHRKEGFVAFQGEWERGHLWQGAA--------VRLLSGAEAVEGLVLGVDSL 292

Query: 231 GYLLLE 236
           G L LE
Sbjct: 293 GALRLE 298


>gi|299538591|ref|ZP_07051874.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus fusiformis ZC1]
 gi|298726178|gb|EFI66770.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Lysinibacillus fusiformis ZC1]
          Length = 327

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 114/240 (47%), Gaps = 8/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            ++D + ST     K A  G      I+   QTAGRGR    W S  G  ++ ++++   
Sbjct: 87  HYYDVVDSTQTIAHKLAQEGAPHGTIIIGEKQTAGRGRMARPWESAHGTGIWMTVIVRPD 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++    +  +  +AVA+   I  TL    +  IKWPND+L+  +K  GIL E     + +
Sbjct: 147 VTPQQASSYTLVVAVAVTMAI-KTLYKHVEPAIKWPNDLLINGKKCTGILTEMQAEADLV 205

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
           QA++VGIG+N      D    +    TSL+ E G  I+   + + +   + +  +L+ K+
Sbjct: 206 QALLVGIGINANQAVADFSPDIADIATSLRLEAGEEINRAALVASILHYLEQFTELYVKE 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   +  LW+  +C IG  I +        G   G+ D G L L +  G VR I+ GDI
Sbjct: 266 -GFASLKTLWQQLSCTIGQRIEVTTIRERFEGVASGITDDGVLQLTQDDGTVRTIYAGDI 324


>gi|283780500|ref|YP_003371255.1| biotin/acetyl-CoA-carboxylase ligase [Pirellula staleyi DSM 6068]
 gi|283438953|gb|ADB17395.1| biotin/acetyl-CoA-carboxylase ligase [Pirellula staleyi DSM 6068]
          Length = 266

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 118/241 (48%), Gaps = 20/241 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLG-NLWIVASCQTAGRGRRDNKWISDKGNLYASLLL--I 73
            +F  I STN   + +A+       L + A  QTAGRGR  N+W S  G L  SLLL   
Sbjct: 19  HYFAKIGSTNSYALSQAVDDTQKCPLLVAAREQTAGRGRGANRWWSSDGCLMFSLLLDCT 78

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           D +      LLS    +++   I   +P G  V +KWPND+ +  RK+AGILIET    +
Sbjct: 79  DWLPTSKWPLLSLVTGISIAQTIEQLIP-GDVVGVKWPNDVYLAGRKVAGILIETSAAAS 137

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDLWK 188
           G   +VVGIGLNV +     P  + +     + R      L+ +   L   V R++  W+
Sbjct: 138 G--RLVVGIGLNVNNSVATAPADIQARAVALVDRSSARWTLELVLERL---VERLITNWQ 192

Query: 189 K--DTGREEIMNLWRCFACGIGDLITIK----LSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           +  + G E     W  +    G ++TI+     S  +++GR +G+D+ G L++E   G +
Sbjct: 193 RLGEQGFESFYRDWPRYCILSGAIVTIRPQAQHSEATVIGRALGIDEAGCLVVETTGGPI 252

Query: 243 R 243
            
Sbjct: 253 H 253


>gi|304316132|ref|YP_003851277.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777634|gb|ADL68193.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 326

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 127/239 (53%), Gaps = 8/239 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
           Y  F++ISSTND   + A S   G   IVA  QT+GRGR    W+S+KG  ++ S++L  
Sbjct: 83  YLHFESISSTNDYAKEIAPSATDGTA-IVAEEQTSGRGRMGRHWVSNKGQGIWLSMILKP 141

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           ++S +    L+   AVA+   I     + +   IKWPNDI++  +K+ GIL E     + 
Sbjct: 142 NLSPNEAVKLTQVAAVAVVDSIKEIADIRSG--IKWPNDIVINSKKVCGILTEMNGEIDR 199

Query: 135 LQAVVVGIGL--NVKHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDT 191
           +  +V+GIG+  NV++ P D     TSL  E G I D K + + +  +  +   ++  + 
Sbjct: 200 VNFIVIGIGINVNVQNFPEDLCGKATSLSIETGKILDRKPLTASILNNFEKYYRIFLIN- 258

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I NL + ++  +   + + ++    +GR V +DD G L++  K G  + I +GD+
Sbjct: 259 GFSSIRNLCKEYSLTLNKDVKVIINNNECIGRAVDIDDDGNLIVVFKNGEKKTIASGDV 317


>gi|308069475|ref|YP_003871080.1| BirA bifunctional protein [Paenibacillus polymyxa E681]
 gi|305858754|gb|ADM70542.1| BirA bifunctional protein [Paenibacillus polymyxa E681]
          Length = 324

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 130/262 (49%), Gaps = 20/262 (7%)

Query: 2   FSNLSECQNPYSF--RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
            S L++  N  SF  R    D+  ST  + M+ A  G      ++A  QTAGRGR   KW
Sbjct: 68  VSKLADILNTQSFGQRIVVLDSTVSTQQDAMRLAEEGTPEGTVVLAEEQTAGRGRLGRKW 127

Query: 60  ISDKGN-LYASLLLIDSIS---KDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDI 114
            S +G  ++ S++L  +        LTLL+  A+  A+R +       G +  IKWPND+
Sbjct: 128 YSPRGKGVWMSIVLRPTQPLAFTPQLTLLTGVAVCRAIRRL------TGVEAGIKWPNDL 181

Query: 115 LVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGC-IDL 169
           L+  RK++GIL+E+      ++  + GIG++V     D P  +    TSL+ E G  ID 
Sbjct: 182 LIHGRKVSGILLESATEDQRIRYCIAGIGIDVNLNKEDYPEELSQVGTSLKIEAGREIDR 241

Query: 170 KDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVD 228
             + S + +++ ++  L+  + G + I  LW   +  +   +      G  + G  VG+D
Sbjct: 242 TVLISSVLEEMEQLSKLY-AEQGFQPIAMLWEALSVTMNRSVRAHTGQGIPVEGTAVGLD 300

Query: 229 DFGYLLLEEKKGCVRQIFTGDI 250
             G L++E  +G   Q+ +GDI
Sbjct: 301 PSGALVIETDQGERIQVISGDI 322


>gi|299821658|ref|ZP_07053546.1| biotin--[acetyl-CoA-carboxylase] ligase [Listeria grayi DSM 20601]
 gi|299817323|gb|EFI84559.1| biotin--[acetyl-CoA-carboxylase] ligase [Listeria grayi DSM 20601]
          Length = 324

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 117/241 (48%), Gaps = 15/241 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F++T+ ST     K    G      IV   Q  G+GR +  W S KG  ++ SL++   I
Sbjct: 86  FYETVGSTQLVAKKAVNDGAPEGTVIVGDQQETGKGRMNRNWDSQKGQGIWMSLIVKPDI 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNLKNG 134
                   +F  ++A+   I       TD+  +IKWPNDI + +RK+ G+L E     + 
Sbjct: 146 PIAKAPQFTFIASLAIVEAIEKV----TDLTPQIKWPNDIYIGKRKVCGVLTEMQAEADQ 201

Query: 135 LQAVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK--- 189
           ++A+++GIG+NV     P +     TSL++E G    +   ++LFQ      + + +   
Sbjct: 202 IEALILGIGINVNQAAFPDEIKNKATSLRQEIGETVSR---TILFQAAMLYFEKYYQLYT 258

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           + G E I  LW   A      +      GSI G+  G+ D G LL+E+ +G + +I++ D
Sbjct: 259 EKGFEPIKLLWESKAIPFQSTMIASTLKGSIRGKVKGISDEGVLLMEDAQGVIHEIYSAD 318

Query: 250 I 250
           I
Sbjct: 319 I 319


>gi|55376943|ref|YP_134793.1| biotin-(acetyl-CoA carboxylase) ligase [Haloarcula marismortui ATCC
           43049]
 gi|55229668|gb|AAV45087.1| biotin-(acetyl-CoA carboxylase) ligase [Haloarcula marismortui ATCC
           43049]
          Length = 315

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 111/235 (47%), Gaps = 17/235 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E+ D+I STN      A  G+   + ++A  QT GRGR D  W S  G ++ S+L  
Sbjct: 75  FSVEYHDSIPSTNARARDLAAEGESDTV-VLADEQTGGRGRLDRDWHSPSGGIWLSVLFR 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIETL 129
             +      + + A AVA+          G +  IKWPND+LV     +RK+ GIL E  
Sbjct: 134 PDVPMAHAPVFTLAAAVAVTRAARE---AGVEAGIKWPNDVLVRHGDEERKLVGILTEME 190

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPV--TSLQRE-GGCIDLKDIFSLLFQDVARVLDL 186
              + +  VVVGIG+N    P D P     TSL  E G  +D +    L  Q +    D 
Sbjct: 191 GEADRVSWVVVGIGVNANVDPADLPDEANPTSLSTERGEPLDRR----LFTQRLLEEFDA 246

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            ++DTGR  ++  WR +A  +G  + ++   G I G  V +   G L++E   G 
Sbjct: 247 LRQDTGR--VVEAWREYATTLGKRVRVETPGGPIEGEAVDIQFPGALVIETASGT 299


>gi|296536142|ref|ZP_06898270.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Roseomonas
           cervicalis ATCC 49957]
 gi|296263513|gb|EFH10010.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Roseomonas
           cervicalis ATCC 49957]
          Length = 241

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 115/242 (47%), Gaps = 8/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           ++R    D + ST D  +  A +G+     ++A  Q+AGRG +   W S  GNL+ SLLL
Sbjct: 2   NWRLSIHDDLPSTQDAVLAAAQAGEGEGFAVLARRQSAGRGTQGRAWRSPPGNLFLSLLL 61

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE-TLNL 131
             +     L   S    +A+   I++ LP    +++KWPND+L+   K AGIL +   + 
Sbjct: 62  RPAGPARELPQWSLLAGLAVAEAISAHLPDPAALRLKWPNDVLLDGAKCAGILTQGQPDA 121

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             G+  +  GIG+N+   P     P  SL +  G     ++ +  +  +AR LD W++  
Sbjct: 122 AGGIAWLAFGIGVNLAEAPQLPDRPTASLAQHAG--RAPEVVAFAWALLAR-LDHWRQRQ 178

Query: 192 GRE---EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             E    +   W      +   + ++   G + G + G+ + G LLL  K G V  + +G
Sbjct: 179 QAEGFAPVRAAWVARGPALRAPLALRRPEGELHGLYQGLTEDGRLLLCSKDGPV-AVASG 237

Query: 249 DI 250
           ++
Sbjct: 238 EV 239


>gi|89070155|ref|ZP_01157484.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola granulosus
           HTCC2516]
 gi|89044272|gb|EAR50418.1| biotin--acetyl-CoA-carboxylase ligase [Oceanicola granulosus
           HTCC2516]
          Length = 227

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 107/215 (49%), Gaps = 9/215 (4%)

Query: 42  WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           WI+A  Q+AG GRR   W   +GNL+A+L+   + S       SF  A A+   +A  L 
Sbjct: 16  WIMAHRQSAGTGRRGRPWQGGEGNLFATLIYKPACSHAEAARRSFLAANALYETLA--LY 73

Query: 102 VGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPY----P 156
           V  D + +KWPND+L+ + K+AGIL+E       +  + VGIG+N+   P D P     P
Sbjct: 74  VDRDTLALKWPNDVLLHEGKVAGILLEASGGGPFVDWLAVGIGVNLATAPPDDPAMNARP 133

Query: 157 VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLS 216
           V+   + G  +  +D  ++L  + A    +   + G   +   W   A  IG++IT + S
Sbjct: 134 VSLFDQGGAPVAPEDFLTVLATNFATQEGIL-AELGFARVREAWLERAARIGEVITARTS 192

Query: 217 YGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I G F  +D+ G L+L    G  R I   DI+
Sbjct: 193 RDEITGTFDTIDEDGNLVLLTADGP-RAIPAADIY 226


>gi|148264857|ref|YP_001231563.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter uraniireducens
           Rf4]
 gi|146398357|gb|ABQ26990.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter uraniireducens
           Rf4]
          Length = 336

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 117/238 (49%), Gaps = 10/238 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
           F+   STN+   K A  G      ++A  Q+ G+GR   +W S  G NLY S++L  SI+
Sbjct: 100 FNETDSTNNVAFKLAEDGAAEGTVVIADTQSRGKGRLGREWASPDGVNLYCSIILRPSIT 159

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
             + + L+F   VA+   +  + P+     IKWPNDIL+  +KIAG+L E       +  
Sbjct: 160 PVAASQLTFLSVVAVARSVEQSTPL--QPWIKWPNDILINGKKIAGLLNEMSAETEKVNF 217

Query: 138 VVVGIGLNV----KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTG 192
           VV+GIG+NV    +  P D  +P +SL  EGG  ++  D    L  ++  + D +  D G
Sbjct: 218 VVLGIGVNVNMRSEQFPADLRHPASSLFIEGGVPVNRNDFVRTLLHELDALYDSYLVD-G 276

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I   W   +   G  + +      + G   G+DD G LLL +  G   ++ +GD+
Sbjct: 277 YGAIREEWLARSQMYGRQVRVSCQDRVMTGVVKGIDDIGALLL-DLDGREERVLSGDV 333


>gi|328954522|ref|YP_004371856.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobacca acetoxidans DSM
           11109]
 gi|328454846|gb|AEB10675.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobacca acetoxidans DSM
           11109]
          Length = 342

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 110/237 (46%), Gaps = 8/237 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
            F  + STND     A  G+     IVA  Q+AGRGR    W S  G  +Y SL+L   +
Sbjct: 97  HFMNLPSTNDMAKDLARQGNPEGSIIVAESQSAGRGRMGRIWESPPGGGIYLSLILRPPL 156

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               L  L+   AVA+   I      G    IKWPNDIL+  +K+ GIL E     + + 
Sbjct: 157 PPAELPRLTLTAAVAVIQAIREV--AGLAADIKWPNDILLQGKKLGGILTEMETESDQMS 214

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE- 195
            V++G+GLNV       P PV  L         +     + + +   LD       +EE 
Sbjct: 215 HVILGLGLNVNTTVF--PEPVRRLATSLASAGKRYSRLAILRSLLAALDSLYGRFLQEEF 272

Query: 196 --IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             I++LWR  A  +G  +T++     I G  + VD  G LLL++  G + ++ +G+I
Sbjct: 273 PAILDLWRQSAVTLGQQVTVRQGKEIISGLALDVDSDGALLLQQPDGRIEKVISGEI 329


>gi|294498155|ref|YP_003561855.1| bifunctional protein BirA [Bacillus megaterium QM B1551]
 gi|294348092|gb|ADE68421.1| bifunctional protein BirA [Bacillus megaterium QM B1551]
          Length = 329

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 115/240 (47%), Gaps = 9/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDS 75
            + +++ ST     + A  G      +VA  QTAGRGR D  W S K    + S++L  S
Sbjct: 87  HYEESVHSTQKIAHRIAQEGAKEGTVVVAEEQTAGRGRLDRAWYSPKYTGAWMSIILRPS 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPND+L+  +K+ GIL E     + +
Sbjct: 147 IPPQQAPQLTLLSAVAVVQAIQEVTNLSPD--IKWPNDVLLNGKKLVGILTEMQADFDRI 204

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
            +V++GIG+NV     D      +  TSL+ E G  I+   +    F  +  + + + K+
Sbjct: 205 HSVIIGIGINVNQQETDFNEQIKHIATSLRIEKGEEINRAALMQAFFLKLETLYEEYLKN 264

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW  +A  IG  I  +    +I G   G+ D G LL+E+ +G + +I + DI
Sbjct: 265 -GFGLIKVLWETYAISIGKRIIARTMTANIEGFAKGITDEGVLLIEDDEGVIHRIHSADI 323


>gi|56697600|ref|YP_167969.1| biotin--acetyl-CoA-carboxylase ligase [Ruegeria pomeroyi DSS-3]
 gi|56679337|gb|AAV96003.1| biotin--acetyl-CoA-carboxylase ligase [Ruegeria pomeroyi DSS-3]
          Length = 249

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  +     D + ST +E  + A +   G  WI+A  QTA RGRR   W   +GNL A+L
Sbjct: 5   PQGYGKRVLDEVDSTLNEAARIAPTLS-GPEWIMARRQTAARGRRGRAWTQAQGNLAATL 63

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++          L SF  A+A+     +       + +KWPND+L+   K+AGIL+E+  
Sbjct: 64  VMRPVGEAKQAALRSFVAALALFDACVAVTGRAEGLALKWPNDVLLNGGKLAGILLESTG 123

Query: 131 LKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
             +G+  + +GIG+N+   P           PV+ +   G  ++ +   + L    AR  
Sbjct: 124 HGSGVAHLAIGIGVNLADAPGADAVEPGAVRPVSLVSETGAQVEPELFLTELAAAFAR-Y 182

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           +      G   I + W   A  +G++IT + +    +G F  VD  G L+L   +G V
Sbjct: 183 ETQFLTYGFAPIRSAWLARAARLGEVITARTATSQTVGTFETVDAEGNLVLNTAQGRV 240


>gi|242398221|ref|YP_002993645.1| Biotin-(Acetyl-coA carboxylase) ligase [Thermococcus sibiricus MM
           739]
 gi|242264614|gb|ACS89296.1| Biotin-(Acetyl-coA carboxylase) ligase [Thermococcus sibiricus MM
           739]
          Length = 248

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 128/238 (53%), Gaps = 14/238 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +F  I STN+   + A   + G + IVA  Q  G GR+   W S +G L+ S++L  + +
Sbjct: 15  YFKKIDSTNEYAKRIAAHEEEGTV-IVADVQETGYGRKFRAWASPQGGLWMSVILKPNTT 73

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
            + +  L F  A+A   V+ +   +G + KIKWPND+LV ++KI GIL+E    +  +  
Sbjct: 74  PEHMIKLVFLGALA---VVETLEQLGIEGKIKWPNDVLVNEKKICGILVEGSFSEKEVYY 130

Query: 138 VVVGIGLNVKHC-PVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD--TGR 193
           +V+GIG+NV +  P +     TSL+   G  I + ++F +L +     L+ W ++   G+
Sbjct: 131 IVLGIGMNVNNSLPQELVSTSTSLREVLGVEIPIIEVFKILVER----LEHWYREFLAGK 186

Query: 194 EE-IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +  I+  WR  A  +   + +     ++ G+ + +D+FG L+LE + G   +I  GD+
Sbjct: 187 DALILQKWRENAI-LRRKVKLITEDKTLTGKALDIDEFGALILELEDGKKEKILYGDV 243


>gi|219851654|ref|YP_002466086.1| biotin/acetyl-CoA-carboxylase ligase [Methanosphaerula palustris
           E1-9c]
 gi|219545913|gb|ACL16363.1| biotin/acetyl-CoA-carboxylase ligase [Methanosphaerula palustris
           E1-9c]
          Length = 326

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 124/249 (49%), Gaps = 19/249 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLW---IVASCQTAGRGRRDNKWISDKGNLYASLL 71
           + ++  T  STND     A  GD+  L    I+A  QT G GR    W+S +G ++ +L+
Sbjct: 83  QMQYLKTTPSTNDVARTLATEGDVAALHGTVIIAEEQTGGVGRLSRAWVSPQGGIWITLI 142

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           L  +I  D + +++ A AVA+   I     +G    IKWPND+ +  +K+AG+L+E    
Sbjct: 143 LKPTIPIDHVFMITMAGAVAIARAIRKEFDIGA--LIKWPNDVYIGDKKVAGLLLELAAE 200

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-----VTSLQRE-GGCIDLKDIFSLLFQDVAR--- 182
            + +   ++GIG++V +  +DT  P     VT++  E    +D     + + ++  R   
Sbjct: 201 SDSIHYCLLGIGIDV-NIKLDTLSPELRSGVTTISEELEHEVDRAAFLARVLREFERHYQ 259

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           VL+  + D     I+  W+  +  +   + +     S  G  + +D++G L++ ++ G +
Sbjct: 260 VLESGEYDA----ILREWKSMSYTLEQHVRVNTMRNSFEGEAIDIDEYGALIVRKENGKI 315

Query: 243 RQIFTGDIF 251
            ++  GD F
Sbjct: 316 ERVIAGDCF 324


>gi|94496466|ref|ZP_01303043.1| biotin protein ligase [Sphingomonas sp. SKA58]
 gi|94424212|gb|EAT09236.1| biotin protein ligase [Sphingomonas sp. SKA58]
          Length = 219

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 100/212 (47%), Gaps = 10/212 (4%)

Query: 42  WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           W+ A  QT GRGR    W S  GNL++S L+           L+   A A+ ++IA  L 
Sbjct: 14  WLRAGRQTGGRGRMGRHWESPAGNLHSSTLVRVRAGDPPAHTLALVAANAVHALIAP-LC 72

Query: 102 VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ 161
           VG + +IKWPNDILV   KIAGIL+E         AV+ GIG+NV   P D   PVTSL+
Sbjct: 73  VG-NARIKWPNDILVDGAKIAGILLERAG-----DAVIAGIGVNVTGHPEDLDRPVTSLK 126

Query: 162 REGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-S 219
            +G    D   +   L       L +W+   G E +   W   A   G  + +    G  
Sbjct: 127 AQGAIEADAGALLERLAALFTHWLAVWRAQ-GLEPVRAHWLLNAHPRGTAMRVLQPDGEQ 185

Query: 220 ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           + G F  +D  G L+L    G  R I  GDI 
Sbjct: 186 VEGAFDTLDQQGMLILRLADGQSRAIHAGDII 217


>gi|302383064|ref|YP_003818887.1| biotin/acetyl-CoA-carboxylase ligase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193692|gb|ADL01264.1| biotin/acetyl-CoA-carboxylase ligase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 253

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 113/239 (47%), Gaps = 5/239 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
              D I STN E  +RA +G+    WIVA  Q AGRGRR  +W S+ GNL+A+LL +   
Sbjct: 6   HLLDEIDSTNAEARRRAEAGETAVQWIVARRQAAGRGRRGREWNSETGNLFATLLTLTRK 65

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  ++F  A+A+  ++     V   V IKWPND+++   K +GILIE+    +   
Sbjct: 66  PPAEAAQVTFVAALAVADLL-DAFAVPGVVSIKWPNDVMLDGDKASGILIESGTHASAAL 124

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWK---KDTG 192
            + VGIG+N+ H P  T  P TSL       I            +A    +W+   +  G
Sbjct: 125 WLAVGIGVNLAHAPDATERPATSLASHLRSDIAYPPSVEAAATVLAEAFAIWQTRWETLG 184

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              I++ W     G+      +L + ++ G   GV   G L L    G +R I  GD+F
Sbjct: 185 FAPILDAWTTRTQGLDGPCVARLGHETVTGIADGVAPDGALRLRTADGQLRLISAGDVF 243


>gi|320322338|gb|EFW78432.1| biotin--protein ligase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331996|gb|EFW87932.1| biotin--protein ligase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330879341|gb|EGH13490.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 319

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 121/239 (50%), Gaps = 10/239 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 65  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 183 AGILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 240

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  +L + +K+ G     + W       G  + +     ++ G  +GVD  G L LE
Sbjct: 241 SQLESLLAVHRKE-GFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE 298


>gi|91776433|ref|YP_546189.1| biotin--acetyl-CoA-carboxylase ligase [Methylobacillus flagellatus
           KT]
 gi|91710420|gb|ABE50348.1| Biotin--acetyl-CoA-carboxylase ligase [Methylobacillus flagellatus
           KT]
          Length = 325

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 117/238 (49%), Gaps = 13/238 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL 72
           F+   FD+I STN   M++A  G        A  QT GRGRR   W S  G +L  SLL 
Sbjct: 81  FKLLMFDSIESTNSYLMQQAALGAAHGTVAAALLQTKGRGRRGRSWQSAFGASLTFSLLW 140

Query: 73  IDSISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
              +   +L+ LS A+ +A+ R++    L      ++KWPNDILV  RK+AGILIE    
Sbjct: 141 RFQLGASALSGLSLAVGLALVRTLHEYGL---RSAQLKWPNDILVRGRKLAGILIELHGD 197

Query: 132 KNGLQAVVVGIGLNVKHCPVDT----PYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDL 186
             G  A V+G+GLN+K  PV        PVT L       I+  D+   L + +A+VL+ 
Sbjct: 198 MEGPSAAVIGVGLNLK-LPVAAREKIDQPVTDLASHLPLEINPNDMLGQLLKQLAQVLEE 256

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVR 243
           +++  G   +   W       G+ + +    G    GR  G+ D G LL++ + G  R
Sbjct: 257 FER-AGFAGMREEWMSHHIFQGETVKLLFPDGREQYGRVEGIADDGVLLIKNEHGNQR 313


>gi|293609097|ref|ZP_06691400.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829670|gb|EFF88032.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 255

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 117/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 32  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 90

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     + +      ++++KWPND+   Q K  GIL+E L+        +V
Sbjct: 91  RLALEVALNILQIPQLQA-----LNLQVKWPNDLYSAQGKWGGILVEPLSQHQA----IV 141

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G    G ++L     +  Q+ AR       D G   
Sbjct: 142 GVGINLKTPPVTDSDQPITSLEDLGLEQMGRLELISELYVAIQNAARWF-----DHGCYN 196

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  I  L+  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 197 LAGRFNHHAAWINQLVQFEHSQGLVHGRFVGISNEGAVILETPE--PQQFYQGRL 249


>gi|255281434|ref|ZP_05345989.1| biotin-[acetyl-CoA-carboxylase] ligase [Bryantella formatexigens
           DSM 14469]
 gi|255267922|gb|EET61127.1| biotin-[acetyl-CoA-carboxylase] ligase [Bryantella formatexigens
           DSM 14469]
          Length = 326

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 113/237 (47%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA-SLLLIDSI 76
           + DT+ STND   K A  G      +VA  Q+ G+GRR   WI+  G   A S+L+   I
Sbjct: 83  YLDTVDSTNDYVKKLAEQGAPHGTLVVADYQSGGKGRRGRTWITPHGTTIAMSILVRPQI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             +  ++L+    +A    +      G DVKIKWPND+++  +K++G L E      G+ 
Sbjct: 143 RPEKASMLTLVTGMAAAEAVGQI--TGLDVKIKWPNDLVIHGKKLSGTLTEMSAEMEGVH 200

Query: 137 AVVVGIGL--NVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV+G G+  N+   P +     +SLQ E G  +D   I     +      + +      
Sbjct: 201 YVVIGTGINANITEFPEELKDLASSLQLELGHPVDRGAIICTCMKYFENYYEKFITTQDM 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +++ ++     +   + +    G   G  +G+D+ G LL+E++ G + +++ G++
Sbjct: 261 SLLIDEYQRLLANMDRQVRVLDPAGEYGGIAIGIDEQGQLLVEKEDGSITRVYAGEV 317


>gi|295703506|ref|YP_003596581.1| bifunctional protein BirA [Bacillus megaterium DSM 319]
 gi|294801165|gb|ADF38231.1| bifunctional protein BirA [Bacillus megaterium DSM 319]
          Length = 329

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 115/240 (47%), Gaps = 9/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDS 75
            + +++ ST     + A  G      +VA  QTAGRGR D  W S K    + S++L  +
Sbjct: 87  HYEESVHSTQKIAHRIAQEGAKEGTVVVAEEQTAGRGRLDRAWYSPKYTGAWMSIILRPA 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+   AVA+   I     +  D  IKWPND+L+  +K+ GIL E     + +
Sbjct: 147 IPPQQAPQLTLLSAVAVVQAIQEVTNLSPD--IKWPNDVLLNGKKLVGILTEMQADFDRI 204

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
            +V++GIG+NV     D      +  TSL+ E G  I+   +    F  +  + + + K+
Sbjct: 205 HSVIIGIGINVNQQETDFNEQIKHIATSLRIEKGEEINRAALMQAFFLKLETLYEEYLKN 264

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW  +A  IG  I  +    +I G   G+ D G LL+E+ +G + +I + DI
Sbjct: 265 -GFGLIKVLWETYAISIGKRIIARTMTANIEGFAKGITDEGVLLIEDDEGVIHRIHSADI 323


>gi|189501364|ref|YP_001960834.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium phaeobacteroides
           BS1]
 gi|189496805|gb|ACE05353.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium phaeobacteroides
           BS1]
          Length = 329

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 110/236 (46%), Gaps = 5/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           F + + STN +    A  G      +VA CQT GRGR   +W+S  G NLY SL+L   +
Sbjct: 86  FHEKVDSTNMQAKILARQGASEGSVLVADCQTGGRGRMGREWVSPPGANLYFSLVLRPPV 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               L+ +    A A+   +  T+  G    IKWPNDIL+  RK+ GIL E  +  +   
Sbjct: 146 PPVRLSQIPLLAAAAIHQALDRTVE-GVSSAIKWPNDILIEGRKVCGILCEMESEPDMTH 204

Query: 137 AVVVGIGLNV--KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
            V+VGIG+NV  +  P +     TSL  E G      DI S +      + D W +    
Sbjct: 205 FVIVGIGVNVNLRDIPGEIKGIATSLFLESGSEYSRPDILSSILNSFEPLYDTWLEADDL 264

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             ++     +A      + ++    ++ GR  G+   G L+LE + G +  I +G+
Sbjct: 265 FAVLPYLERYAWLKDREVKVEQYKSTLEGRVRGLTRTGELMLESQDGSMHAISSGE 320


>gi|289623865|ref|ZP_06456819.1| biotin--protein ligase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648958|ref|ZP_06480301.1| biotin--protein ligase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330869447|gb|EGH04156.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 319

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 121/239 (50%), Gaps = 10/239 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 65  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 183 AGILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 240

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  +L + +K+ G     + W       G  + +     ++ G  +GVD  G L LE
Sbjct: 241 SQLESLLAVHRKE-GFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE 298


>gi|257483169|ref|ZP_05637210.1| biotin--protein ligase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331012396|gb|EGH92452.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 319

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 121/239 (50%), Gaps = 10/239 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 65  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIARGAPMPLLVVAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 183 AGILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 240

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  +L + +K+ G     + W       G  + +     ++ G  +GVD  G L LE
Sbjct: 241 SQLESLLAVHRKE-GFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE 298


>gi|224369786|ref|YP_002603950.1| BirA [Desulfobacterium autotrophicum HRM2]
 gi|223692503|gb|ACN15786.1| BirA [Desulfobacterium autotrophicum HRM2]
          Length = 304

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 116/257 (45%), Gaps = 18/257 (7%)

Query: 5   LSECQNPYSFRYE-------FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDN 57
           L+ C++   F  E       F  +I ST DE  + A  G      ++A  QT GRGR + 
Sbjct: 50  LATCRDLVRFSLERTTENILFSPSIDSTMDEARRLAREGVPHFTVVIAEQQTKGRGRLNR 109

Query: 58  KWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP--VGTDVKIKWPNDIL 115
            W S KG L+ +++L      D    LSF +  A    +A TL      + K+KWPNDIL
Sbjct: 110 AWSSQKGGLWFTIIL----RPDLPPQLSFKVNFAASLCLAKTLNQLFNINAKVKWPNDIL 165

Query: 116 VFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV-DTPYPVTSLQREGGCIDLKDIFS 174
           +  +K+ G+L E     + +  V VGIG+NV + P  + P  V+     G  +    I +
Sbjct: 166 INNQKLVGLLSEMETRGDMISFVNVGIGINVNNQPEKEQPNAVSISTLLGQKVSRTKILA 225

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
                  R LD    +     I+ LW+     IG  + I+       G  + VDD G L+
Sbjct: 226 AFLDRFQRTLD----NILERNIIELWKEQTATIGRQVRIETFKDHFQGLALDVDDTGALI 281

Query: 235 LEEKKGCVRQIFTGDIF 251
           L ++    R++  GD F
Sbjct: 282 LMDEDHTTRRVIYGDCF 298


>gi|88861232|ref|ZP_01135865.1| hypothetical protein PTD2_00522 [Pseudoalteromonas tunicata D2]
 gi|88816825|gb|EAR26647.1| hypothetical protein PTD2_00522 [Pseudoalteromonas tunicata D2]
          Length = 334

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 127/251 (50%), Gaps = 12/251 (4%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGN--LWIVASCQTAGRGRRDNKWISDKG 64
           + Q+    ++E F  I STN E M+R  SG L +    +V+  QTAGRGRR  +W S  G
Sbjct: 78  KAQSEGVAQFELFPVIDSTNSELMRRIQSGQLPDSGTVVVSESQTAGRGRRGRQWQSPFG 137

Query: 65  -NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S   +      +   +S A+ +A+   + +   +  DV++KWPNDILV ++K+AG
Sbjct: 138 SNLYFSYYWLLDDGLQAAMGVSIAVGLAVYDALKALYQI--DVQLKWPNDILVHEQKLAG 195

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQD 179
           +L+E     +G   +V+GIGLN+ + PV     +    T L   G  +D   + ++L   
Sbjct: 196 VLVELDGQPDGPCHLVIGIGLNL-NMPVTASANIDQAWTDLALLGCEVDKSKLVAVLTHC 254

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + + L  +++ +G +E+   W       G  + +     S  G   G+D  G + + +  
Sbjct: 255 LEQRLKQYRQ-SGLDEMHQQWNQVHAFQGQRVNLITGLRSWQGICEGIDPQGGIKIRQ-N 312

Query: 240 GCVRQIFTGDI 250
           G V+  F G+I
Sbjct: 313 GEVKSYFGGEI 323


>gi|332185935|ref|ZP_08387682.1| biotin-[acetyl-CoA-carboxylase] ligase [Sphingomonas sp. S17]
 gi|332014293|gb|EGI56351.1| biotin-[acetyl-CoA-carboxylase] ligase [Sphingomonas sp. S17]
          Length = 234

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 111/230 (48%), Gaps = 8/230 (3%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN +  + A +G    LW+ A  QTAGRGR+   W S  GN Y S L+           
Sbjct: 9   STNADLRQLAEAGGEDGLWLRADRQTAGRGRQGRDWSSPSGNFYGSTLVRLRPGDPMAAT 68

Query: 84  LSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
           L+   AVA+ + + S LP +GT + +KWPND+L+   K++GIL+E         AVV+G+
Sbjct: 69  LALVAAVAIEAAVRSCLPDIGTRLALKWPNDLLIDGAKLSGILLERTG-----DAVVIGM 123

Query: 143 GLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRC 202
           G+N+   P       T+L   G  +    +  LL   +A  + +W ++ G   ++  W  
Sbjct: 124 GINLVSAPELPDRSTTALVDHGAEVSPARMQGLLADAMAHWVTIW-REAGLSAVIERWEA 182

Query: 203 FACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            A   G  +  +L  G +L G F G+   G L L    G    I  GDIF
Sbjct: 183 RAHPRGTPLIARLPDGQVLTGAFEGLASDGALRLGLADGASHVIHAGDIF 232


>gi|329114691|ref|ZP_08243450.1| Biotin synthetase [Acetobacter pomorum DM001]
 gi|326696171|gb|EGE47853.1| Biotin synthetase [Acetobacter pomorum DM001]
          Length = 258

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 121/248 (48%), Gaps = 15/248 (6%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +R E F  + ST+D C+++A  G    L ++A  QT GRG R  +W+    +L  S
Sbjct: 15  QPSPWRLECFAELGSTSDFCLEQARQGADSGLAVLAYRQTQGRGSRGRQWVDAGQSLALS 74

Query: 70  LLL-IDSISKDSLTLLSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIE 127
           +LL      +D L    FA ++A    +   +P V   + IKWPND+L+  +K  GILIE
Sbjct: 75  VLLDAQQAGQDMLGGWPFAASLAFYDGLLHAVPAVAGHLMIKWPNDLLLDGQKAGGILIE 134

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
             + +     +V+G G N+   P    T      L + G    +KD+   +   +A    
Sbjct: 135 RESAR-----LVIGFGANLTQAPSQQQTGRFTACLGQYGAVPPVKDVAQCILSSLADWCA 189

Query: 186 LWKKDTGREEIMNLW--RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           +W+++ G   +   W  R    G   +++ + +Y    G+F G+ + G LLL+ + G ++
Sbjct: 190 VWRQN-GFGALRQAWLDRAHPVGTPLVVSSRTTYEQ--GKFAGLAEDGRLLLDTEAG-MK 245

Query: 244 QIFTGDIF 251
            I TGDI 
Sbjct: 246 TITTGDIL 253


>gi|330988298|gb|EGH86401.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 319

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 120/237 (50%), Gaps = 10/237 (4%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S   
Sbjct: 67  IAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSPFA 126

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAG
Sbjct: 127 ENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKIAG 184

Query: 124 ILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQD 179
           IL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+   
Sbjct: 185 ILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALISSQ 242

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           +  +L + +K+ G     + W       G  + +     ++ G  +GVD  G L LE
Sbjct: 243 LESLLAVHRKE-GFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGVDSLGALRLE 298


>gi|71734061|ref|YP_276722.1| biotin--protein ligase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554614|gb|AAZ33825.1| birA bifunctional protein [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 319

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 120/239 (50%), Gaps = 10/239 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 65  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E L     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 183 AGILLELLGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 240

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  +L + +K+ G     + W       G  + +     ++ G  +G D  G L LE
Sbjct: 241 SQLESLLAVHRKE-GFVAFQDEWERGHLWQGAAVRLLSGAEAVEGVVLGADSLGALRLE 298


>gi|254994843|ref|ZP_05277033.1| biotin-(acetyl-CoA carboxylase) (birA) [Anaplasma marginale str.
           Mississippi]
          Length = 232

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 120/234 (51%), Gaps = 11/234 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN E ++ A SG      I+A  QT+G GR   +W S KGNLY S++   S    +L+ 
Sbjct: 4   STNLEAIELAQSGAPDGTVIIADEQTSGTGRYGREWHSPKGNLYCSIITRRSAQVAALSF 63

Query: 84  L-SFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           L S A+ V +  V  +      +  ++ KWPND++V  +KI+G+LI+T  +   +   V 
Sbjct: 64  LSSLAVGVTLEQVFEAHNCSTKNALIRYKWPNDVMVDGKKISGVLIKTKMIGGEIDWAVC 123

Query: 141 GIGLNVKHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDLWKKDTGREEIMN 198
           GIG+N+   P   PY   SL      + L   ++  L+ Q+ A++LD+ +   G  ++ +
Sbjct: 124 GIGVNMYAPP---PY-AASLHDYIPELKLSNLELLDLMLQNFAKLLDVLET-MGFAQLRS 178

Query: 199 LWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           LW       GD I +  +   I+ G+FV +D  G ++LE   G    +  G+I 
Sbjct: 179 LWMRRGHTPGDKIRVITNNNMIIEGKFVNIDTHGAMVLESDSGIPTAVDYGEIL 232


>gi|254445666|ref|ZP_05059142.1| biotin-(acetyl-CoA-carboxylase) ligase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259974|gb|EDY84282.1| biotin-(acetyl-CoA-carboxylase) ligase [Verrucomicrobiae bacterium
           DG1235]
          Length = 329

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 114/244 (46%), Gaps = 8/244 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLL 71
           SF     D + STN E  +R  +G+     +++  QT GRGR    W S + GNLYAS  
Sbjct: 82  SFTATVLDEVDSTNSEAERRIANGEPTPFVVLSRLQTIGRGRLGRVWHSPQNGNLYASFA 141

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
               IS   ++L +  + + +   I S   V    K+KWPND+ +  +KIAGIL E    
Sbjct: 142 FRPQISPTQMSLFTLWMGINICECINSVCRV--SCKVKWPNDLHIEGKKIAGILTEARME 199

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDL 186
            + ++ VV+GIGLNV     D P  + S+     Q  G   D+  + S +   +A     
Sbjct: 200 ADQVRDVVLGIGLNVNSDGKDWPEELKSIATSLRQSSGETFDINRLVSAITGRIAIAYKQ 259

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            +  + ++ + + W  +   +G  +++      I G   G+D  G L++E + G      
Sbjct: 260 LEDGSHKKALKDKWPRYDSLVGKQVSLLQGESRISGTANGIDANGSLVIEREDGTRYLAR 319

Query: 247 TGDI 250
            G++
Sbjct: 320 AGEV 323


>gi|222474996|ref|YP_002563411.1| biotin-(acetyl-CoA carboxylase) (birA) [Anaplasma marginale str.
           Florida]
 gi|222419132|gb|ACM49155.1| biotin-(acetyl-CoA carboxylase) (birA) [Anaplasma marginale str.
           Florida]
          Length = 242

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 122/246 (49%), Gaps = 11/246 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           + F         STN E ++ A SG      I+A  QT+G GR   +W S KGNLY S++
Sbjct: 2   HGFVIHHTSVSRSTNLEAIELAQSGAPDGTVIIADEQTSGTGRYGREWHSPKGNLYCSII 61

Query: 72  LIDSISKDSLTLL-SFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIET 128
              S    +L+ L S A+ V +  V  +      +  ++ KWPND++V  +KI+G+LI+T
Sbjct: 62  TRRSAQVAALSFLSSLAVGVTLEQVFEAHNCSTKNALIRYKWPNDVMVDGKKISGVLIKT 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDL 186
             +   +   V GIG+N+   P   PY   SL      + L   ++  L+ Q+ A++LD+
Sbjct: 122 KMIGGEIDWAVCGIGVNMYAPP---PY-AASLHDYIPELKLSNLELLDLMLQNFAKLLDV 177

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQI 245
            +   G  ++ +LW       GD I +  +   I+ G+FV +D  G ++LE   G    +
Sbjct: 178 LET-MGFAQLRSLWMRRGHTPGDKIRVITNNNMIIEGKFVNIDTHGAMVLESDGGIPTAV 236

Query: 246 FTGDIF 251
             G+I 
Sbjct: 237 DYGEIL 242


>gi|15614248|ref|NP_242551.1| transcriptional repressor of the biotin operon [Bacillus halodurans
           C-125]
 gi|10174302|dbj|BAB05404.1| transcriptional repressor of the biotin operon [Bacillus halodurans
           C-125]
          Length = 323

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 114/239 (47%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + ++ +ST    +K A  G      ++A+ QT+G+GR    W S  G+ +  S++    +
Sbjct: 84  YLESTASTQTVALKLAQEGAKEGHIVLANEQTSGKGRMGRGWYSPPGSSISMSIIFRPQL 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AVA+   I  T   G D  IKWPND+L+  +KI GIL E    ++ + 
Sbjct: 144 PPQKAPQLTLLTAVAIVRAIKET--TGLDSDIKWPNDLLIDGKKIVGILTEMQADQDSVH 201

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           +V+ GIG+NV H        +    TSL  ++G  I    + + + +++    DL+ +  
Sbjct: 202 SVIQGIGINVNHQEEAFAEEIRKIATSLAIKKGEPIQRAPLIAAILKNIELFYDLYLQH- 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW   A  IG  I  ++      G   G+ D G LLLE+  G +  I++ DI
Sbjct: 261 GFSRIKPLWEAHAISIGKRIRARMLNDVKFGVAKGITDDGVLLLEDDDGKLHSIYSADI 319


>gi|317509332|ref|ZP_07966952.1| biotin-[acetyl-CoA-carboxylase] ligase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316252388|gb|EFV11838.1| biotin-[acetyl-CoA-carboxylase] ligase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 278

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 119/247 (48%), Gaps = 20/247 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
           E  +   STN + + RA SG +    ++A  QT  RGR D +W +  +  +  S  +   
Sbjct: 31  EVIEETGSTNADLLDRARSGSIARRVLIADHQTQARGRLDRRWEAPTRTQIALSFGVAVE 90

Query: 76  ISKDSLTLLSFAIAVAMRSVIA---------STLPVGTDVKIKWPNDILVFQRKIAGILI 126
            +   L  L   + +++ +++A         S +PV  +  +KWPND+LV  RKIAGIL+
Sbjct: 91  QNGAELGWLPLVVGLSVGAMLAQYFDSYRTISGVPV-PEPSLKWPNDVLVGGRKIAGILV 149

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +   L       VVG+GLNV     + P P  TSL+ E      + +  LL  ++ + L+
Sbjct: 150 Q---LTPKGDEAVVGVGLNVDQREDELPVPTATSLRIEQVAAVRQQLVPLLLMELDKGLE 206

Query: 186 LWK-KDTGREEIMNLWRCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVR 243
            W+ +D G   +   +R     IG  + + L   G +LGR   VD  G L++ E  G  R
Sbjct: 207 QWRTQDPG---LATAYRAHCSTIGQDVRVTLPGGGELLGRASSVDHHGRLVVTEDDGTPR 263

Query: 244 QIFTGDI 250
            +  GDI
Sbjct: 264 VVDVGDI 270


>gi|158520408|ref|YP_001528278.1| biotin--acetyl-CoA-carboxylase ligase [Desulfococcus oleovorans
           Hxd3]
 gi|158509234|gb|ABW66201.1| biotin--acetyl-CoA-carboxylase ligase [Desulfococcus oleovorans
           Hxd3]
          Length = 240

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 108/235 (45%), Gaps = 5/235 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
               T  ST D     AL G      +VA  QT GRGR D  W SD G LY +L+L   +
Sbjct: 9   HHLATTESTMDVARNLALQGCPHFTVVVADTQTGGRGRMDRTWHSDPGGLYMTLVLKPDM 68

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+F  ++ +   +     +  D  +KWPNDILV ++K+AG+L E     + + 
Sbjct: 69  PAADGLKLTFLASLTLAQTVRRCCDI--DAGVKWPNDILVKEKKLAGLLSEMQATGSRID 126

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
            V +GIG+NV + P       TS++   G    ++    L  +    L    ++T    +
Sbjct: 127 FVNIGIGINVNNDPARFEPGATSIKAATGATFSREG---LLDEFLGALKTGLQNTSLPSV 183

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           +  W+  A  +G  +T+     ++ G    V++ G LL+    G +R+I  GD F
Sbjct: 184 IQQWKTLAVSLGRPVTVVTPRETVTGIAEDVNESGALLVRMSDGDLREICYGDCF 238


>gi|307293256|ref|ZP_07573102.1| biotin/acetyl-CoA-carboxylase ligase [Sphingobium chlorophenolicum
           L-1]
 gi|306881322|gb|EFN12538.1| biotin/acetyl-CoA-carboxylase ligase [Sphingobium chlorophenolicum
           L-1]
          Length = 219

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 99/213 (46%), Gaps = 12/213 (5%)

Query: 42  WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           W+ A  QT GRGR    W S  GNLY S ++     +D   L      VA  +V A   P
Sbjct: 14  WLRAGRQTGGRGRMGRDWESPDGNLYCSTVIR---LRDGDPLPHTLALVAANAVHALVAP 70

Query: 102 V-GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSL 160
           +     +IKWPNDILV   KIAGIL+E +       A+V GIG+NV   P     PVTSL
Sbjct: 71  LCAGQARIKWPNDILVDGAKIAGILLERVG-----DAIVAGIGINVTGHPAGLDRPVTSL 125

Query: 161 QREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG- 218
             +G    D   +   L +  A  L +W+   G E +   W   A   G  + +    G 
Sbjct: 126 LAQGASDADAPALQVRLAELFAHWLAIWRAQ-GLEPVRTHWLLNAHPTGTPMRVVQPDGE 184

Query: 219 SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           ++ G F  +D  G L+L    G  R I  GDIF
Sbjct: 185 TVEGSFDTLDRHGMLILRLANGQSRAIHAGDIF 217


>gi|297584393|ref|YP_003700173.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus selenitireducens
           MLS10]
 gi|297142850|gb|ADH99607.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus selenitireducens
           MLS10]
          Length = 326

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 117/249 (46%), Gaps = 14/249 (5%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYA 68
           N Y       D  +ST D+ +K    G       V+  Q+AGRGR    W S  KG L+ 
Sbjct: 78  NSYFKSIHKVDETTSTQDDALKLIQEGAESGTVTVSDMQSAGRGRLGRSWDSPRKGGLWF 137

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S++L   I       L+    VA+   + + L  G    IKWPND+L+  +KIAGIL E 
Sbjct: 138 SMILKPDIPVHKAPQLTLLTGVALAQTVNNQLH-GQVAAIKWPNDLLINHKKIAGILTEM 196

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYP------VTSLQR-EGGCIDLKDIFSLLFQDVA 181
               + ++A+++G+GLNV        +P        SL R  G   +L +I S       
Sbjct: 197 HADPDKVKALIIGVGLNVNQ----EMFPDWLLDIADSLGRMTGARYNLNEILSDFLIRFD 252

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            +  L+ K+ G   I NLW+  A   G  +  K + G I G    +D+ G + +++ +G 
Sbjct: 253 ELYHLFIKE-GFLPIRNLWKELALSPGQTVHYKHNKGVINGTTHDIDEEGVMQIKDDQGT 311

Query: 242 VRQIFTGDI 250
           + ++F+ ++
Sbjct: 312 IHRVFSSEL 320


>gi|113460565|ref|YP_718629.1| biotin--protein ligase [Haemophilus somnus 129PT]
 gi|170718912|ref|YP_001784082.1| biotin--protein ligase [Haemophilus somnus 2336]
 gi|112822608|gb|ABI24697.1| biotin operon repressor [Haemophilus somnus 129PT]
 gi|168827041|gb|ACA32412.1| biotin--acetyl-CoA-carboxylase ligase [Haemophilus somnus 2336]
          Length = 310

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 119/245 (48%), Gaps = 14/245 (5%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYA 68
           +PY   Y     I+STN   M+  L  + G+L      Q AGRGRR  +W S   G L  
Sbjct: 70  SPYKIYYH--PIINSTNQYLMENILQLNKGDL-CFTEYQFAGRGRRGREWQSPFAGQLMV 126

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           S     + +  SL  LS  + +A   V+     +G +VK+KWPND+L+F RK+AGIL+E 
Sbjct: 127 SFYWTFNPTV-SLNGLSSVLGLATAEVLNE---MGAEVKLKWPNDLLLFGRKLAGILVEI 182

Query: 129 LNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +N KNGL   +VGIG+N+   +   +D P+    L      ID  D+   L +   + L 
Sbjct: 183 VNAKNGLLNFIVGIGINLSLPQENKIDQPW--AELLETLPEIDRNDLAIQLVKKWYQYLT 240

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           ++++  G       W       G  + I      + G   G+D+ GYLL+    G +R+ 
Sbjct: 241 IFEQQ-GMHAFFQRWIKLDYFFGQEVNIISEKEIVCGIEQGIDEEGYLLVALNNGVLRKF 299

Query: 246 FTGDI 250
             G++
Sbjct: 300 NGGEV 304


>gi|239626151|ref|ZP_04669182.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520381|gb|EEQ60247.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 326

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 114/241 (47%), Gaps = 8/241 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R E+FD   STN    K A  G      +VA  Q++G+GRR   W S +G  ++ S++L 
Sbjct: 80  RLEYFDETDSTNTRARKFAEEGAPHGTLVVADSQSSGKGRRGRLWTSPRGVGIWMSMVLR 139

Query: 74  DSISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             I+    ++L+    +A+ R V  ST   G D  IKWPND ++  RKI GIL E     
Sbjct: 140 PDIAPVHASMLTLIAGMAVVRGVKEST---GLDAMIKWPNDAVLAGRKICGILTEMSTED 196

Query: 133 NGLQAVVVGIGLNVK--HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKK 189
           + ++ V+ GIG+NV     P +     TSL+ E G  +    +   + +      D++ +
Sbjct: 197 DSIRYVITGIGINVNIDEFPEEIRDKATSLKMELGKSVKRSPVIRAVAEAFETYYDIFLE 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 +   +       G  + +    G   G  +G+DD G LL+ +K G V  + +G+
Sbjct: 257 TCDMSRLKEEYNRELANTGREVLVLDPRGQYEGTALGIDDEGSLLVRKKDGTVVPVISGE 316

Query: 250 I 250
           +
Sbjct: 317 V 317


>gi|325121128|gb|ADY80651.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 250

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 117/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     + +      ++++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQIPQLQA-----LNLQVKWPNDLYSAQGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G    G ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMGRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  I  L+  + S G + GRFVG+ + G +++E  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWINQLVQFEHSQGLVHGRFVGISNEGAVIIETPE--PQQFYQGRL 244


>gi|294101054|ref|YP_003552912.1| biotin/acetyl-CoA-carboxylase ligase [Aminobacterium colombiense
           DSM 12261]
 gi|293616034|gb|ADE56188.1| biotin/acetyl-CoA-carboxylase ligase [Aminobacterium colombiense
           DSM 12261]
          Length = 323

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 112/238 (47%), Gaps = 7/238 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            F  + STN E  K A  G      IVA  QTAGRGR    W S     +  SL+L   +
Sbjct: 84  HFREVPSTNIEARKYAREGTAEGTVIVAEHQTAGRGRSGRSWFSSPEWAIQMSLILRPKV 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           S      ++   A A+   + S   +G   +IKWPND+L+ ++K+ GIL E     + + 
Sbjct: 144 SPALAASITQIGAAAVAKALES---LGLSPQIKWPNDVLLSEKKVCGILTEMSCELDHIN 200

Query: 137 AVVVGIGLNVK--HCPVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDTGR 193
            +V+GIG+NV   H P D     TS++ E G   + K + + +      +   + +    
Sbjct: 201 HIVIGIGINVNTPHFPDDVASVATSVRIEKGETWNRKKLMAAVLNSFEPLYKEFLEGKEH 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            E + + R  +  IG  IT + + G +  + + +D+ G L+++   G    + +G++ 
Sbjct: 261 PEYLRICRALSNLIGQHITYETTKGRLSAKAIDIDNIGRLIVQHSDGSTETLLSGEVH 318


>gi|313673633|ref|YP_004051744.1| biotin/acetyl-CoA-carboxylase ligase [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940389|gb|ADR19581.1| biotin/acetyl-CoA-carboxylase ligase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 248

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 123/248 (49%), Gaps = 26/248 (10%)

Query: 14  FRYEF-FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
           F++ F F+ + STN+E MK           I+A  Q AG+GR   KW+SD+GNLY S++L
Sbjct: 16  FKHCFIFNELDSTNNEAMKSTYPH---YSLIIAEKQYAGKGRSGRKWVSDEGNLYFSIVL 72

Query: 73  IDSISKDSLTL---LSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                +  L L     +AI  A+R+          DV +KWPNDI+   +K+ GILIET 
Sbjct: 73  PPMPVEQLLPLNISTGYAICDALRNY--------ADVSLKWPNDIVFNNKKLGGILIETK 124

Query: 130 NLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSL----QREGGCIDLKDIFSLLFQDVARV 183
              N L+ +V+GIG+NV       D     TSL    +R+    ++  ++ +L       
Sbjct: 125 FSGNILEKIVLGIGINVNQLDFSHDIKEIATSLAIITERQYRTEEI--LWQILNNFEKNY 182

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            DL KK   R +I+  W  ++   G +I I L    +     G+ D G L+  +  G  R
Sbjct: 183 TDLLKK---RIDIIEKWCKYSMNFGKMIKIHLDGEKMELIEKGITDKGELIAVDHFGNER 239

Query: 244 QIFTGDIF 251
           +I  GDI+
Sbjct: 240 KIVLGDIY 247


>gi|167044635|gb|ABZ09307.1| putative biotin/lipoate A/B protein ligase family protein
           [uncultured marine crenarchaeote HF4000_APKG7F19]
          Length = 332

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 124/246 (50%), Gaps = 17/246 (6%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +FD+  ST +  MK A +       +++  QT GRGR   KW S  G ++ S+++  
Sbjct: 90  RVYYFDSTDSTQNFAMKIASNDKENGTVVISKKQTGGRGRMKRKWKSPTGGIWMSIIIHP 149

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                  TL+  A ++A+   I   L +  +  +KWPND+ +  +K+AG+LI+T  + N 
Sbjct: 150 KFDVSYTTLVPIATSLALCMAIEKILKIKPE--LKWPNDVTLKGKKVAGVLIDTSIISNE 207

Query: 135 LQAVVVGIGLNVKHCPVD-------TP--YPVTSL-QREGGCIDLKDIFSLLFQDVARVL 184
           ++ +V+GIG+N K  P +       TP  Y V +L ++    + L   F    ++V +++
Sbjct: 208 IENMVLGIGINFKIKPHELASTIKKTPNFYGVATLVKKNERALPLVHQFLYELENVFQLI 267

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +         +I N W   +  IG  ++I  S G++ G+ V +D  G L++ + K   R 
Sbjct: 268 N----SRRIRKIKNEWTKRSSTIGRNVSIITSEGNVNGKAVKIDSDGALIISKGKKAER- 322

Query: 245 IFTGDI 250
           I  GDI
Sbjct: 323 ILVGDI 328


>gi|255002976|ref|ZP_05277940.1| biotin-(acetyl-CoA carboxylase) (birA) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004104|ref|ZP_05278905.1| biotin-(acetyl-CoA carboxylase) (birA) [Anaplasma marginale str.
           Virginia]
          Length = 232

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 120/234 (51%), Gaps = 11/234 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN E ++ A SG      I+A  QT+G GR   +W S KGNLY S++   S    +L+ 
Sbjct: 4   STNLEAIELAQSGAPDGTVIIADEQTSGTGRYGREWHSPKGNLYCSIITRRSAQVAALSF 63

Query: 84  L-SFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           L S A+ V +  V  +      +  ++ KWPND++V  +KI+G+LI+T  +   +   V 
Sbjct: 64  LSSLAVGVTLEQVFEAHNCSTKNALIRYKWPNDVMVDGKKISGVLIKTKMIGGEIDWAVC 123

Query: 141 GIGLNVKHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDLWKKDTGREEIMN 198
           GIG+N+   P   PY   SL      + L   ++  L+ Q+ A++LD+ +   G  ++ +
Sbjct: 124 GIGVNMYAPP---PY-AASLHDYIPELKLSNLELLDLMLQNFAKLLDVLET-MGFAQLRS 178

Query: 199 LWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           LW       GD I +  +   I+ G+FV +D  G ++LE   G    +  G+I 
Sbjct: 179 LWMRRGHTPGDKIRVITNNNMIIEGKFVNIDTHGAMVLESDGGIPTAVDYGEIL 232


>gi|90417552|ref|ZP_01225473.1| birA bifunctional protein [marine gamma proteobacterium HTCC2207]
 gi|90330644|gb|EAS45934.1| birA bifunctional protein [marine gamma proteobacterium HTCC2207]
          Length = 336

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 116/254 (45%), Gaps = 17/254 (6%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P+    + F TI+STN    + A S       I+A  QTAGRGRR   W+S    N+Y S
Sbjct: 80  PHLSAIDIFQTINSTNTYARELAESSSASGAVILAEQQTAGRGRRGKSWVSPFAANIYLS 139

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           ++        +L  LS AI VA++  +  T     +VK+KWPNDI V Q+K+ GIL+E +
Sbjct: 140 IVWDFEQGAQALEGLSLAIGVAVKRAL--TAHGVQEVKLKWPNDIYVEQKKLGGILLEMI 197

Query: 130 NLKNGLQAVVVGIGLNV-----KHCPVDTPYP--VTSLQREGGCID------LKDIFSLL 176
               G   V+VG+GLNV     +   +D  +    T LQ +    D         + + L
Sbjct: 198 GDPVGHCNVIVGVGLNVSMPALQAAAIDQDWTDVTTELQAQQSPADGPKLSVRNKLAAAL 257

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             ++  +LD ++   G     + W+      G    I     SI G   GV+  G L LE
Sbjct: 258 ISEILPLLDTFQT-RGFAAYRDEWQAADAFYGQAAEISTPKQSIAGVVRGVETNGALRLE 316

Query: 237 EKKGCVRQIFTGDI 250
              G +     G++
Sbjct: 317 LDNGTIESFIGGEL 330


>gi|116750036|ref|YP_846723.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699100|gb|ABK18288.1| biotin--acetyl-CoA-carboxylase ligase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 335

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 117/241 (48%), Gaps = 9/241 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLID 74
           Y +  T+ STND  ++ AL G      + A  QT GRGR    W+S  +  +Y ++LL  
Sbjct: 88  YHYLATVGSTNDVALQLALEGAPHGTVVSAEEQTRGRGRLRRDWLSSPRRGIYMTILLRT 147

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +     +   +  A+A+   + ST  + +   IKWPND+LV  +K+AGIL E  + +  
Sbjct: 148 PLPVREASQSVYIAALALAKTLHSTFRLPSS--IKWPNDVLVRHKKVAGILTEMQSDQEQ 205

Query: 135 LQAVVVGIGLNVKHCPVDTP----YPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +V+GIG+NV H   +      YP TS+  E G  I  +++     +      D +  
Sbjct: 206 TRFLVIGIGINVNHTQEELAGPFRYPATSVAVELGRPIRRQELMKSFLERFEMEYDRF-L 264

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D G   I+     F+  +G  +++      I GR +G    G L+L  ++G  + I+ GD
Sbjct: 265 DEGFGAILPELEEFSDILGKNVSVLCGKEEIEGRALGFTPEGALVLLTREGRKQSIWAGD 324

Query: 250 I 250
           +
Sbjct: 325 V 325


>gi|110680447|ref|YP_683454.1| biotin--acetyl-CoA-carboxylase ligase, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456563|gb|ABG32768.1| biotin--acetyl-CoA-carboxylase ligase, putative [Roseobacter
           denitrificans OCh 114]
          Length = 253

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 107/236 (45%), Gaps = 9/236 (3%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           + ST DE  ++A       LW+ A  QTA RGRR   W    GN  A+LL+         
Sbjct: 20  VDSTLDEAARQAPHAAT-PLWVFAQRQTAARGRRGRPWSMPAGNFAATLLMRSEGPPAQA 78

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
            L SF +++A+            D  +KWPND+L+   K+AGIL+E++        + +G
Sbjct: 79  ALRSFTMSLALYRSFVEVTGRENDFTLKWPNDVLLKGGKVAGILLESVGAGQQTGCLSIG 138

Query: 142 IGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           +G+N+   P           PV+ L+     +  +    +L    A VL+   +  G + 
Sbjct: 139 VGVNLVAAPSPGDVEARALKPVSILRETSVRVSPETFLEVLAGHFA-VLEQQFQRYGFDP 197

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           I   W   A  +G++IT + S     G F  VD  G+L+L   +G V  I   D++
Sbjct: 198 IRTGWLAQAARLGEVITARTSRDEYTGTFEDVDAEGHLVLRGPRG-VMSIAAADVY 252


>gi|296395354|ref|YP_003660238.1| biotin/acetyl-CoA-carboxylase ligase [Segniliparus rotundus DSM
           44985]
 gi|296182501|gb|ADG99407.1| biotin/acetyl-CoA-carboxylase ligase [Segniliparus rotundus DSM
           44985]
          Length = 283

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 120/251 (47%), Gaps = 24/251 (9%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI--D 74
           E  +   STN + ++RA  G +    ++A  QT G+GR   +W +      A    +  D
Sbjct: 31  EVIEETGSTNADLLERAARGPIARRVLIADHQTQGKGRLGRRWEAPPRTQIALSFGVAFD 90

Query: 75  SISK---DSLTLLSFAIAVAMRSVIA---------STLPVGTDVKIKWPNDILVFQRKIA 122
             ++     L  L  A+ +++ +++A         S +PV  +  +KWPND+LV  RKIA
Sbjct: 91  RSARAGGPELGWLPLAVGLSVGAMLAQYFDSYRSISGVPV-PEPSLKWPNDVLVGDRKIA 149

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVA 181
           G+L++   L       VVG+GLNV     + P P  TSL+ E      + +  LL  ++ 
Sbjct: 150 GVLVQ---LSPKADEAVVGVGLNVDQHEDELPVPTATSLRIEQVAAARQQLVPLLLMELD 206

Query: 182 RVLDLW-KKDTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKK 239
           R LD W  +D G   + + +R     +G  + + L  G+ I GR   VDD G L++    
Sbjct: 207 RGLDRWLAQDPG---LADAYRAHCSTLGQDVRVALPGGNEIFGRASSVDDHGRLVVALAD 263

Query: 240 GCVRQIFTGDI 250
           G  R +  GD+
Sbjct: 264 GTARVVDAGDV 274


>gi|288940040|ref|YP_003442280.1| biotin/acetyl-CoA-carboxylase ligase [Allochromatium vinosum DSM
           180]
 gi|288895412|gb|ADC61248.1| biotin/acetyl-CoA-carboxylase ligase [Allochromatium vinosum DSM
           180]
          Length = 332

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 126/256 (49%), Gaps = 18/256 (7%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           LS+       R +    I STN E M+ A  G       +A  QTAGRGRR  +W+S  G
Sbjct: 75  LSDAGRARLSRLDIHPLIGSTNSELMRLAAEGAPSGSVCLAERQTAGRGRRGREWVSPFG 134

Query: 65  -NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL-PVGTD-VKIKWPNDILVFQRKI 121
            NLY SLL     +  +L   S A+     +V+A  L  +GT+   +KWPND+L  +RK+
Sbjct: 135 VNLYLSLLWRYPFAPSNLGGASLAVG----AVLADALNGLGTEGPALKWPNDLLWRRRKL 190

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKH-----CPVDTPYPVTSLQREGGC--IDLKDIFS 174
           AG+L+E      G   +VVG+GLN++        +D P+  TSL+   G   I    + +
Sbjct: 191 AGLLLEVAGESQGPCHLVVGLGLNLRMTAGQGSAIDQPW--TSLETMLGTAMIGRNALVA 248

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            L + +   LD + ++ G    +  WR     +G+ + + +    I G   GV + G LL
Sbjct: 249 RLLEALLEALDRYGRE-GLSPFLTRWRAHDAYLGEPVRLLIGERVIEGVHAGVGEDGSLL 307

Query: 235 LEEKKGCVRQIFTGDI 250
           LE  +GC R    G++
Sbjct: 308 LETSEGC-RTFQAGEV 322


>gi|89902712|ref|YP_525183.1| biotin--acetyl-CoA-carboxylase ligase [Rhodoferax ferrireducens
           T118]
 gi|89347449|gb|ABD71652.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodoferax ferrireducens
           T118]
          Length = 268

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 118/244 (48%), Gaps = 34/244 (13%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD---------KG 64
           FR E+   I STN E M+RA +G L  + +VA  QTAGRGR   +W SD         +G
Sbjct: 20  FRAEWLPQIDSTNSELMRRARAGRLEPVLLVAGQQTAGRGRLGRQWFSDTGADAKLGSEG 79

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           +L  SL L   ++    + LS A+ V   SV+ S  P   D+++KWPND+ +  RK+AGI
Sbjct: 80  SLTFSLGL--PLAPLDWSGLSLAVGV---SVVRSLHP---DLRLKWPNDVWLRDRKLAGI 131

Query: 125 LIETLNLKNGLQA--VVVGIGLNVK-HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVA 181
           LIET NL +  +A   VVG+G+N+K         P   L      ++  +    +   + 
Sbjct: 132 LIETANLADTPEARYAVVGVGINMKPRAATGLSTPPAWLGEVLPGVEAPEALLRIAAPLV 191

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDL-----ITIKLSYGSILGRFVGVDDFGYLLLE 236
           R L L++         N +  F  G  +      + + LS G+  G   GVD  G LL+ 
Sbjct: 192 RALKLFEA--------NGFSTFQAGFNERDALGGLAVTLSDGTT-GVAQGVDGMGALLVH 242

Query: 237 EKKG 240
              G
Sbjct: 243 TAHG 246


>gi|196232981|ref|ZP_03131830.1| biotin/acetyl-CoA-carboxylase ligase [Chthoniobacter flavus
           Ellin428]
 gi|196222959|gb|EDY17480.1| biotin/acetyl-CoA-carboxylase ligase [Chthoniobacter flavus
           Ellin428]
          Length = 325

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 118/256 (46%), Gaps = 12/256 (4%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           +FS L  C+   +     F   +STND  M+R   G  G + I A  QTAGRGR    W 
Sbjct: 71  IFSRLGTCE--LAREIVVFAETASTNDSAMQRGRQGAEGGIVIFAERQTAGRGRFGRAWA 128

Query: 61  SDK-GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
           S     L+ S+L+   +   +   L+   AV++ S I ++L  G  V IKWPNDI +  R
Sbjct: 129 SAPYRGLWFSMLMRPDLPPSAWPRLTTWAAVSLASTIENSL--GLPVSIKWPNDIYLSGR 186

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE-----GGCIDLKDIFS 174
           KIAGIL E+    NG    VVGIG+NV     + P  + +         G  ID   + +
Sbjct: 187 KIAGILAESGADVNGRPFAVVGIGVNVNQSQAEFPPELATKAASLSMITGRLIDRPTLAA 246

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            L +++         D     ++   R  +  +G  + ++  +  + GR   +D  G LL
Sbjct: 247 HLLRELGTRFPQILADF--PAMIAAARRRSLLLGHWVQVQSGHNILEGRAEELDPDGQLL 304

Query: 235 LEEKKGCVRQIFTGDI 250
           L    G + ++  G++
Sbjct: 305 LRRSDGTLSRLSAGEV 320


>gi|317472898|ref|ZP_07932204.1| biotin-[acetyl-CoA-carboxylase] ligase [Anaerostipes sp. 3_2_56FAA]
 gi|316899618|gb|EFV21626.1| biotin-[acetyl-CoA-carboxylase] ligase [Anaerostipes sp. 3_2_56FAA]
          Length = 327

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (48%), Gaps = 6/238 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           +   T+ STN E  + A +G      + A  QT+G+GRR   W+S  G  ++ S +L   
Sbjct: 82  KVMKTVDSTNLEARRLAEAGASHGTLVTAEEQTSGKGRRGRSWVSVPGQGVWMSFVLRPD 141

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  ++ ++L+   A+A+   I      G D KIKWPND+L+  +K+ GIL E     + L
Sbjct: 142 VELENSSMLTLVAALAVEKGIKDA--AGIDGKIKWPNDVLINGKKVCGILTELSAQMDEL 199

Query: 136 QAVVVGIGL--NVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             +VVGIG+  N++  P +     TSL  E G   D   +   + +      +++KK   
Sbjct: 200 NYIVVGIGINANIEQFPEEVRDKATSLLLETGKPADRIALLCRVLEHFEHDYEIFKKTQD 259

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +M  +  F    G  I +       + +  G++  G L++E+  G  R+IF+G++
Sbjct: 260 FSMLMEEYNSFLAHRGQEIKVMRGNDEYMCKSGGINRRGELIVEDSLGRTREIFSGEV 317


>gi|315230054|ref|YP_004070490.1| biotin-protein ligase [Thermococcus barophilus MP]
 gi|315183082|gb|ADT83267.1| biotin-protein ligase [Thermococcus barophilus MP]
          Length = 249

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 125/238 (52%), Gaps = 13/238 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +   + STN+   K A   + G + IVA  Q  GRGR+  KWIS KG L+ S++L  ++ 
Sbjct: 15  YLQEVESTNELAKKIAPQEEEGTI-IVADIQRRGRGRKLRKWISPKGGLWMSVILKPNVH 73

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
              +T L F  A+A+   +A     G + KIKWPND+LV ++KI GIL E     + ++ 
Sbjct: 74  LVHITKLVFVSALAVVETLAE---FGIEGKIKWPNDVLVNRKKICGILSEGKYSTDSVEY 130

Query: 138 VVVGIGLNVKH-CPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLW---KKDTG 192
           VV+GIGLNV +  PVD      S++   G  + L ++F  L +     LD W     D  
Sbjct: 131 VVLGIGLNVNNEIPVDLLDVAISMKDVLGFRVPLVEVFRNLLEK----LDKWYLRYLDGQ 186

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I+  W+ ++  IG  + I      I+G  V V D G L++  K G +++I+ GD+
Sbjct: 187 YALILEEWKAYSAVIGKEVRIVGDNEEIIGTAVDVSDDGSLIIALKDGTLKKIYYGDV 244


>gi|302389451|ref|YP_003825272.1| biotin/acetyl-CoA-carboxylase ligase [Thermosediminibacter oceani
           DSM 16646]
 gi|302200079|gb|ADL07649.1| biotin/acetyl-CoA-carboxylase ligase [Thermosediminibacter oceani
           DSM 16646]
          Length = 327

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 117/240 (48%), Gaps = 13/240 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
           ++   +STN+E  K A  G      ++A  QT G+GR    W+S  +  ++ S++L   I
Sbjct: 90  YYPATASTNEEAKKLAGEGAHHGSLVIAEEQTGGKGRMGRVWLSPPRVGIWMSIILRPVI 149

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  ++   AVA    I      G    IKWPNDILV  +K+AGIL E     +G+ 
Sbjct: 150 QPYEAPRITMTGAVAAAKAIRER--TGVTCHIKWPNDILVEGKKVAGILTEMSADIDGIN 207

Query: 137 AVVVGIGLNVKH--CPVDTPYPVTSLQ-REGGCIDLKDI---FSLLFQDVARVLDLWKKD 190
            VV+GIG+NV +   P +     TSL+  +G   D  DI   F   F+D    L+  +  
Sbjct: 208 YVVMGIGINVNNDDFPGELKEIATSLKIAKGEAQDRLDILTGFLFRFEDYYNCLEAGE-- 265

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              ++I+  WR   C +G  + +     ++ G  + VDD G LL+  + G V +I +GD+
Sbjct: 266 --FKKILEEWRLLCCNLGRRVRVVGRNFTVEGIALDVDDDGALLVRSENGRVERILSGDV 323


>gi|302386861|ref|YP_003822683.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium saccharolyticum
           WM1]
 gi|302197489|gb|ADL05060.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium saccharolyticum
           WM1]
          Length = 327

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 120/246 (48%), Gaps = 6/246 (2%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LY 67
           +  +    E+ + I STN    + A  G      ++A  Q AGRGRR   W+S  GN ++
Sbjct: 75  KGKFGREVEYHEIIDSTNIRAKRLAEEGASSGTLVLADLQEAGRGRRGRTWVSPSGNNIF 134

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
            SL+L   I   S ++++   A+A+   I +    G    IKWPNDI+   +K+ GIL E
Sbjct: 135 MSLILRPDILPSSASMITLVAALAVYDGIKNL--TGLAAGIKWPNDIVANGKKLCGILTE 192

Query: 128 TLNLKNGLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVL 184
                 G+  VVVGIG+NV  +  P +     TSL  E G  +    + + + +   +  
Sbjct: 193 MSAELEGIHYVVVGIGINVNMEEFPEEVRQTATSLFLETGEKVGRSRLVAAVMEAFEQYY 252

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           + +        +++++       G  + +    G  +G+ +G+++ G LL+E + G VR+
Sbjct: 253 EEFISQGDLSGLISVYNKNMVNAGKEVRVLDRSGDYIGKALGINEKGELLVEVEPGKVRR 312

Query: 245 IFTGDI 250
           + +G++
Sbjct: 313 VISGEV 318


>gi|182411911|ref|YP_001816977.1| biotin--acetyl-CoA-carboxylase ligase [Opitutus terrae PB90-1]
 gi|177839125|gb|ACB73377.1| biotin--acetyl-CoA-carboxylase ligase [Opitutus terrae PB90-1]
          Length = 332

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 111/246 (45%), Gaps = 12/246 (4%)

Query: 15  RYEF----FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           R EF     D + STNDE  ++  +G +    ++A  QT GRGR    W S+  GNLYAS
Sbjct: 80  RREFPILLLDEVDSTNDEAARQLAAGRIAPFVVLAHRQTHGRGRLGRSWHSEAPGNLYAS 139

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                 IS   +   +  + V +  +IA+   +     IKWPNDIL   RK  G+L E  
Sbjct: 140 FAFRPKISPTRMGAFTLWMGVNVCELIATVAQLAPG--IKWPNDILFDGRKAGGMLTEAR 197

Query: 130 NLKNGLQAVVVGIGLN----VKHCPVDTPYPVTSL-QREGGCIDLKDIFSLLFQDVARVL 184
              + ++ +V G+GLN    V   P D      SL ++    +D+    + L   V    
Sbjct: 198 IDADQIRDLVFGLGLNINGPVHGWPADLARRAVSLSEKTKASLDVNYFTAALIGRVLLAY 257

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D +      +   +LW+ F    G  I +  S   I G   GVDD G LL+    G +++
Sbjct: 258 DHFVDGEHTKTFADLWQRFDVLRGHPIALLQSGRRIAGIAAGVDDEGSLLIRSATGRLQR 317

Query: 245 IFTGDI 250
              GD+
Sbjct: 318 FHAGDV 323


>gi|56416631|ref|YP_153705.1| biotin-(acetyl-CoA carboxylase) [Anaplasma marginale str. St.
           Maries]
 gi|56387863|gb|AAV86450.1| biotin-(acetyl-CoA carboxylase) [Anaplasma marginale str. St.
           Maries]
          Length = 242

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 122/246 (49%), Gaps = 11/246 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           + F         STN E ++ A SG      I+A  QT+G GR   +W S KGNLY S++
Sbjct: 2   HGFVIHHTSVSRSTNLEAIELAQSGAPDGTVIIADEQTSGTGRYGREWHSPKGNLYCSII 61

Query: 72  LIDSISKDSLTLL-SFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIET 128
              S    +L+ L S A+ V +  V  +      +  ++ KWPND++V  +KI+G+LI+T
Sbjct: 62  TRRSAQVAALSFLSSLAVGVTLEQVFEAHNCSTKNALIRYKWPNDVMVDGKKISGVLIKT 121

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDL 186
             +   +   V GIG+N+   P   PY   SL      + L   ++  L+ Q+ A++LD+
Sbjct: 122 KMIGGEIDWAVCGIGVNMYAPP---PY-AASLHDYIPELKLSNLELLDLMLQNFAKLLDV 177

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQI 245
            +   G  ++ +LW       GD I +  +   I+ G+FV +D  G ++LE   G    +
Sbjct: 178 LET-MGFAQLRSLWMRRGHTPGDKIRVITNNNMIIEGKFVNIDTHGAMVLESDGGIPTAV 236

Query: 246 FTGDIF 251
             G++ 
Sbjct: 237 DYGEML 242


>gi|311030317|ref|ZP_07708407.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Bacillus sp. m3-13]
          Length = 328

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 117/244 (47%), Gaps = 13/244 (5%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           +  F D+++ST     + A  G      +VA  QT+GRGR    W S K   ++ SL+L 
Sbjct: 85  KIHFEDSVTSTQKIAHQLAYDGVPEGTLVVAEEQTSGRGRLSRAWYSPKYTGVWMSLILR 144

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            ++       L+   AVA+   I     +  D  IKWPNDIL+ ++K  GIL E     +
Sbjct: 145 PNLPPAKAPQLTLLTAVAITQAIEEVTGLRPD--IKWPNDILINKKKTVGILTEMQAEAD 202

Query: 134 GLQAVVVGIGLNVKHC----PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWK 188
            + +V++G+G+NV       P +     TSL  E G  ++  ++   +     +  +L++
Sbjct: 203 KINSVIIGMGINVNQSLEQFPEELHSIATSLSIELGEKVNRAELIQTIL---MKFENLYQ 259

Query: 189 K--DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           K    G   I  LW  +A  IG  I  +   G++ G+  G+ + G L+LE+ +  V  I 
Sbjct: 260 KYLQHGFYPIKLLWESYAISIGKRIIARTITGTLEGKAKGITEDGVLMLEDDQEVVHYIH 319

Query: 247 TGDI 250
           + DI
Sbjct: 320 SADI 323


>gi|291279943|ref|YP_003496778.1| biotin-[acetyl-CoA-carboxylase] ligase [Deferribacter desulfuricans
           SSM1]
 gi|290754645|dbj|BAI81022.1| biotin-[acetyl-CoA-carboxylase] ligase [Deferribacter desulfuricans
           SSM1]
          Length = 255

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 132/243 (54%), Gaps = 19/243 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLL 72
           FR   ++ ++STN   +  +L  D+ ++ I+A+ Q  G+GR+   WISD +GNLY +++L
Sbjct: 20  FRLYIYEILTSTNQFALDSSL--DIYSI-IIANKQLKGKGRQGRTWISDNEGNLYFTIVL 76

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
            ++ +  +L  L+   A A+   +     V  +VK+KWPNDIL   +KI+GIL+E     
Sbjct: 77  DNNENIRTLFRLNIITAYALCDTMKDVYSV--NVKVKWPNDILYNGKKISGILLEAKMEG 134

Query: 133 NGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLF-QDVARVLDLWKK 189
           N L  +V+G+G+N+    +  +     T+L  E G    K I  L F +   R    WK 
Sbjct: 135 NKLNRIVLGVGINLNADKIADEIKNRATTLFLETG----KKIDKLEFLKRFLRHFIKWKN 190

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV--GVDDFGYLLLEEKKGCVRQIFT 247
             G  +I  LW  ++      I+    Y + + +F+  G+ D G L++E+KKG +++++ 
Sbjct: 191 WDG--DINKLWDKYSAYYNKEIS--FHYNNSIEKFIEKGITDDGALIIEDKKGVLKKVYY 246

Query: 248 GDI 250
           G+I
Sbjct: 247 GEI 249


>gi|164686640|ref|ZP_02210668.1| hypothetical protein CLOBAR_00233 [Clostridium bartlettii DSM
           16795]
 gi|164604369|gb|EDQ97834.1| hypothetical protein CLOBAR_00233 [Clostridium bartlettii DSM
           16795]
          Length = 327

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 124/241 (51%), Gaps = 17/241 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
             DT+ STND   K   +   G   I++  QT G+GR    W S  G+ ++ SL++   I
Sbjct: 87  HLDTVGSTNDYA-KEIGNKVSGGTLIISEQQTKGKGRLGRVWKSKSGDGIWMSLIIKPKI 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+    VA  SV+ +   +G +  IKWPNDI+V  +KI GIL E       + 
Sbjct: 146 EPYKAPFLTL---VAGASVVKALSNLGVEASIKWPNDIIVHNKKICGILTELSAEMERVN 202

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDI---FSLLFQDVAR--VLDLWKK 189
            VV+GIG+N+K    P +     TSL +EG  +   DI   F + F+ + +  +LD  K+
Sbjct: 203 YVVIGIGINIKTIDFPDEIKEKATSLYKEGYKLSRVDIVRQFCIEFEKLYKGYILDGNKQ 262

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           DT     + L R ++  IG  + +  +    L + + +++ G L+++EK G +++I +G+
Sbjct: 263 DT-----LELCRKYSAIIGKQVYVIKNNKRELVKCIDINENGNLIVKEKNGEIQEIMSGE 317

Query: 250 I 250
           +
Sbjct: 318 V 318


>gi|114777612|ref|ZP_01452593.1| birA biofunctional protein, putative [Mariprofundus ferrooxydans
           PV-1]
 gi|114552083|gb|EAU54600.1| birA biofunctional protein, putative [Mariprofundus ferrooxydans
           PV-1]
          Length = 319

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 111/245 (45%), Gaps = 16/245 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
            R    D   STN + M+ A  G+   L ++A  QT GRGR   +W +   +L  S+LL 
Sbjct: 80  HRLLLVDETGSTNQDVMRLAEHGEPDGLVMIAKRQTTGRGRLGRRWHTVPESLAVSVLLR 139

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            ++  + +  LS   AVA+   +   +P    ++IKWPND++    K+AGIL E      
Sbjct: 140 PALPPEKVPQLSLLTAVALHEALQVYVPA---LRIKWPNDLMCHGGKLAGILTEMRAEPG 196

Query: 134 GLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGCIDLKDIFSL-LFQDVARVLDLWK 188
            + AVV+G G+N+       P D   P   L    G    + +  L +   V  VLD W 
Sbjct: 197 SVHAVVLGFGINLNPPADGWPADITQPAIDLATAAG----RSMSRLEVVAGVLNVLDAWY 252

Query: 189 K---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
                 G + +   W          + +    G + G   G+D  G LLLE ++G +R+I
Sbjct: 253 DRYLRQGFDPVREAWWQAHAASDQAVRVHDGRGYLHGMARGLDHDGALLLETEEG-MRRI 311

Query: 246 FTGDI 250
             G++
Sbjct: 312 IAGEL 316


>gi|262280100|ref|ZP_06057885.1| birA [Acinetobacter calcoaceticus RUH2202]
 gi|262260451|gb|EEY79184.1| birA [Acinetobacter calcoaceticus RUH2202]
          Length = 250

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I    P+   +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---IPQLQPL--SLQVKWPNDLYSAQGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQ----REGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+     +   ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKMPPVTDSDQPITSLEDLGLEQNNRLELVSELYMAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  I   +  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWINQFVQFEHSQGLVEGRFVGISNDGAVILETPE--PKQFYQGRL 244


>gi|331268218|ref|YP_004394710.1| birA bifunctional protein [Clostridium botulinum BKT015925]
 gi|329124768|gb|AEB74713.1| birA bifunctional protein, putative [Clostridium botulinum
           BKT015925]
          Length = 328

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 121/239 (50%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +F+TI STN++  +   +G L    +++  QT GRGR   +W+S K   ++ S++L   I
Sbjct: 84  YFNTIDSTNNKAKELGTNGVLEGTVVISEEQTGGRGRLGRQWVSPKFKGIWMSMILRPDI 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + ++  +A A+ S I     +G DV IKWPNDI++  +KI GIL E     N + 
Sbjct: 144 EPMEASKITQIVAAAVCSAIKE---LGIDVYIKWPNDIVLNNKKICGILTEMSGEINKIN 200

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDT 191
            +V GIG+NV    +  P D     TS++ + G  I  K++ + +F     + D +    
Sbjct: 201 YIVAGIGINVNIDEEDFPEDIKKIATSIKIQTGLKIQRKELIAKIFNKFEMLYDEFINKG 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +  + + +C +  +G  + I      I  + + + + G L++E   G V +I +G++
Sbjct: 261 TIKRSIEICKCNSALLGRKVKIIRKSNEIFAKALTIAEDGELIVEYDDGKVEKIVSGEV 319


>gi|150392216|ref|YP_001322265.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus metalliredigens
           QYMF]
 gi|149952078|gb|ABR50606.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus metalliredigens
           QYMF]
          Length = 326

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 116/238 (48%), Gaps = 7/238 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           ++FDTI STN      AL    G + +++  Q  GRGR    W S KG  ++ SL+L   
Sbjct: 83  KYFDTIDSTNTYSKTIALEVPHGTI-VMSDEQVGGRGRLGRNWSSPKGEGIWMSLILKPG 141

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I  +    +S   A A+   I      G +  +KWPNDI++  +K+ GIL E     N +
Sbjct: 142 IPPNEGMKVSHIAAAAVCKGIREI--TGLEALVKWPNDIVINGKKVCGILTEVAGELNEI 199

Query: 136 QAVVVGIGLNVKHC--PVDTPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             ++VGIG+NV +   P +     +SL  EG    D K++   +     +  D + K+  
Sbjct: 200 HYLIVGIGINVNNIDFPTELEEKASSLLIEGKKKYDRKELIVKIISIFEKFYDSFIKEGS 259

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            EE++ L R ++  IG  + I         + +G+ D G+L +E   G +  IF+G++
Sbjct: 260 LEEVLRLCRQYSALIGREVVIIKGGSQEAAKVLGMTDEGFLEVELSDGRIEHIFSGEV 317


>gi|167745538|ref|ZP_02417665.1| hypothetical protein ANACAC_00229 [Anaerostipes caccae DSM 14662]
 gi|167655259|gb|EDR99388.1| hypothetical protein ANACAC_00229 [Anaerostipes caccae DSM 14662]
          Length = 327

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (48%), Gaps = 6/238 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           +   T+ STN E  + A +G      + A  QT+G+GRR   W+S  G  ++ S +L   
Sbjct: 82  KVMKTVDSTNLEARRLAEAGASHGTLVTAEEQTSGKGRRGRSWVSVPGQGVWMSFVLRPD 141

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  ++ ++L+   A+A+   I      G D KIKWPND+L+  +K+ GIL E     + L
Sbjct: 142 VELENSSMLTLVAALAVEKGIKDA--AGIDGKIKWPNDVLINGKKVCGILTELSAQMDEL 199

Query: 136 QAVVVGIGL--NVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             +VVGIG+  N++  P +     TSL  E G   D   +   + +      +++KK   
Sbjct: 200 NYIVVGIGINANIEQFPEEVRDKATSLFLETGKPADRIALLCRVLEHFEHDYEIFKKTQD 259

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +M  +  F    G  I +       + +  G++  G L++E+  G  R+IF+G++
Sbjct: 260 FSMLMEEYNSFLAHRGQEIKVMRGNDEYMCKSGGINRRGELIVEDSLGRTREIFSGEV 317


>gi|126640850|ref|YP_001083834.1| hypothetical protein A1S_0794 [Acinetobacter baumannii ATCC 17978]
          Length = 230

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 7   TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 65

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     + S       +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 66  RLALEVALNILQIPQLQS-----LSLQVKWPNDLYSTQGKWGGILVEPLSQHQ----AIV 116

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 117 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 171

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G I GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 172 LAGRFNHHAAWLNQLVQFEHSQGLIYGRFVGISNEGAVILETPE--PQQFYQGRL 224


>gi|189424381|ref|YP_001951558.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter lovleyi SZ]
 gi|189420640|gb|ACD95038.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter lovleyi SZ]
          Length = 328

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 116/234 (49%), Gaps = 9/234 (3%)

Query: 23  SSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSL 81
           +STN +    A  G      ++A  Q AG+GR   +W S  G NLY S++L   +     
Sbjct: 95  ASTNSDAFHLAEEGAEEGTVVLADRQLAGKGRLGRRWESPAGVNLYCSVVLRPELPPYEA 154

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
             L+F  AVA+   I ++   G    IKWPND+L+  RK+AG+L E     + +  V++G
Sbjct: 155 PQLTFLSAVAVARAIHTS--TGLQPVIKWPNDLLLNGRKVAGLLNEMNAETDRVGFVILG 212

Query: 142 IGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSL-LFQDVARVLDLWKKDTGREEI 196
           IG+N+       P D   P TSL  E G   ++  F++ L +++ R    + ++ G   +
Sbjct: 213 IGVNLNMREDQFPPDLRSPATSLLLETGSAVVRQAFAVNLLRELEREYLRFTQN-GFGPV 271

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              W  +    G  + +++   ++ G F G+D  G LL+    G + +I +GD+
Sbjct: 272 REDWTRYCNAFGREVRVEMGPHTLQGPFAGIDHDGALLMTLPDGRIERILSGDV 325


>gi|193076573|gb|ABO11232.2| hypothetical protein A1S_0794 [Acinetobacter baumannii ATCC 17978]
          Length = 250

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     + S       +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQIPQLQS-----LSLQVKWPNDLYSTQGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G I GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLIYGRFVGISNEGAVILETPE--PQQFYQGRL 244


>gi|169634137|ref|YP_001707873.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           baumannii SDF]
 gi|169152929|emb|CAP01970.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           baumannii]
          Length = 250

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 116/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I    P+   +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---IPQLQPL--SLQVKWPNDLYSTQGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNYHAAWLNQLVQFEHSQGLVYGRFVGISNEGAVILETPE--PQQFYQGRL 244


>gi|213966089|ref|ZP_03394277.1| biotin-[acetyl-CoA-carboxylase] ligase [Corynebacterium amycolatum
           SK46]
 gi|213951287|gb|EEB62681.1| biotin-[acetyl-CoA-carboxylase] ligase [Corynebacterium amycolatum
           SK46]
          Length = 285

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 123/242 (50%), Gaps = 11/242 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNL-WIVASCQTAGRGRRDNKWISDKGNLYA--SLLLI 73
           E  +T  STN +  K+A  G + +L  ++AS QTAGRGR    W + KG   A  +LL  
Sbjct: 29  EVVETTGSTNADLRKQAALGQVTDLSALIASEQTAGRGRLSRSWTAPKGASIALSALLRP 88

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
           + ++ + L LL     +A+   +     +  + V +KWPND+LV  RK+ GIL+E  +L 
Sbjct: 89  EGLAPEQLGLLPLVAGLAVVDAVVEVAGLAPERVSLKWPNDVLVDGRKLCGILVEAASLT 148

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
                ++ GIG+NV     + P P   SL   G   +D  DI + + + + R    W+K 
Sbjct: 149 P--PTLIPGIGINVSLQEDELPVPHAISLYLAGAENLDRDDISAGVLRVLGRRQAQWRK- 205

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            G  E++  +      IG  + ++LS   +L G+ VGV   G L++ ++ G    +  GD
Sbjct: 206 -GDAELLRDYEAVCATIGSNVRVELSGDRVLVGKAVGVCADGELIVTDEAGTSHFVAAGD 264

Query: 250 IF 251
           +F
Sbjct: 265 VF 266


>gi|85374146|ref|YP_458208.1| biotin protein ligase [Erythrobacter litoralis HTCC2594]
 gi|84787229|gb|ABC63411.1| biotin protein ligase [Erythrobacter litoralis HTCC2594]
          Length = 236

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 106/231 (45%), Gaps = 9/231 (3%)

Query: 24  STNDECMKRALSGDL--GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           STN + + R   GD      W+VA  QTAGRGR+   W    GN   S ++  +      
Sbjct: 10  STNADLISRICGGDHVPEGHWLVADRQTAGRGRQGRTWFDGSGNFMGSTVVHRAPQDPLA 69

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
             LS    +A+   +AS +   + + +KWPND+L+   K+ G+L+E         AVV+G
Sbjct: 70  HSLSLVAGLALYEALASHVSDPSGLMLKWPNDVLLRGAKLCGVLLERAG-----DAVVIG 124

Query: 142 IGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWR 201
           IG+N+   P        +L + G   D     + L   + R L+ W+   G + ++  W 
Sbjct: 125 IGVNLAAAPDLPDRETIALSQLGPAPDRDLFAAALAGALDRELERWRA-YGLDPLIRRWL 183

Query: 202 CFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
                 G  +++    GS L GRF G+D  G L L    G +R I  GD+ 
Sbjct: 184 VGGTPEGTALSVHEPDGSRLSGRFAGLDAEGTLQLRLDDGTIRAIHAGDVM 234


>gi|292656607|ref|YP_003536504.1| biotin--acetyl-CoA-carboxylase ligase [Haloferax volcanii DS2]
 gi|291370495|gb|ADE02722.1| biotin--acetyl-CoA-carboxylase ligase [Haloferax volcanii DS2]
          Length = 334

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 118/260 (45%), Gaps = 35/260 (13%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           +  EF +T+ S+ND     A  G   ++ +VA  QTA RGR++ +W +  G ++ SLL+ 
Sbjct: 75  YDVEFHETLDSSNDRARDLAAEG-ASDVVVVAREQTASRGRKNREWSAPDGGVWLSLLVR 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ--------------- 118
                    L + A+AVA   V  +    G D KIKWPND++V +               
Sbjct: 134 PDEPPAYAPLYTLAMAVA---VCDAAREAGVDAKIKWPNDVIVSEASGGSPAHAGDRSTD 190

Query: 119 ---------RKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDL 169
                    RK+ GIL E     + +  +V+G G+NV   P + P   TS+  E G ++ 
Sbjct: 191 ADAPDDRGYRKLCGILTEMEGEADRVSWLVIGPGVNVNLDPAELPEVATSVAAEAGPVER 250

Query: 170 KDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDD 229
           +    +  Q V    D  + D   + ++  WR  A  +G  + +  + G I G  V ++ 
Sbjct: 251 R----VFVQRVLERFDALRSDL--DAVLPAWRERADTLGRRVRVHTASGVIEGDAVDIEH 304

Query: 230 FGYLLLEEKKGCVRQIFTGD 249
            G L++    G  +++  GD
Sbjct: 305 PGTLVVSTDAG-EKRVHAGD 323


>gi|91774336|ref|YP_567028.1| biotin--acetyl-CoA-carboxylase ligase [Methanococcoides burtonii
           DSM 6242]
 gi|91713351|gb|ABE53278.1| Bifunctional protein birA [Methanococcoides burtonii DSM 6242]
          Length = 321

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 119/239 (49%), Gaps = 17/239 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +FD + STND   K   S D G + ++A  Q +GRGR+   W+S +G ++ S++L  ++ 
Sbjct: 87  YFDEVDSTNDVAKKMGSSSDEGTV-VIAEMQDSGRGRKGGHWMSPRGGVWMSVILKPNVV 145

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                  +    VA+   I     +G +  +KWPND+L+  +K+ GIL E     + +  
Sbjct: 146 PAYAPRFTLMAGVAVAKAIRG---LGVEASLKWPNDVLIGDKKVCGILTEMDAECDQINF 202

Query: 138 VVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLF-QDVARVLD---LWKK 189
           V++GIG+NV    +    D     TSL      I  +++  + F Q + R L+   +  K
Sbjct: 203 VIIGIGINVNVLIEELSEDLRSSSTSLSE----IKGEELDRIAFVQALLRALEDEYIRSK 258

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            +G + I+  WR  +  IG  + +      I G+ VG+ + G LL+E  +G + +I  G
Sbjct: 259 TSGFDSILEEWRSLSSTIGRDVDVVTPQRIIRGKAVGITENGTLLVETAEG-LEEIVAG 316


>gi|289422524|ref|ZP_06424367.1| biotin-(acetyl-CoA-carboxylase) ligase [Peptostreptococcus
           anaerobius 653-L]
 gi|289157096|gb|EFD05718.1| biotin-(acetyl-CoA-carboxylase) ligase [Peptostreptococcus
           anaerobius 653-L]
          Length = 327

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 120/240 (50%), Gaps = 10/240 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           R ++F TI STN +  K A     G + ++A  QT G+GR    W+S++   LY S +L 
Sbjct: 85  RVDYFKTIDSTNIQANKIASQSPEGTV-VLADEQTKGKGRIGRTWVSEQNKGLYFSTILK 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I+   L    F   +   S+  + L +G ++ IKWPND++   +K+AGIL E     +
Sbjct: 144 PDIA---LMQAPFITQLVAASLTKTFLDLGIEISIKWPNDLIYKGKKVAGILTEMSAEID 200

Query: 134 GLQAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            +  ++VGIG+N+  K    +     TS   EG  ID  +     F +   + + +K   
Sbjct: 201 HISYIIVGIGINLYKKDFEDEIKDKATSFANEGIEIDRIEFLRKFFPNFEDLYEKFKAGD 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFV-GVDDFGYLLLEEKKGCVRQIFTGDI 250
            R E +++ R  +  +G  +  K+  G  +  F   +DD G L++E + G V  +FTG+I
Sbjct: 261 KR-ECLDILRSRSAVLGREV-YKIKEGERVKVFARDIDDMGNLIVEHESGQVETVFTGEI 318


>gi|78357696|ref|YP_389145.1| biotin--acetyl-CoA-carboxylase ligase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220101|gb|ABB39450.1| Biotin--acetyl-CoA-carboxylase ligase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 343

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 28/252 (11%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
             +++ STN E    A  G      ++A CQTAGRGR+   W+S +G +Y S++L    +
Sbjct: 100 HMESVPSTNMEARVLAERGAPEGSVVLADCQTAGRGRQGRTWLSPRGGVYMSVVLRPQCA 159

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
              + +L+    VA+   +      G     KWPND+LV  RK++G+LIE   + + L  
Sbjct: 160 PQQVPVLTLMTVVAVVGAVRGL--TGLPAMPKWPNDVLVHGRKLSGVLIEAGLVVDALDY 217

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREG-------GCIDLKD-----------IFSLLFQD 179
            V GIG+NV           + L+R+G       G ++              +   + + 
Sbjct: 218 AVAGIGINVNTV-------CSELERDGMRAVSLRGALETHHGTEQPQLPRAGVARAVLEG 270

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +    +L++   G   ++  W+  A   G  I +      + G+   VDD G+LLLE++ 
Sbjct: 271 LEEAYELFRSGGG-AAVVARWKQLAGITGSSIRLGRGDAVLTGKVRDVDDNGWLLLEDES 329

Query: 240 GCVRQIFTGDIF 251
           G V ++  GDI 
Sbjct: 330 GTVHRLPAGDIL 341


>gi|23099219|ref|NP_692685.1| biotin [acetyl-CoA carboxylase] ligase [Oceanobacillus iheyensis
           HTE831]
 gi|22777448|dbj|BAC13720.1| biotin [acetyl-CoA carboxylase] ligase : transcriptional repressor
           of the biotin operon [Oceanobacillus iheyensis HTE831]
          Length = 328

 Score = 95.1 bits (235), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 111/235 (47%), Gaps = 8/235 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           ++ ST     + A +G      I+A  QTAGRGR    W S+   ++ +++L  +I  + 
Sbjct: 90  SVGSTQLVGHEAAQNGAAHGTIIIADEQTAGRGRVQKNWDSNGDGIWMTIILRPNIPPNR 149

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
            + L+   AVA+   I     +  D  IKWPNDIL+ ++K+ GIL E    ++ +Q +++
Sbjct: 150 ASELTLLTAVAITKAIKKITNI--DPLIKWPNDILIKEKKLCGILTEMQAEQDQVQYILI 207

Query: 141 GIGLNVKHCPV----DTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G GLNV               TSL +E G   +   +   +     R  + +  + G + 
Sbjct: 208 GTGLNVNQSNQLWDKQLQNIATSLYQETGHTFEKHTLLQQILLQFERTYNNY-MEHGFQP 266

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           I   W   A  IG  I I   +   +G+F+G+ D G LL E   G   +I++ DI
Sbjct: 267 IKQQWEANAFKIGSEIEITTFHEQWVGKFLGISDEGALLAESSDGSPVKIYSADI 321


>gi|297620545|ref|YP_003708682.1| putative biotin-[acetyl-CoA-carboxylase] ligase [Waddlia
           chondrophila WSU 86-1044]
 gi|297375846|gb|ADI37676.1| putative biotin-[acetyl-CoA-carboxylase] ligase [Waddlia
           chondrophila WSU 86-1044]
          Length = 239

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 109/214 (50%), Gaps = 15/214 (7%)

Query: 43  IVASCQTAGRGRRDNKWIS-DKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           + A  Q+ GRGR  N+W S +  NLYA+  +   + +     L   IA+A  SV+     
Sbjct: 33  VYAKKQSEGRGRHKNQWTSPNANNLYATFGVFIPLEQGVQPNLPQLIALATISVMEK--- 89

Query: 102 VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ 161
           +G   KIKWPND+LV Q+KIAGIL ET ++ +      VGIG+N+   P D P PVTSL 
Sbjct: 90  MGVQPKIKWPNDLLVQQKKIAGILTET-SIDDQHIFHAVGIGVNLNSSP-DLPRPVTSLS 147

Query: 162 RE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSI 220
            E    IDL++    L +  +R L ++  D G    +     F   +      +LS+   
Sbjct: 148 AEIEREIDLEEFLDQLKETFSRFLSVF-LDAGFSPYL---PAFKAHLNHHENQELSFHEK 203

Query: 221 ----LGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                G+F  ++D G L L+ + G VR+   G+I
Sbjct: 204 DCQWKGKFHSINDDGTLNLKLETGEVRRFIAGEI 237


>gi|163732042|ref|ZP_02139488.1| biotin--acetyl-CoA-carboxylase ligase, putative [Roseobacter
           litoralis Och 149]
 gi|161394340|gb|EDQ18663.1| biotin--acetyl-CoA-carboxylase ligase, putative [Roseobacter
           litoralis Och 149]
          Length = 253

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 107/238 (44%), Gaps = 7/238 (2%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            + + ST DE  ++A       LWI A  QT  RGRR   W   +GN  A+LLL  +   
Sbjct: 17  LNEVDSTLDEAARQAPKAAT-PLWIFARRQTTARGRRGRPWSMPEGNFAATLLLRPAGPP 75

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
               L SF +++A+             + +KWPND+L+   K+AGIL+E+         +
Sbjct: 76  TQAALRSFIMSLALYRAFVEVTGREKGLALKWPNDVLLNGGKVAGILLESTGAGQQTGFL 135

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            +G+G+N+   P  +    T+L+      E     L + F  +       L+   +  G 
Sbjct: 136 SIGVGVNLVAAPPASDVEATALKPVSILSETSVRVLPETFFEVLACHFANLEQQFQQYGF 195

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           E I   W   A  IG++IT + +     G F  VD  G+L+L   +G V  I   D++
Sbjct: 196 EPIRTGWLAHAARIGEVITARTTREEYSGTFEDVDAEGHLVLRGPRG-VMSIAAADVY 252


>gi|76802823|ref|YP_330918.1| biotin--[acetyl-CoA-carboxylase] ligase [Natronomonas pharaonis DSM
           2160]
 gi|76558688|emb|CAI50280.1| biotin--[acetyl-CoA-carboxylase] ligase [Natronomonas pharaonis DSM
           2160]
          Length = 306

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 117/243 (48%), Gaps = 11/243 (4%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL 66
           E Q   S   E+ D I+STND   + A  G  G + ++A  QT  RGR D  W S  G +
Sbjct: 68  EHQLDASVDIEYHDRIASTNDRARELAADGAEG-VCVLADEQTGARGRLDRPWESPAGGV 126

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + SL+    +    + + + A AVA  + +     VG   +IKWPNDILV   K+ GIL 
Sbjct: 127 WLSLVYRPDLPPSQVPVYTLAAAVAATAALRE---VGVSAEIKWPNDILVDGEKLVGILT 183

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E     + +  VVVGIG+N        P   T+++ + G ID   + + +   +  + + 
Sbjct: 184 EMEGEADRVSWVVVGIGINANIDAASVPDHATTVKEQVGDIDRGALTASIIDRLEALRN- 242

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
                  E++   WR  +  IG ++ ++    ++ G  VG++  G L++E   G  R+I 
Sbjct: 243 -----APEDVPEAWRELSTTIGQIVRVETPGETVTGEAVGIEFPGTLVVETDDGK-RRIA 296

Query: 247 TGD 249
            GD
Sbjct: 297 AGD 299


>gi|119717716|ref|YP_924681.1| biotin--acetyl-CoA-carboxylase ligase [Nocardioides sp. JS614]
 gi|119538377|gb|ABL82994.1| biotin--acetyl-CoA-carboxylase ligase [Nocardioides sp. JS614]
          Length = 263

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 110/230 (47%), Gaps = 20/230 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           E  ++ +S+N     RA  G    L IVA  Q+AGRGR D  W +   +     LL+   
Sbjct: 21  EVLESATSSNAVASDRAREGADEGLVIVAEHQSAGRGRLDRAWEAPARSALTFSLLVRPT 80

Query: 77  SKDS----LTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +  +    L LL+ + +   +R+        G DV +KWPND+LV  RK+ GIL+E +  
Sbjct: 81  APAADWPWLPLLTGYTVMKTLRAE-------GYDVGVKWPNDVLVGDRKLVGILVERVET 133

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKK 189
            +G  A V+G+GLNV     + P P  TSL  E G   D   +   L + +    D+W+ 
Sbjct: 134 PSG-PAAVLGVGLNVSLTADELPVPTATSLTLESGAEPDRTHLLVELLRSLREAYDVWQA 192

Query: 190 DTGREEIMNLWRCFACG---IGDLITIKLSYGSIL-GRFVGVDDFGYLLL 235
             G E    L   +A     +G  + + L  G +L GR  GVD  G L++
Sbjct: 193 G-GAEATARLRSSYAAACVTVGREVRVDLPGGQLLTGRATGVDGAGRLVV 241


>gi|260550987|ref|ZP_05825192.1| birA [Acinetobacter sp. RUH2624]
 gi|260405935|gb|EEW99422.1| birA [Acinetobacter sp. RUH2624]
          Length = 250

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 116/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I+   P+   +++KWPND+     K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---ISQLQPL--SLQVKWPNDLYSAHGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELMSELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLVQGRFVGISNEGAVILETPE--PQQFYQGRL 244


>gi|284165938|ref|YP_003404217.1| biotin/acetyl-CoA-carboxylase ligase [Haloterrigena turkmenica DSM
           5511]
 gi|284015593|gb|ADB61544.1| biotin/acetyl-CoA-carboxylase ligase [Haloterrigena turkmenica DSM
           5511]
          Length = 312

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 116/234 (49%), Gaps = 18/234 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  ++ +TI STN+   + A +G   ++ ++A  QT  RGR D +W S  G ++ S++  
Sbjct: 75  FSVDYHETIGSTNNRARELAANG-AADVAVLADEQTGSRGRLDREWSSPSGGVWVSIVSR 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF------QRKIAGILIE 127
            +I+     L + A AVA+          G D +IKWPND++V        RK+AGIL E
Sbjct: 134 PTITPAQAPLYTLAAAVAIARAAREA---GVDARIKWPNDVVVPVGDDGDYRKLAGILTE 190

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDT-PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                + +  ++ GIG+N  +  VD  P   TS++ E G +D +    L  Q +    D 
Sbjct: 191 MEGETDRVDWIIPGIGVNA-NIDVDALPEGATSIRDEAGDVDRR----LFVQRLLEEFDD 245

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++ D   E ++  WR  A  +G  + +    G ++G  V + D G L++E   G
Sbjct: 246 YRNDL--ETVIPAWRDLALTLGQRVRVDRPAGEVVGEAVDITDSGALVIETDDG 297


>gi|169797014|ref|YP_001714807.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           baumannii AYE]
 gi|213156582|ref|YP_002318243.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           AB0057]
 gi|215484474|ref|YP_002326709.1| Bifunctional protein birA [Acinetobacter baumannii AB307-0294]
 gi|260555694|ref|ZP_05827914.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           ATCC 19606]
 gi|301347729|ref|ZP_07228470.1| Bifunctional protein birA [Acinetobacter baumannii AB056]
 gi|301512477|ref|ZP_07237714.1| Bifunctional protein birA [Acinetobacter baumannii AB058]
 gi|301594391|ref|ZP_07239399.1| Bifunctional protein birA [Acinetobacter baumannii AB059]
 gi|332852102|ref|ZP_08433929.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6013150]
 gi|332867500|ref|ZP_08437653.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6013113]
 gi|169149941|emb|CAM87835.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           baumannii AYE]
 gi|213055742|gb|ACJ40644.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           AB0057]
 gi|213988130|gb|ACJ58429.1| Bifunctional protein birA [Acinetobacter baumannii AB307-0294]
 gi|260410605|gb|EEX03903.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           ATCC 19606]
 gi|332729474|gb|EGJ60813.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6013150]
 gi|332733917|gb|EGJ65062.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6013113]
          Length = 250

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 116/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I    P+   +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---IPQLQPL--SLQVKWPNDLYSTQGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRFVG+ + G +++E  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLVYGRFVGISNEGAVIIETPE--PQQFYQGRL 244


>gi|239501246|ref|ZP_04660556.1| Bifunctional protein birA [Acinetobacter baumannii AB900]
          Length = 250

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 116/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I    P+   +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---IPQLQPL--SLQVKWPNDLYSTQGKWGGILVEPLSPHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRF+G+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLVHGRFIGISNEGAVILETPE--PQQFYQGRL 244


>gi|194016904|ref|ZP_03055517.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
 gi|194011510|gb|EDW21079.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
          Length = 327

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 118/247 (47%), Gaps = 22/247 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL 72
           F+ E   T    +D   + A  G L    +V+  QT G+GR    W S  G  ++ SL+L
Sbjct: 88  FQKEVASTQLIAHDLVNEGAPHGTL----VVSDHQTNGKGRLQRMWHSPNGTGIWMSLIL 143

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       ++   +VA+   IA     G    IKWPNDIL+  +K+ GIL E     
Sbjct: 144 RPEIPLHKAPQMTLLASVAIAEAIAEQ--TGLSPSIKWPNDILLNGKKVVGILTELKAEA 201

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQDV-----ARV 183
           + + AV++G G+NV     D P  +    TSL+ E   ++ K   + L Q +      R 
Sbjct: 202 DQVHAVIIGPGINVNQTADDFPDELKDVATSLRME---LNEKVDRAALIQQIMSTFEKRY 258

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            D  K+  G   I  LW  FA  IG  I  +   G   G+ +G+++ G LLLE ++G ++
Sbjct: 259 ADYMKQ--GFAPIKQLWESFAMTIGQHIVARTVNGQYTGKALGINEEGVLLLETEEG-IQ 315

Query: 244 QIFTGDI 250
           +I++ DI
Sbjct: 316 KIYSADI 322


>gi|78223194|ref|YP_384941.1| biotin--acetyl-CoA-carboxylase ligase [Geobacter metallireducens
           GS-15]
 gi|78194449|gb|ABB32216.1| Biotin--acetyl-CoA-carboxylase ligase [Geobacter metallireducens
           GS-15]
          Length = 338

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 106/238 (44%), Gaps = 7/238 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           F     STN    + A  G +    ++A  Q  GRGR   +W S  G NLY S++L   I
Sbjct: 99  FVGETDSTNTLAYRLAEDGAVEGTVVIADAQNRGRGRLGRQWESPAGVNLYCSIILRPPI 158

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+F  AVA+   I  +   G    IKWPND+LV   K+AG+L E       + 
Sbjct: 159 MPLHAPQLTFLSAVAVAEAIERS--AGLAPVIKWPNDVLVNGFKVAGMLNEMSAETERID 216

Query: 137 AVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            +V+GIG+N+       P D  +P +SL  E G    +  F+    +   V     +  G
Sbjct: 217 FLVLGIGVNINMQRDQFPTDLRHPASSLAIEAGHEVSRLSFARALLESLDVHYSQYRSEG 276

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +   W   +  +G  + +  + G + G   G+D+ G LLL    G + ++  GD+
Sbjct: 277 YAPLRQAWLGRSAVMGRRVRVSGNQGDMTGTVEGIDEIGALLLRTAHGTLERVLAGDV 334


>gi|258542709|ref|YP_003188142.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633787|dbj|BAH99762.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636846|dbj|BAI02815.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639899|dbj|BAI05861.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642955|dbj|BAI08910.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646010|dbj|BAI11958.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649063|dbj|BAI15004.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652050|dbj|BAI17984.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655107|dbj|BAI21034.1| biotin--acetyl-CoA-carboxylase ligase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 247

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 118/248 (47%), Gaps = 15/248 (6%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
            P  +R E F  + ST+D C+++A  G    L ++A  QT GRG R  +W+    +L  S
Sbjct: 4   QPSPWRLECFAELGSTSDFCLEQAREGADSGLAVLAYRQTQGRGSRGRQWVDAGQSLALS 63

Query: 70  LLL-IDSISKDSLTLLSFAIAVAMRSVIASTLP-VGTDVKIKWPNDILVFQRKIAGILIE 127
           +LL      +D L    FA ++A    +   +P V   + IKWPND+L+  +K  GILIE
Sbjct: 64  VLLDAQQAGQDMLGGWPFAASLAFYDGLLRAVPAVAGHLMIKWPNDLLLDGQKAGGILIE 123

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
               +     +V+G G N+   P    T      L + G     KD+   +   +     
Sbjct: 124 REGGR-----LVIGFGANLTQVPSQQQTRRFAACLGQYGAVPPAKDVAQCILSSLTHWCT 178

Query: 186 LWKKDTGREEIMNLW--RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           +W+++ G   +   W  R    G   +++ + +Y    G+F G+ + G LLL+ + G ++
Sbjct: 179 VWQQN-GFGALRQAWLERAHPVGTPLVVSSRTTYEQ--GKFAGLAEDGRLLLDTETG-MK 234

Query: 244 QIFTGDIF 251
            I TGDI 
Sbjct: 235 TITTGDIL 242


>gi|298506050|gb|ADI84773.1| biotin operon repressor and biotin--acetyl-CoA carboxylase ligase
           [Geobacter sulfurreducens KN400]
          Length = 338

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 114/242 (47%), Gaps = 16/242 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL---I 73
           F +T+S TN      A  G      ++A  QT G+GR   +W S  G N+Y S++L   I
Sbjct: 100 FRETVS-TNTVASHLAAEGAAEGTVVLADAQTGGKGRLGRRWESPPGVNVYCSIILRPPI 158

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +    LTLLS   AVA    I  T   G    IKWPNDILV   K+AG+L E      
Sbjct: 159 SPLHSPQLTLLS---AVATAEAIERT--SGLVPAIKWPNDILVNGFKVAGMLNELSAETE 213

Query: 134 GLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWK 188
            ++ +V+GIG+N+       P D  YP +SL  E G  ++       L + + R+ D + 
Sbjct: 214 RVEYLVLGIGVNINMERDQFPGDLRYPASSLALEAGRTVERIPFVRALLESLDRLYDEYL 273

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   + + W   +  +G  + +    G + G   G+D+ G LL+    G + ++  G
Sbjct: 274 LK-GFSPVRDAWLARSAVMGRRVKVDGGAGILAGTVEGIDEIGALLVRTAGGSLERVLAG 332

Query: 249 DI 250
           D+
Sbjct: 333 DV 334


>gi|148545722|ref|YP_001265824.1| biotin--protein ligase [Pseudomonas putida F1]
 gi|148509780|gb|ABQ76640.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas putida F1]
          Length = 319

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 113/225 (50%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 80  IHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDG 139

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + +A MR++ A  +    DV +KWPND+LV  +KI GIL+E +     +
Sbjct: 140 GMRQLEGLSLVVGLAVMRTLQAFGVK---DVGLKWPNDVLVRGQKITGILLELVGDPADV 196

Query: 136 QAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+GIG+NV    +  VD  +  TS++RE G  ID   + +LL Q +   L   ++  
Sbjct: 197 CHVVLGIGINVNMQVNEQVDQQW--TSMRREVGAAIDRNHLVALLSQQLQHELARHRR-Y 253

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           G       W       G  +++      I G  +GVD  G L LE
Sbjct: 254 GFAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE 298


>gi|330891947|gb|EGH24608.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. mori str.
           301020]
          Length = 310

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 112/215 (52%), Gaps = 14/215 (6%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + +++C  P S+    +DTI STN E  +    G    L +VA  QT+GRGRR  KW+S 
Sbjct: 96  AGIAQCGFPASWSVRTYDTIDSTNAEATRLIAHGAPMPLLVVAEQQTSGRGRRGRKWVSP 155

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 156 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVQGAG--LKWPNDVLVGRQKI 213

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCI-DLKDIFSLLF 177
           AGIL+E +     +  V++GIG+NV       VD  +  TS++ E G + D   I +L+ 
Sbjct: 214 AGILLELVGDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSIRLETGSLADRNRIAALIS 271

Query: 178 QDVARVLDLWKKD-----TGREEIMNLWRCFACGI 207
             +  +L + +K+         E+ +LW+   C I
Sbjct: 272 SQLESLLAVHRKEGFVAFQDEWELGHLWQGGCCQI 306


>gi|39997033|ref|NP_952984.1| birA biofunctional protein [Geobacter sulfurreducens PCA]
 gi|39983923|gb|AAR35311.1| birA biofunctional protein, putative [Geobacter sulfurreducens PCA]
          Length = 323

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 114/242 (47%), Gaps = 16/242 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL---I 73
           F +T+S TN      A  G      ++A  QT G+GR   +W S  G N+Y S++L   I
Sbjct: 85  FRETVS-TNTVASHLAAEGAAEGTVVLADAQTGGKGRLGRRWESPPGVNVYCSIILRPPI 143

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +    LTLLS   AVA    I  T   G    IKWPNDILV   K+AG+L E      
Sbjct: 144 SPLHSPQLTLLS---AVATAEAIERT--SGLVPAIKWPNDILVNGFKVAGMLNELSAETE 198

Query: 134 GLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWK 188
            ++ +V+GIG+N+       P D  YP +SL  E G  ++       L + + R+ D + 
Sbjct: 199 RVEYLVLGIGVNINMERDQFPGDLRYPASSLALEAGRTVERIPFVRALLESLDRLYDEYL 258

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   + + W   +  +G  + +    G + G   G+D+ G LL+    G + ++  G
Sbjct: 259 LK-GFSPVRDAWLARSAVMGRRVKVDGGAGILAGTVEGIDEIGALLVRTAGGSLERVLAG 317

Query: 249 DI 250
           D+
Sbjct: 318 DV 319


>gi|254488864|ref|ZP_05102069.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseobacter sp. GAI101]
 gi|214045733|gb|EEB86371.1| biotin-(acetyl-CoA-carboxylase) ligase [Roseobacter sp. GAI101]
          Length = 215

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 98/219 (44%), Gaps = 13/219 (5%)

Query: 39  GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAS 98
           G +WI+A  QTA RGRR   W + KGN  A+L++  + +     L SF  ++A+R     
Sbjct: 3   GPVWILADEQTAARGRRGRSWATPKGNFAATLMMRRAEAPGVAALRSFIASLALRRAFVR 62

Query: 99  TLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP------VD 152
                    +KWPND+L+   K+AGIL+ET         + +GIG+N+ H P        
Sbjct: 63  VTGDDGAFALKWPNDVLLNGGKVAGILLETTG-----DHLAIGIGVNLAHAPGADQVEAG 117

Query: 153 TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLIT 212
              PV+ +   G  +        L  + A  L+   +  G   I   W   A  +G+ I 
Sbjct: 118 ALRPVSLVGETGISVSTSAFLDALASEYA-PLEAQFQTFGFAPIRTAWLVHAARLGEEIV 176

Query: 213 IKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            +       G F  VD+ G L+L   KG V  I   D+F
Sbjct: 177 ARTMREETRGIFEDVDESGSLILRTPKGRV-PITAADVF 214


>gi|206889577|ref|YP_002249406.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206890257|ref|YP_002249455.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741515|gb|ACI20572.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742195|gb|ACI21252.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 266

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 111/238 (46%), Gaps = 7/238 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            +D + STN +  +    G      +VA  Q  G+GR   KWIS  G NLY S+ +  +I
Sbjct: 25  VYDEVESTNSKANELLKQGYPSGTVVVADRQIKGKGRLGRKWISPSGKNLYMSIGIKPTI 84

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                TLL+    VA  + +     V   V IKWPND+LV  +K+ GIL E       ++
Sbjct: 85  PPKYATLLTLTSVVACTTALRRYADV--PVLIKWPNDMLVDDKKVGGILTEMKIEGEKIK 142

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIF-SLLFQDVARVLDLWKK---DTG 192
           + VVGIG+NV     D P  +  +         +D   SLL  ++ +  D W +      
Sbjct: 143 SAVVGIGINVNMTEEDMPEEIKEIASSLKICKGEDFSRSLLAVEIIKEFDKWYQLLEKRQ 202

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           R+ I++ W   +  IG  + I LS   ++     +D+ G L+++   G   +I  GD+
Sbjct: 203 RKTIIDRWMQLSGTIGRQVKIVLSDRELIATAEAIDEEGRLIVKLTDGTYEKICAGDV 260


>gi|26987178|ref|NP_742603.1| biotin--protein ligase [Pseudomonas putida KT2440]
 gi|24981814|gb|AAN66067.1|AE016236_1 birA bifunctional protein [Pseudomonas putida KT2440]
          Length = 319

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 113/225 (50%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 80  IHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDG 139

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + +A MR++ A  +    DV +KWPND+LV  +KI GIL+E +     +
Sbjct: 140 GMRQLEGLSLVVGLAVMRTLQAFGVK---DVGLKWPNDVLVRGQKITGILLELVGDPADV 196

Query: 136 QAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+GIG+NV    +  VD  +  TS++RE G  ID   + +LL Q +   L   ++  
Sbjct: 197 CHVVLGIGINVNMQVNEQVDQQW--TSMRREVGAAIDRNHLVALLSQQLQHELARHRR-Y 253

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           G       W       G  +++      I G  +GVD  G L LE
Sbjct: 254 GFAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE 298


>gi|326387447|ref|ZP_08209056.1| biotin--acetyl-CoA-carboxylase ligase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208103|gb|EGD58911.1| biotin--acetyl-CoA-carboxylase ligase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 251

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 110/247 (44%), Gaps = 13/247 (5%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDL---GNLWIVASCQTAGRGRRDNKWISDKGN 65
           ++P +   E    I+STN E + R   GDL   GN W+VA  Q+AGRGR    W    GN
Sbjct: 8   RDPLTGSLETVSQIASTNTELLARVGRGDLPFEGN-WLVADRQSAGRGRAGRVWNDGFGN 66

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
              S +            LS    VA+   +     + +   +KWPND+LV   K+AGIL
Sbjct: 67  FMGSTVAWLRAGDPPAPTLSLVAGVAVIRALHDVCGLLSGAILKWPNDVLVRGAKLAGIL 126

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR-VL 184
           +E          +VVGIG+N+   P        SL   G  +  +D F+       R  L
Sbjct: 127 LERQG-----DCIVVGIGVNLVLAPEVEGRETVSLASLGHAVS-RDSFAFALSAQWRSAL 180

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIK-LSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           + W +      +   W  +A   G L++++  S G+I+G F G+   G  LL    G  R
Sbjct: 181 ECWHRGE-WPSLREDWLAYAHRKGTLLSVRDPSGGAIMGGFAGLTPDGAALLHLADGQRR 239

Query: 244 QIFTGDI 250
            I  GDI
Sbjct: 240 AIHAGDI 246


>gi|302337932|ref|YP_003803138.1| biotin/acetyl-CoA-carboxylase ligase [Spirochaeta smaragdinae DSM
           11293]
 gi|301635117|gb|ADK80544.1| biotin/acetyl-CoA-carboxylase ligase [Spirochaeta smaragdinae DSM
           11293]
          Length = 312

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 121/249 (48%), Gaps = 28/249 (11%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           + F+ E+ +   ST ++   R     +  +++ A  Q++GRGR++ +W S +G LYAS+L
Sbjct: 74  FPFKVEYREETGSTMEDA--RKAEERIATIFL-AGKQSSGRGRKNRRWQSPEGGLYASVL 130

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
                   +       +A ++ +V+  T  +    +I WPNDI+V +RKIAGI+ E    
Sbjct: 131 FFPGSEYGAAFFSPMKLAASVVNVLRKTYHI--PARISWPNDIVVGERKIAGIITELHGK 188

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC---IDLK-------DIFSLLFQDVA 181
            + +   ++GIG+N++        PV  + R G     +D K       D+   +F +  
Sbjct: 189 YDLVDRQIIGIGINLQ--------PVPGVPRSGALQEFVDRKKKLPSSADLARGIFFEFH 240

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKG 240
             ++ W      ++ +  W+  +  IG  + I+ S+G+ L GR   +   G LL+E  +G
Sbjct: 241 SRMNRWSP----QQTIAAWKAASATIGRRVRIEKSWGTALTGRAKDIGSDGSLLIESDEG 296

Query: 241 CVRQIFTGD 249
            V  +  GD
Sbjct: 297 YVESVREGD 305


>gi|222055477|ref|YP_002537839.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. FRC-32]
 gi|221564766|gb|ACM20738.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. FRC-32]
          Length = 336

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 117/240 (48%), Gaps = 14/240 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
            +   STN+   + A  G      ++A  Q+ G+GR    W S KG NLY S++L  S+ 
Sbjct: 100 LEETDSTNNVTFRLAEEGTAEGTVVIADAQSRGKGRLGRSWASPKGVNLYCSVVLRPSMP 159

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVK--IKWPNDILVFQRKIAGILIETLNLKNGL 135
             + + L+F   VA    +A  + + T +K  IKWPNDIL+  RKIAG+L E       +
Sbjct: 160 PVAASQLTFLSVVA----VARAIELSTSLKAWIKWPNDILINGRKIAGLLNEMSAETEKV 215

Query: 136 QAVVVGIGLNV----KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
             VV+GIG+N+    +  P D  +P +SL  E G  +D       L +++  + D++ + 
Sbjct: 216 NFVVLGIGININMRQEQFPTDLRHPASSLYIESGAELDRNRFIRTLLKELDDLYDVYLQ- 274

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   +   W   +   G    I     ++ G   G+DD G LLL +  G   +I +GD+
Sbjct: 275 RGYGPVREEWLSRSQLYGRKARIDCQDRTMTGIIRGIDDMGALLL-DLDGREERILSGDV 333


>gi|90020562|ref|YP_526389.1| biotin--(acetyl-CoA-carboxylase) ligase [Saccharophagus degradans
           2-40]
 gi|89950162|gb|ABD80177.1| Biotin--acetyl-CoA-carboxylase ligase [Saccharophagus degradans
           2-40]
          Length = 332

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 114/225 (50%), Gaps = 11/225 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWI-VASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           +  + STN+  ++R  +G+ G+ +  +A  Q+AGRGRR  +W S  G N+Y SL      
Sbjct: 90  YSQLDSTNERVLQRIRAGESGHGYACLAELQSAGRGRRGRQWQSPYGRNVYLSLGWRFER 149

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              ++  LS AI VA+   +     +    ++KWPND+L+  RK+ GIL+E     +G  
Sbjct: 150 GVAAMEGLSLAIGVAVCRALDKNFSL--KAELKWPNDVLLAGRKLGGILLEVAGDLSGEC 207

Query: 137 AVVVGIGLNVKHC-----PVDTPY-PVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
            VV G+GLNV         +D P+  V S     G ID   + + L  +++ VL  +++ 
Sbjct: 208 YVVAGVGLNVSMPSAAAQAIDQPWIDVASCIESIGLIDRNQLAAALLFELSCVLSDYEQ- 266

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
            G     N W+     IG  + +     +++G  VGVDD G LLL
Sbjct: 267 RGFAAYKNEWKMRCPHIGASVQLSSHSNTLVGEMVGVDDTGALLL 311


>gi|299771372|ref|YP_003733398.1| Bifunctional protein birA [Acinetobacter sp. DR1]
 gi|298701460|gb|ADI92025.1| Bifunctional protein birA [Acinetobacter sp. DR1]
          Length = 250

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     + S      ++++KWPND+     K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQIPQLQS-----LNLQVKWPNDLYSTHGKWGGILVEPLSQHQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       D G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----DHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLVHGRFVGISNEGAVILETPE--PQQFYQGRL 244


>gi|167768158|ref|ZP_02440211.1| hypothetical protein CLOSS21_02714 [Clostridium sp. SS2/1]
 gi|317499621|ref|ZP_07957883.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167709682|gb|EDS20261.1| hypothetical protein CLOSS21_02714 [Clostridium sp. SS2/1]
 gi|291560184|emb|CBL38984.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region
           [butyrate-producing bacterium SSC/2]
 gi|316893096|gb|EFV15316.1| biotin-[acetyl-CoA-carboxylase] ligase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 326

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 118/238 (49%), Gaps = 10/238 (4%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
           ++T+ STN E  + A +G       +   QT G+GRR   W+++ G  +  S LL   I 
Sbjct: 84  YETMDSTNLEIRRLAEAGAGHGTVAITEEQTMGKGRRGRSWLAEAGAGIAMSFLLKPQIE 143

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
             + ++L+   A+A+   I  T   G   KIKWPNDI+V  +KI GIL E     + +  
Sbjct: 144 AQNSSMLTLVTALAVNEAICET--TGIRAKIKWPNDIIVNGKKICGILTEMSLQMDEINY 201

Query: 138 VVVGIGLNVK--HCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           +VVG+G+NV   H P D     TSLQ EGG  I    + + + +   +  D++ K     
Sbjct: 202 IVVGLGINVNIDHFPEDLSDKATSLQIEGGRKIKRAPLAAKVLECFEKYYDMFLKTEDLS 261

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFV--GVDDFGYLLLEEKKGCVRQIFTGDI 250
            + + +            IK+  GS    F+  G++  G LL+E++ G V ++ +G++
Sbjct: 262 MLQDEYNKLLVHTDQ--KIKVVRGSKEEIFLSRGINHRGELLVEDEDGKVSEVSSGEV 317


>gi|58696976|ref|ZP_00372461.1| biotin-acetyl-CoA-carboxylase ligase [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536782|gb|EAL60022.1| biotin-acetyl-CoA-carboxylase ligase [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 290

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 125/291 (42%), Gaps = 58/291 (19%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  F    +  +SSTN E +     G      I+A  QT GRGR    WIS +GN YASL
Sbjct: 3   PEGFHIHHYKEVSSTNKEALDLIDKGISNETAIIADKQTEGRGRTGKSWISPEGNFYASL 62

Query: 71  L-------------------------------------------------LIDSISKDS- 80
           +                                                 L++ I+  S 
Sbjct: 63  VINLFNDYLNESQLSVSFQRVTLESRKKEEWIPVSSTGMTSEGIGMTEKGLVNKIADVSK 122

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           LT L+F  A+ + + I S +  G +++ KWPND+L+  +KI+GIL+E  +  N L   +V
Sbjct: 123 LTELTFVTALTVGNTILSFIN-GLNLQYKWPNDVLIDGKKISGILLEKRSNSNWL---IV 178

Query: 141 GIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLW 200
           GIG+NV H P+      T +   G  +   D+   L  +  ++   W  D G   I  +W
Sbjct: 179 GIGINVSHAPLP---GTTCISNYGESVSNIDLLKELIINFNKLKKQWLFD-GFYAIREMW 234

Query: 201 RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              A  + + I++KL+     G F  +D  G L+L++K   +     G++F
Sbjct: 235 LKKAFKMNEQISVKLADKLYEGIFADIDKSGKLVLQQKDESLIYFDAGELF 285


>gi|95930661|ref|ZP_01313395.1| Biotin--acetyl-CoA-carboxylase ligase [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133313|gb|EAT14978.1| Biotin--acetyl-CoA-carboxylase ligase [Desulfuromonas acetoxidans
           DSM 684]
          Length = 328

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 116/243 (47%), Gaps = 9/243 (3%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL 72
            R E+F    STN   M+ A  G      ++A CQ  GRGR   +W S  G NLY S++L
Sbjct: 85  HRVEYFAETDSTNLRAMELAEQGAQEGTVVIADCQNGGRGRMGRRWSSPAGVNLYTSIIL 144

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              ++      L+F  AVA      +    G +V++KWPNDILV   KIAG+L E     
Sbjct: 145 RPDMAPIQAAQLTFLSAVATARAFEAV--AGIEVQVKWPNDILVNGCKIAGLLNELSAET 202

Query: 133 NGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSL-LFQDVARVLDLW 187
            G+  VV+GIG N+    +  P D   P TS+  E G    +  F+  L++ + R+  L+
Sbjct: 203 EGVHHVVLGIGANLNMSREQFPDDLRRPATSVLLETGQTVSRVAFAQELYRQLDRLYPLY 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           ++  G   I   W       G  + +        G   G+ D G LLL+ ++G  + I+ 
Sbjct: 263 QQQ-GFVPIRLAWEALFYLQGHKVEVDCGADVFTGMVAGLADDGALLLDLEQGGQQVIYA 321

Query: 248 GDI 250
           GD+
Sbjct: 322 GDV 324


>gi|322419426|ref|YP_004198649.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M18]
 gi|320125813|gb|ADW13373.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M18]
          Length = 327

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 113/234 (48%), Gaps = 10/234 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLT 82
           STN    K A  G      ++A  QTAG+GR    W+S  G NLY S++L  +I+  +  
Sbjct: 94  STNQVAFKMAEEGAAEGTVVIADAQTAGKGRLGRIWLSPAGVNLYCSVVLRPAIAPMAAC 153

Query: 83  LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
            L+F   VA+   I     +    +IKWPNDIL+  +K+AG+L E       +  VV+GI
Sbjct: 154 QLTFLSVVAVARAIQGCTTL--QPQIKWPNDILINGKKVAGLLNEMNAETEKVNFVVLGI 211

Query: 143 G--LNVKHCPVDTP---YPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           G  LN+K   +      +P TSL  EGG  +D       L  ++ R+ D++ ++ G   +
Sbjct: 212 GVNLNLKMSSISESLLRHPATSLLEEGGVEVDRLAFTRSLLIELDRLYDVFLRE-GEGPV 270

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              W   +   G  + +        G   GVD FG LL++   G V  + +GD+
Sbjct: 271 RAEWLERSAIQGRSVKVSQGEREFTGVVQGVDSFGALLVQLSDGKVETVLSGDV 324


>gi|225630637|ref|YP_002727428.1| biotin-[acetyl-coa-carboxylase] ligase, putative [Wolbachia sp.
           wRi]
 gi|225592618|gb|ACN95637.1| biotin-[acetyl-coa-carboxylase] ligase, putative [Wolbachia sp.
           wRi]
          Length = 290

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 125/291 (42%), Gaps = 58/291 (19%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P  F    +  +SSTN E +     G      I+A  QT GRGR    WIS +GN YASL
Sbjct: 3   PEGFHIHHYKEVSSTNKEALDLIDKGISNETAIIADKQTEGRGRTGKSWISPEGNFYASL 62

Query: 71  L-------------------------------------------------LIDSISKDS- 80
           +                                                 L++ I+  S 
Sbjct: 63  VINLFNDYLNESQLSVSFQRVTLESRKKEEWIPVSSTGMTSEGIGMTEKGLVNKIADVSK 122

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           LT L+F  A+ + + I S +  G +++ KWPND+L+  +KI+GIL+E  +  N L   +V
Sbjct: 123 LTELTFVTALTVGNTILSFIN-GLNLQYKWPNDVLIDGKKISGILLEKRSNSNWL---IV 178

Query: 141 GIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLW 200
           GIG+NV H P+      T +   G  +   D+   L  +  ++   W  D G   I  +W
Sbjct: 179 GIGINVSHAPLP---GTTCISNYGESVSNIDLLKELIINFNKLRKQWLFD-GFYAIREMW 234

Query: 201 RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              A  + + I++KL+     G F  +D  G L+L++K   +     G++F
Sbjct: 235 LKKAFKMNEQISVKLADKLYEGIFADIDKSGKLVLQQKDESLIYFDAGELF 285


>gi|188996724|ref|YP_001930975.1| biotin/acetyl-CoA-carboxylase ligase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931791|gb|ACD66421.1| biotin/acetyl-CoA-carboxylase ligase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 318

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 130/246 (52%), Gaps = 23/246 (9%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
           Y +F+ I STN +  KR    D G + I A  QTAG+GR++ KW+S KG  LY +++L  
Sbjct: 80  YLYFEEIDSTNLQA-KRENYED-GTV-IFAESQTAGKGRKNRKWVSHKGLGLYFTIVLKP 136

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I  + L+  S     ++  V+ +   V  ++KIKWPNDI +  +KIAG LIE+    N 
Sbjct: 137 GIEVNYLSHFSLLFNYSVFKVLKNY--VNGEIKIKWPNDIYLNGKKIAGFLIESSIENNS 194

Query: 135 LQAVVVGIGLNV----KHCPVDTPYPVTSLQ-REGGCIDLKDIFSLLFQDVAR-VLDLWK 188
           +  ++VG+G+NV    K    D     TSL+  EG   + K+IF  + Q + +  L   K
Sbjct: 195 ISKLIVGVGINVNQSIKDFEEDIKEVATSLKIEEGKTFNRKEIFLDILQQIEKDYLKFIK 254

Query: 189 K---DTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQ 244
           +   D  + E   LW      I   + I      IL G+ +G+++ G L+L+  +G +R 
Sbjct: 255 EKYLDIKKIEENLLW------INQNVMILEDGKPILSGKLIGLNEDGSLMLKTDEG-LRF 307

Query: 245 IFTGDI 250
           ++ GD+
Sbjct: 308 VYVGDL 313


>gi|56552764|ref|YP_163603.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241762496|ref|ZP_04760573.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|56544338|gb|AAV90492.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241372998|gb|EER62665.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 267

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 118/245 (48%), Gaps = 14/245 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P   R    +   STN +    A  G     W++A+ QT GRGR+  KW   +GNL  S 
Sbjct: 29  PEHSRIRVVEETESTNSDMRLLADQGLPEGFWLLANKQTKGRGRQGRKWQLPEGNLAISG 88

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETL 129
           L+    +  SL+ L+F  A+A+    A++L V  D + +KWPND+++   K AGILIE  
Sbjct: 89  LVRIRETDTSLSGLAFVAALALYQ--AASLFVKADWLSLKWPNDLMLKGAKCAGILIE-- 144

Query: 130 NLKNGLQ-AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS-LLFQDVARVLDLW 187
               G Q A++ G G+N+K   V    P  +L      I  K  FS  L    A  LD+W
Sbjct: 145 ----GHQDAMIFGFGVNLKQA-VKLDRPTAALADFADKIPEKKAFSEALVASFADWLDIW 199

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIF 246
           +K  G E I + W   A  I   +TI    G +L G F G+D  G L L  +   +    
Sbjct: 200 RKQ-GIEIIHDNWLKRAHNIHTPLTIHKENGELLSGYFAGLDPDGALKLRLQNDRICLFH 258

Query: 247 TGDIF 251
           +GD+ 
Sbjct: 259 SGDVL 263


>gi|320355028|ref|YP_004196367.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobulbus propionicus DSM
           2032]
 gi|320123530|gb|ADW19076.1| biotin/acetyl-CoA-carboxylase ligase [Desulfobulbus propionicus DSM
           2032]
          Length = 270

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 95/191 (49%), Gaps = 11/191 (5%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +PY+    + D I STN    + AL G      + A  QT+GRG+    ++S KG LY S
Sbjct: 6   SPYTMLI-YLDHIDSTNRLAKELALEGKPSGTVVCAERQTSGRGQHGRNFVSPKGGLYFS 64

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           LLL+  IS + L L++ A  +A R+ +     +     IKWPND+ V  RKIAGIL E +
Sbjct: 65  LLLMPDISPERLPLVTLATGLACRACLCERFSL--QAHIKWPNDLYVHGRKIAGILCERV 122

Query: 130 ---NLKNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCI--DLKDIFSLLFQDVA 181
              N  +    V++G+GLNV     D P    P+ +   E   I  DLK +   + + + 
Sbjct: 123 LPNNSGSPRPMVIIGVGLNVNSALADFPEELQPLVTSVYEQASIRTDLKMLLPAVVEKII 182

Query: 182 RVLDLWKKDTG 192
             +   + D+ 
Sbjct: 183 ATIHRLQSDSA 193


>gi|14520365|ref|NP_125840.1| biotin--protein ligase [Pyrococcus abyssi GE5]
 gi|5457580|emb|CAB49071.1| Biotin-(acetyl-coA carboxylase) ligase [Pyrococcus abyssi GE5]
          Length = 237

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 123/236 (52%), Gaps = 21/236 (8%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +F  ++STND    +A + + G + IVA  Q  G GR + KW S +G L+ S++L   +S
Sbjct: 15  YFQEVASTNDYA--KAENLEEGTV-IVADRQIKGHGRLERKWESPEGGLWMSVVLTPRVS 71

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
           ++ L  + F  A+A   V+ +      D +IKWPND+LV  RK+AG+L+E        + 
Sbjct: 72  QEDLPKIVFLGALA---VVETLREFSIDARIKWPNDVLVNYRKVAGVLVEAKG-----EK 123

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           V++GIGLNV +     P   TS+++E G  I + ++F  L + +  +   + +  G+   
Sbjct: 124 VILGIGLNVNN---KVPDGATSMKQELGSEIPMLNVFKTLVKTLDSLYLKFLESPGK--- 177

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVG--VDDFGYLLLEEKKGCVRQIFTGDI 250
             L R     I  +    LS G +    +   VD+FG L++    G V++I  GD+
Sbjct: 178 -ILERAKRSMILGVRVKVLSDGEVEAEGIAEDVDEFGRLIVRLDDGRVKKILYGDV 232


>gi|184157073|ref|YP_001845412.1| biotin-(acetyl-CoA carboxylase) ligase [Acinetobacter baumannii
           ACICU]
 gi|332872649|ref|ZP_08440617.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6014059]
 gi|183208667|gb|ACC56065.1| Biotin-(acetyl-CoA carboxylase) ligase [Acinetobacter baumannii
           ACICU]
 gi|322506972|gb|ADX02426.1| Putative biotin-(acetyl-CoA-carboxylase) synthetase [Acinetobacter
           baumannii 1656-2]
 gi|323516839|gb|ADX91220.1| biotin-(acetyl-CoA carboxylase) ligase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332739178|gb|EGJ70037.1| biotin--[acetyl-CoA-carboxylase] ligase [Acinetobacter baumannii
           6014059]
          Length = 250

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 116/235 (49%), Gaps = 22/235 (9%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           T +STND+  + A  G    L + ++ QT GRG+   +WIS +GN+Y S L+      D 
Sbjct: 27  TTTSTNDDIREIAQKGITTGL-VCSAQQTQGRGQHQRQWISPEGNIYLSTLVQTRTPLDG 85

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L  A+ +     I    P+   +++KWPND+   Q K  GIL+E L+        +V
Sbjct: 86  RLALEVALNILQ---IPQLQPL--SLQVKWPNDLYSTQGKWGGILVEPLSQYQA----IV 136

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREG----GCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           G+G+N+K  PV D+  P+TSL+  G      ++L     +  Q+ AR       + G   
Sbjct: 137 GVGINLKTPPVTDSDQPITSLEDLGLEQMSRLELISELYVAIQNAARWF-----EHGCYN 191

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   +   A  +  L+  + S G + GRFVG+ + G ++LE  +   +Q + G +
Sbjct: 192 LAGRFNHHAAWLNQLVQFEHSQGLVYGRFVGISNEGAVILETPE--PQQFYQGRL 244


>gi|260753506|ref|YP_003226399.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552869|gb|ACV75815.1| biotin/acetyl-CoA-carboxylase ligase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 267

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 118/245 (48%), Gaps = 14/245 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P   R    +   STN +    A  G     W++A+ QT GRGR+  KW   +GNL  S 
Sbjct: 29  PEHSRIRAVEETESTNSDMRLLADQGLPEGFWLLANKQTKGRGRQGRKWQLPEGNLAISG 88

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETL 129
           L+    +  SL+ L+F  A+A+    A++L V  D + +KWPND+++   K AGILIE  
Sbjct: 89  LVRIRKTDTSLSGLAFVAALALYQ--AASLFVKADWLSLKWPNDLMLKGAKCAGILIE-- 144

Query: 130 NLKNGLQ-AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS-LLFQDVARVLDLW 187
               G Q A++ G G+N+K   V    P  +L      I  K  FS  L    A  LD+W
Sbjct: 145 ----GHQDAMIFGFGVNLKQA-VKLDRPTAALADFADKIPEKKAFSEALVASFADWLDIW 199

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIF 246
           +K  G E I + W   A  I   +TI    G +L G F G+D  G L L  +   +    
Sbjct: 200 RKQ-GIEIIHDNWLKRAHNIHTPLTIHKENGELLSGYFAGLDPDGALKLRLQNDRICLFH 258

Query: 247 TGDIF 251
           +GD+ 
Sbjct: 259 SGDVL 263


>gi|332158325|ref|YP_004423604.1| biotin--protein ligase [Pyrococcus sp. NA2]
 gi|331033788|gb|AEC51600.1| biotin--protein ligase [Pyrococcus sp. NA2]
          Length = 241

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 117/234 (50%), Gaps = 22/234 (9%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           +   ++STN+  +   L+       IVA  Q  GRGR   KW S +G L+ S++L   +S
Sbjct: 21  YLREVTSTNEYAL---LNNFPEGTVIVADRQIKGRGRLGRKWESPEGGLWMSVVLKPRVS 77

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
            + L  L F  A+   SVI        + +IKWPND+LV  RKI+GIL+E          
Sbjct: 78  ANDLPKLVFLGAL---SVIDVLKEFAIEGRIKWPNDVLVNYRKISGILVEGRG-----DN 129

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
            V+GIGLNV +   + P   TS++ E G  + L DIF  L   +  +  L+ K   R  I
Sbjct: 130 FVLGIGLNVNN---EVPEGATSIKAELGTEVSLTDIFKKLVLSLDELYSLFLKSPSR--I 184

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           + L R        ++ +++  G+I G    VDDFG L++    G  R++  GD+
Sbjct: 185 LELARENM-----ILGVRVRVGNIEGIAEDVDDFGALIVRLDTGETRRVVHGDV 233


>gi|269795826|ref|YP_003315281.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Sanguibacter keddieii
           DSM 10542]
 gi|269098011|gb|ACZ22447.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Sanguibacter keddieii
           DSM 10542]
          Length = 282

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 105/231 (45%), Gaps = 33/231 (14%)

Query: 43  IVASCQTAGRGRRDNKW-ISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           +VA  Q AGRGR    W    +  L ASLL+   +  + L  L     +A  + + +TL 
Sbjct: 58  LVAEHQEAGRGRAGRSWETPPRAALTASLLVRPQVPPERLGWLPLLAGLATVTALRATL- 116

Query: 102 VGTDVKIKWPNDILVF-----------QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCP 150
            G     KWPND+LV             RKIAGIL E L        VV+G+GLNV   P
Sbjct: 117 -GVQAVAKWPNDVLVVTDEPELPGWGTARKIAGILTEVLP-----DGVVIGVGLNVSQTP 170

Query: 151 VDTPYP--VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG-------REEIMNLWR 201
            + P P  V+ L+  G  +D   I + L +    VL  W    G        +E++    
Sbjct: 171 EELPVPTAVSVLRAGGATVDRTVILTALAESFVSVLGRWTAAGGDVVASGLADEVL---- 226

Query: 202 CFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             +  +G  + ++L+ G  +LG   G+   G LL+E+  G V  + +GD+ 
Sbjct: 227 AVSATVGASVRVELAGGDELLGTATGLAPDGALLVEDASGRVVTVHSGDVH 277


>gi|225020634|ref|ZP_03709826.1| hypothetical protein CORMATOL_00641 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946580|gb|EEG27789.1| hypothetical protein CORMATOL_00641 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 261

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 115/245 (46%), Gaps = 9/245 (3%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
              PY  R E+F  +SSTN E +  A  G       +   QTAGRGR    + +   +  
Sbjct: 18  ANGPYQ-RIEYFPEVSSTNTELVAAAHDGAPAWTAFLTDHQTAGRGRMGRSFSAPPRSQM 76

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
              +LI    +    L +  +A  +  + A   P    +++KWPND+++  RK+ GIL E
Sbjct: 77  PLSILIRPPHESVTRLGTMPLATGLALIDALATP---QIQLKWPNDLVIDGRKLCGILAE 133

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            ++L +   AVV+G+GLN      + P P  TSL  EG   +  ++   +   +   L  
Sbjct: 134 AVSLGDQ-PAVVIGLGLNTSLTKEELPVPHATSLHLEGIPYERNELAIRVLNALHHRLTQ 192

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVRQI 245
           W  +T    +M  +R  +  IG  + + L   + +LG   GV D G L + ++ G + ++
Sbjct: 193 W--ETNDPALMPDYRAVSATIGQNVRVILPNDTELLGTAEGVADDGRLQVRDQTGTLHEL 250

Query: 246 FTGDI 250
             GD+
Sbjct: 251 TAGDV 255


>gi|302390913|ref|YP_003826733.1| biotin/acetyl-CoA-carboxylase ligase [Acetohalobium arabaticum DSM
           5501]
 gi|302202990|gb|ADL11668.1| biotin/acetyl-CoA-carboxylase ligase [Acetohalobium arabaticum DSM
           5501]
          Length = 331

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 119/243 (48%), Gaps = 14/243 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           ++ E   T S    E  + A  G +    IVA  Q  G+GR   ++    G ++ S++L 
Sbjct: 90  YQEEVKSTNSLAKSEARQEAEEGTV----IVAKEQVGGKGRLGREYFCPPGGIWFSVILR 145

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNL 131
            ++  DS +  SF   VA+    A T+   TD   +IKWPND+L+  +K++GIL E    
Sbjct: 146 PNMKPDSASQFSFVAVVAL----AKTIDELTDSVPEIKWPNDVLINGKKVSGILTEMSAE 201

Query: 132 KNGLQAVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            + +  +V+GIG+N    V   P D     TS+Q E G    K  F L   +        
Sbjct: 202 IDQIDYLVLGIGVNLNIAVDEFPSDLKNKATSIQEESGQQIPKLNFFLSLLEQLEEEYFK 261

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G E+I+  W+ +   +G+ +T+  +   + G+ V VD+ G LL+E   G ++++  
Sbjct: 262 LQTEGFEKIIEGWKEYNITLGNEVTVTSNNEVLTGQAVDVDNKGRLLVELPNGTMKKVVA 321

Query: 248 GDI 250
           GD+
Sbjct: 322 GDV 324


>gi|310816698|ref|YP_003964662.1| biotin--acetyl-CoA-carboxylase ligase [Ketogulonicigenium vulgare
           Y25]
 gi|308755433|gb|ADO43362.1| biotin--acetyl-CoA-carboxylase ligase [Ketogulonicigenium vulgare
           Y25]
          Length = 253

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           FD+I ST  E  ++   G    LWI+A  QTAG GRR   W    GN   +++     + 
Sbjct: 16  FDSIDSTMLEARRQLALGLTRPLWILAHDQTAGHGRRGRAWTHPAGNFAGTVVFRPGGTP 75

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
            S  L SF ++ A+R+ +++ +     + +KWPND+L+   KIAGIL+E+      +  +
Sbjct: 76  HSAGLRSFLMSNALRTALSAFVDPAR-LGLKWPNDVLLDGGKIAGILLESSAQGAAVDWL 134

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIF-SLLFQDVARVLDLWKKDTGREEIM 197
            +G+G+N+   P D+     +    G      ++F + L +  A    ++  D G   I 
Sbjct: 135 AIGVGVNLAMAP-DSDGAAFAPVALGAHPPHPEVFLTHLARAFAAQEAIFATD-GFAPIR 192

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           N W   A   G  IT +L   +  GRF G+DD G L+L
Sbjct: 193 NEWLKHAVMRGKTITARLPNVTYEGRFDGIDDDGNLML 230


>gi|289580761|ref|YP_003479227.1| biotin/acetyl-CoA-carboxylase ligase [Natrialba magadii ATCC 43099]
 gi|289530314|gb|ADD04665.1| biotin/acetyl-CoA-carboxylase ligase [Natrialba magadii ATCC 43099]
          Length = 315

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 118/244 (48%), Gaps = 18/244 (7%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E+ D + STN     RA  G   ++ ++A  QT GRGR + +W S  G ++ S++  
Sbjct: 75  FTVEYHDAVGSTNAVARDRATDG-AADVVVLADEQTGGRGRLEREWSSPAGGVWLSIVTR 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV------FQRKIAGILIE 127
            +I+     L + A AVA           G D +IKWPND++V        RK+AGIL E
Sbjct: 134 PAITPARAPLYTLAAAVATTRAAREA---GVDARIKWPNDVVVPVDEDGAYRKLAGILTE 190

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLF-QDVARVLDL 186
                + ++ + VGIG+N        P   T+++ E G    +D+   +F Q +    D 
Sbjct: 191 MEGETDRVEWLTVGIGVNANLDADGLPDGATTIRDEAG----EDVDRRVFVQRLLEEFDA 246

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE-EKKGCVRQI 245
            + D   + ++  WR  A  +G  + +  S G+++G  V + D G L++E E+ G    +
Sbjct: 247 VRADL--DGVVPAWRELALTLGQRVRVDRSSGALVGEAVDISDSGALVVESEESGKRETV 304

Query: 246 FTGD 249
             GD
Sbjct: 305 AAGD 308


>gi|294011323|ref|YP_003544783.1| biotin-[acetyl-CoA-carboxylase] ligase [Sphingobium japonicum
           UT26S]
 gi|292674653|dbj|BAI96171.1| biotin-[acetyl-CoA-carboxylase] ligase [Sphingobium japonicum
           UT26S]
          Length = 219

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 100/214 (46%), Gaps = 14/214 (6%)

Query: 42  WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIA-VAMRSVIASTL 100
           W+ A+ QT GRGR    W S +GNLY S +    I       L F +A VA  +V A   
Sbjct: 14  WLRAARQTGGRGRMGRHWESPEGNLYCSTV----IRLRDGDPLPFTLALVAANAVHALVA 69

Query: 101 PV-GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
           P+     +IKWPND+LV   KIAGIL+E         AVV GIG+NV   PV    P TS
Sbjct: 70  PLCAGQARIKWPNDVLVDGAKIAGILLERAG-----DAVVAGIGINVTGHPVGLDRPATS 124

Query: 160 LQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG 218
           L  +G    D   +   L +  A  L +W+   G + +   W   A   G  + +    G
Sbjct: 125 LFAQGAPDADAAALQVRLAELFAHWLAIWRAQ-GLDPVRAHWLANAHPAGTPMRVAQPDG 183

Query: 219 -SILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            +I G F  +D  G L+L    G  R I  GDI 
Sbjct: 184 ETIEGSFDTLDRDGMLILRLANGESRAIHAGDIL 217


>gi|257388616|ref|YP_003178389.1| biotin/acetyl-CoA-carboxylase ligase [Halomicrobium mukohataei DSM
           12286]
 gi|257170923|gb|ACV48682.1| biotin/acetyl-CoA-carboxylase ligase [Halomicrobium mukohataei DSM
           12286]
          Length = 310

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 109/227 (48%), Gaps = 14/227 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E+ D+I STN    + A  G   ++ ++A  QT GRGR D  W S  G ++ SL L 
Sbjct: 75  FEIEYHDSIDSTNRRARELATDG-RSDVAVLADEQTGGRGRLDRAWASPSGGVWLSLALR 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF--QRKIAGILIETLNL 131
             +        + A AVA+          G D +IKWPND++V   +RK+AG+L E    
Sbjct: 134 PGVPIAHAPAFTLAAAVAVTRAAREA---GVDARIKWPNDVVVGDDERKLAGVLTEVEGE 190

Query: 132 KNGLQAVVVGIGLNVKHCPVDTP--YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
            + +  VVVGIG NV   P   P     TS+Q   G +D +     L ++     D  ++
Sbjct: 191 ADRVDWVVVGIGSNVNVDPAALPDEADATSVQDAVGPVDRRAFTQRLLEE----FDALRR 246

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           D   + ++  WR  A  +G  + ++   G++ G  V V   G L+++
Sbjct: 247 DL--DAVVPAWRADATTLGKRVRVETPGGTVEGEAVDVSFPGALVVD 291


>gi|307825692|ref|ZP_07655909.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacter tundripaludum
           SV96]
 gi|307733269|gb|EFO04129.1| biotin/acetyl-CoA-carboxylase ligase [Methylobacter tundripaludum
           SV96]
          Length = 332

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 118/243 (48%), Gaps = 13/243 (5%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
           +E  D I STN   ++R+ +  L      A  QTAG+GRR  +W+S  G N+Y S+L   
Sbjct: 87  FEIHDQIDSTNRYLVERSQNNALSGSVCFAEYQTAGKGRRGRQWVSPYGSNIYLSILWRF 146

Query: 75  SISKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                +++ LS AI VA +R++    +    D+ +KWPNDI    +K+ GIL+E     +
Sbjct: 147 QQGPAAISGLSLAIGVAVIRALKQHQI---NDIGLKWPNDIYSQGKKLGGILVEVSGETD 203

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTS----LQREGGCIDL--KDIFSLLFQDVARVLDLW 187
           G  + V+G+GLN+   P      +T     L +  G   L    +   L   +  V+  +
Sbjct: 204 GPCSAVIGLGLNL-FLPETEAESITQAWTDLSKITGQNQLFRNKLAGTLLNHLLPVIAEY 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +   G +  ++ WR + C  G   T+ +      G   G+DD G LL+E   G V+   +
Sbjct: 263 E-GVGIQAYLDEWRSYDCLTGKSATLFIGQQQFEGIVRGIDDNGMLLIERPDGHVQTFAS 321

Query: 248 GDI 250
           G++
Sbjct: 322 GEV 324


>gi|294677075|ref|YP_003577690.1| biotin--[acetyl-CoA-carboxylase] ligase [Rhodobacter capsulatus SB
           1003]
 gi|3282580|gb|AAC25006.1| BIRA [Rhodobacter capsulatus]
 gi|294475895|gb|ADE85283.1| biotin--[acetyl-CoA-carboxylase] ligase-1 [Rhodobacter capsulatus
           SB 1003]
 gi|1586529|prf||2204231K ORF 3
          Length = 242

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 104/219 (47%), Gaps = 8/219 (3%)

Query: 39  GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAS 98
           G  W+ A  QTAGRGRR   W+   GN  A+L+   +++  +  L SF  A+A+ + +  
Sbjct: 25  GPAWVFAHRQTAGRGRRGRDWLMPSGNFAATLVFRPAVTPATAALYSFVAALALEAALTE 84

Query: 99  TLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPY--- 155
            +  G    IKWPND+L+   KIAGIL+E++     +  + VGIG+N+   P        
Sbjct: 85  VMGPGPVTAIKWPNDVLLNGGKIAGILLESVGTGGQISHLAVGIGVNLAKAPPAAALEPG 144

Query: 156 ---PVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLIT 212
              PV+ L   G  ID  D  + L +  A     +++  G   I   W   A  IG  IT
Sbjct: 145 AVAPVSLLGETGLVIDPLDFLAPLARGFAHYAATFER-YGFAPIRAAWLARAARIGQRIT 203

Query: 213 IKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            +    ++ G F  +DD G L+L       R I   DIF
Sbjct: 204 ARTGTETLTGTFETIDDTGALILATGS-ERRAISAADIF 241


>gi|323484888|ref|ZP_08090243.1| hypothetical protein HMPREF9474_01994 [Clostridium symbiosum
           WAL-14163]
 gi|323401769|gb|EGA94112.1| hypothetical protein HMPREF9474_01994 [Clostridium symbiosum
           WAL-14163]
          Length = 326

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 114/237 (48%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           +FD   STN E  + A +G       VA  Q  G+GRR   W S +G  ++ SL++   I
Sbjct: 83  YFDETGSTNTEAKQAAEAGAPHGTLAVADYQNMGKGRRGRMWTSPRGVGVWMSLMIRPEI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              + ++L+   A+A+   I  T   G + +IKWPNDI+   +KI GIL E       + 
Sbjct: 143 HPSAASMLTLVAALAVSEGIGKT--CGLETQIKWPNDIVADGKKICGILTEMSTELECIN 200

Query: 137 AVVVGIGL--NVKHCPVDTPYPVTS-LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV G+G+  N++  P +     TS L + G  +    +   + +   +  +++ +    
Sbjct: 201 YVVTGMGINANMEELPEEIKDVATSILLQTGKRVKRSQLIGAVMESYEKYYNVFMESGNM 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +++++      +   + +       +G  +G++D G LL++ + G V Q+ +G++
Sbjct: 261 SGLLDVYNSHLANMQRSVRVLQPGSEYVGTALGINDAGELLVKTEDGAVHQVISGEV 317


>gi|323693744|ref|ZP_08107941.1| hypothetical protein HMPREF9475_02804 [Clostridium symbiosum
           WAL-14673]
 gi|323502195|gb|EGB18060.1| hypothetical protein HMPREF9475_02804 [Clostridium symbiosum
           WAL-14673]
          Length = 326

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 114/237 (48%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           +FD   STN E  + A +G       VA  Q  G+GRR   W S +G  ++ SL++   I
Sbjct: 83  YFDETGSTNTEAKQAAEAGAPHGTLAVADYQNMGKGRRGRMWTSPRGVGVWMSLMIRPEI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              + ++L+   A+A+   I  T   G + +IKWPNDI+   +KI GIL E       + 
Sbjct: 143 HPSAASMLTLVAALAVSEGIGKT--CGLETQIKWPNDIVADGKKICGILTEMSTELECIN 200

Query: 137 AVVVGIGL--NVKHCPVDTPYPVTS-LQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV G+G+  N++  P +     TS L + G  +    +   + +   +  +++ +    
Sbjct: 201 YVVTGMGINANMEELPEEIKDVATSILLQTGKRVKRSQLIGAVMESYEKYYNVFMESGNM 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +++++      +   + +       +G  +G++D G LL++ + G V Q+ +G++
Sbjct: 261 SGLLDVYNSHLANMQRSVRVLQPGSEYVGTALGINDAGELLVKTEDGAVHQVISGEV 317


>gi|194017230|ref|ZP_03055842.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
 gi|194011098|gb|EDW20668.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacillus pumilus ATCC 7061]
          Length = 252

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 115/239 (48%), Gaps = 18/239 (7%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           +DTI STN+E  +    G+  +  + A  QTAGRGR    W +  GN+  ++ ++     
Sbjct: 19  YDTIDSTNNEAKRLMQQGEKPSFAVYARQQTAGRGRLGRPWETPLGNVAVTMTVLPPEEL 78

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
            + + ++   A+A+  V+   +     + IKWPNDIL+ + K++G LIE         A+
Sbjct: 79  STQSTIAPLTALAIYDVLKPLIRADDQLAIKWPNDILINEAKVSGTLIEA-----DRSAI 133

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS-LLFQDVARVLDLWK---KDTGRE 194
            +G+G+NVK  P   PY    L       ++ ++ +  L +D+A   + +    ++ G E
Sbjct: 134 YIGVGINVKTKPEHVPYKTICLS------EMTEVKADQLVKDLAAAFEKYHTRWQNEGFE 187

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSIL---GRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +  L+      +   + I L         G   GV+ FG+L L++ KG ++    GDI
Sbjct: 188 ALTALYNKRLYRLNKPLRISLDREKQTWEEGICYGVNRFGHLQLKDDKGQIKAHSAGDI 246


>gi|237797416|ref|ZP_04585877.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331020266|gb|EGI00323.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 319

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 119/239 (49%), Gaps = 10/239 (4%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLG-NLWIVASCQTAGRGRRDNKWIS 61
           S + +   P  +    +D+I STN E + R +  D+   L ++A  QT+GRGRR  KW+S
Sbjct: 65  SAIEKAGLPADWSVRTYDSIDSTNAEAV-RLIGQDVSMPLLVLAERQTSGRGRRGRKWVS 123

Query: 62  D-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
               NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++K
Sbjct: 124 PFAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDIGVHGAG--LKWPNDVLVGRQK 181

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLF 177
           IAGIL+E +     +  VV+GIG+NV       VD  +    L+  G  +D  DI + + 
Sbjct: 182 IAGILLELIGDPADVCHVVIGIGVNVNMRASAEVDQQWTSVRLE-TGHFVDRNDIAARIS 240

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +  +L + +K+ G       W       G  +T+    G++ G  +G+D  G L LE
Sbjct: 241 SQLNALLAVHRKE-GFAAFREEWEQGHLWQGAKVTLLSGVGAVEGVVLGIDSLGALRLE 298


>gi|297617464|ref|YP_003702623.1| biotin/acetyl-CoA-carboxylase ligase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145301|gb|ADI02058.1| biotin/acetyl-CoA-carboxylase ligase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 349

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 121/245 (49%), Gaps = 21/245 (8%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            D  SSTN    + A  G L    IV A+ QT G+GRR  +W S  G L+ S++L   + 
Sbjct: 112 LDETSSTNTVAWEMADQGRLAEGGIVIAARQTQGKGRRGRRWESPAGGLWLSIVLYPELQ 171

Query: 78  KDSLTLLS--FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
              +  LS  FA+AVA       T PV    K+KWPND+L+  +K+AGIL+E     + +
Sbjct: 172 VRDVVPLSLVFALAVACALQRFITAPV----KVKWPNDVLLGGKKVAGILLEINTEFDMI 227

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGGC-IDLKDIFSLLFQDV----ARVLDL 186
           + VV GIG+NV     D P  +    TSL  E G   DL+ + S +  ++    AR L+ 
Sbjct: 228 KYVVAGIGVNVNLRAEDLPAALRDQATSLYLETGQEFDLEAVLSAILAELEKAYARYLET 287

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             K   R + M   RC     G  +T+      + G   G+DD G L L+ K G + ++ 
Sbjct: 288 GFKGL-RRQFME--RC--AHFGQPVTVHTQGRDLSGIDQGIDDHGCLRLKLKDGRLVRVT 342

Query: 247 TGDIF 251
            GD+ 
Sbjct: 343 AGDVM 347


>gi|167045639|gb|ABZ10288.1| putative biotin/lipoate A/B protein ligase family protein
           [uncultured marine microorganism HF4000_APKG10K24]
          Length = 289

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 110/240 (45%), Gaps = 11/240 (4%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I ST +E  + A  G      +VA  Q+ GRGR+   W+S +GN+Y S++   
Sbjct: 22  RLLYFQEIPSTMNEASRLAQEGADEGTVVVAGTQSEGRGRQGRNWVSREGNIYISIIFRP 81

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           ++  D L +LS    VA    I  T   G +  IKWPND+++  +K  GIL+E+      
Sbjct: 82  TL--DVLPMLSILAGVAAVRAIRKT--TGLEPGIKWPNDVMIGGKKTGGILVESAVQGGQ 137

Query: 135 LQAVVVGIGLNV---KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
           +   ++G+G+N+        +     T+L    G  +  +D+   L  D+ R   L+ + 
Sbjct: 138 VSHAILGMGINIDLDAQKEEEIANLATALNSAAGRIVPPEDLLRQLLHDLDR---LYIEA 194

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           T     +  W      IG  I       +  G   G+D+ G LLL  + G +  +  GD+
Sbjct: 195 THGVSPLPEWETLLETIGQSIQATWRQETYTGVAEGIDNLGNLLLRLEDGQLMTLTAGDV 254


>gi|326202904|ref|ZP_08192771.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium papyrosolvens DSM
           2782]
 gi|325986981|gb|EGD47810.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium papyrosolvens DSM
           2782]
          Length = 326

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 119/243 (48%), Gaps = 15/243 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           + FD I STN+   K A  G      +VA  QT GRGR   +W SD    ++ S++L   
Sbjct: 81  QHFDEIDSTNNYAKKIANEGCAHGTVVVAEKQTTGRGRIGRQWQSDTSEGIWFSIVLRPE 140

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  + L +++ A +VA+   I  TL  G    IKWPNDI++  +K+ GIL E       +
Sbjct: 141 MKPEDLQVITLAASVAVVEAIEETL--GIVCGIKWPNDIIIDGKKLGGILTELSAEPGHV 198

Query: 136 QAVVVGIGLN----VKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLL---FQDVARVLDLW 187
             VVVGIG+N    ++H   +      SL+  +G  +   ++   +   F++V + + L 
Sbjct: 199 NYVVVGIGINANQDLEHFDYEIRQKAISLKMCKGETVSRSNLLGSILTNFEEVYKGVLLG 258

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           K     +EI++ W  ++  IG  + I       +G    V   G L+++ K G  R+I  
Sbjct: 259 K----NKEIIDRWTKYSVTIGKEVKIAYRNMEYIGTAQSVASDGRLIVQCKDGVTREISA 314

Query: 248 GDI 250
           G+I
Sbjct: 315 GEI 317


>gi|225156046|ref|ZP_03724529.1| Biotin--(acetyl-CoA-carboxylase) ligase [Opitutaceae bacterium
           TAV2]
 gi|224803279|gb|EEG21519.1| Biotin--(acetyl-CoA-carboxylase) ligase [Opitutaceae bacterium
           TAV2]
          Length = 357

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 112/248 (45%), Gaps = 16/248 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
              D + STNDE  +R  +G+   L ++A  QT GRGR    W S   GNLY S      
Sbjct: 101 HLLDEVDSTNDEAARRLTAGEAAPLVVMARRQTKGRGRFGRVWHSGVAGNLYCSFGFRPR 160

Query: 76  ISKDSLTLLSFAIAVAMRSVIA-----STLPVGT-DVKIKWPNDILVFQRKIAGILIETL 129
           +    +   S  + V +   +A     +  P G   + IKWPND+L+  RK  GIL E  
Sbjct: 161 VEPARMQPFSLWMGVNICEFVADFCRIAPGPAGAAKIGIKWPNDLLLDGRKAGGILTEAR 220

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPVT----SLQREGGCIDLKDIFSLLFQDVARVLD 185
              + ++ +V+G+GLN++  P   P  +     S+          + F+L    VARVL+
Sbjct: 221 MDADQIRDLVLGLGLNLQPPPEGWPPEIAARAVSISEHANVPVEINRFALAL--VARVLE 278

Query: 186 LWKK---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            +++   D  R+   +LW       G  + +        G  +GVDD G LL+    G +
Sbjct: 279 AYEQFVADAHRDTFADLWNKHDLLRGRPVAVLQGDTRTPGTAMGVDDEGCLLVRTPMGGI 338

Query: 243 RQIFTGDI 250
            +   G++
Sbjct: 339 ERFRAGEV 346


>gi|218778235|ref|YP_002429553.1| biotin/acetyl-CoA-carboxylase ligase [Desulfatibacillum
           alkenivorans AK-01]
 gi|218759619|gb|ACL02085.1| biotin/acetyl-CoA-carboxylase ligase [Desulfatibacillum
           alkenivorans AK-01]
          Length = 312

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 111/220 (50%), Gaps = 28/220 (12%)

Query: 43  IVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV 102
           +VA  QT GRGR +  W S  G LY +++L  S+  + +  + F  +V++  V+ +    
Sbjct: 101 VVAQRQTKGRGRLNRVWDSQDGGLYFTVILRPSLPINQVYKVLFTASVSLALVVRNL--T 158

Query: 103 GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQR 162
           G +  +KWPNDILV ++K+ G+L E       +Q V +GIG+NV + P          + 
Sbjct: 159 GINATVKWPNDILVGEKKLNGMLSEMATQDEFVQYVNLGIGVNVNNNPS---------KA 209

Query: 163 EGGCIDLKDIFSLLFQDVAR------VLD-----LWKKDTGREEIMNLWRCFACGIGDLI 211
           E   + ++D   LL Q+  R       LD     L  KD   E+++  W+ +   IG  +
Sbjct: 210 EPNAVSIRD---LLGQEFPRRKILTGFLDSMEERLKNKD---EDVIAQWKQYTSTIGRPV 263

Query: 212 TIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            I+ +   + GR V V+  G L++E   G + ++F GD F
Sbjct: 264 RIQTTRDVLEGRAVDVNSQGSLIVELADGRLEEVFHGDCF 303


>gi|306820540|ref|ZP_07454173.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551454|gb|EFM39412.1| biotin--[acetyl-CoA-carboxylase] ligase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 321

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 125/240 (52%), Gaps = 15/240 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           E FD I STN++  K A +   G + + A+ QT G+GRR  ++ S KG +Y S++L   +
Sbjct: 85  EVFDEIDSTNEQAKKIAKNASDGTI-VAANVQTKGKGRRGREFESKKGGMYFSIILKPDV 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           + + +  ++   A ++   ++    +G D  IKWPNDI++  +K+ GIL E     + L 
Sbjct: 144 AIEEVPFITQMTACSINKALSE---MGVDTLIKWPNDIILNDKKLCGILCEMSCEIDYLS 200

Query: 137 AVVVGIGLNVKHCPVDTPYP--VTSLQREGGCIDLKDIFSL-LFQDVARVLDLWKKD--- 190
            VV GIG+N+K    +       TSL++EG  +D     +L LF ++ +  D + +    
Sbjct: 201 YVVAGIGINLKKVDFEEEVEKVATSLEQEGYELD-----NLGLFWNILKNFDYFYQKYIM 255

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +E++++ R  +  +   I I  S      R   +D+ G+L++E + G +  I  G++
Sbjct: 256 HDYDEMLDILRANSYILNKDIEILTSNEIKKARSKDIDEKGFLVVEYENGDIEHINYGEV 315


>gi|157693259|ref|YP_001487721.1| biotin-(acetyl-CoA carboxylase) ligase [Bacillus pumilus SAFR-032]
 gi|157682017|gb|ABV63161.1| possible biotin-(acetyl-CoA carboxylase) ligase [Bacillus pumilus
           SAFR-032]
          Length = 239

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 116/239 (48%), Gaps = 18/239 (7%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           +DTI STN+E  +    G+  +  + A  QTAGRGR    W +  GN+  ++ ++     
Sbjct: 6   YDTIDSTNNEAKRLMQQGEKPSFAVYARQQTAGRGRLGRPWETPLGNVAVTMTVMPPEEL 65

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
            + + ++   A+A+  V+   +    ++ IKWPNDIL+ + K++G LIE         A+
Sbjct: 66  STQSTIAPLTALAIYDVLKPLIRAEDELAIKWPNDILINEAKVSGTLIEA-----DRSAI 120

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFS-LLFQDVARVLDLWK---KDTGRE 194
            +G+G+NV+  P   PY    L       +L ++ +  L +D+A   + +    ++ G E
Sbjct: 121 YIGVGINVETKPEHVPYKTICLS------ELTEVKADQLVKDLAAAFEKYHSRWQNEGFE 174

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSIL---GRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +  L+      +   + I L         G   GV+ FG+L L++ KG ++    GDI
Sbjct: 175 ALTALYNKRLYRLNKPLRISLDREKQTWEEGICCGVNRFGHLQLKDDKGQIKAHSAGDI 233


>gi|288871334|ref|ZP_06410116.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium hathewayi DSM
           13479]
 gi|288863858|gb|EFC96156.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium hathewayi DSM
           13479]
          Length = 328

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 113/237 (47%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +++   STN    K A  G      +V   Q AGRGRR   W+S  G  ++ SL+L   I
Sbjct: 85  YYEETDSTNIRARKLAEEGAPDGTLVVTDFQNAGRGRRGRMWVSPSGTGVFMSLILRPDI 144

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S ++L+   A+A+   I  T   G D  IKWPNDI+   RK+ GIL E      G+ 
Sbjct: 145 LPSSASMLTLVAALAVHDGIKET--TGLDTVIKWPNDIVGDGRKLCGILTEMSAELEGIH 202

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV GIG+N      P +     +SL+   G  +    + + + +        +++    
Sbjct: 203 YVVTGIGINANMTEFPEEAGEVASSLRILTGSPVRRSRLIASVMKAYEGYYKKFRECGSL 262

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +M+++      +G  + +    G+  G+ +G+D+ G L++E+  G V ++ +G++
Sbjct: 263 ASLMDVYNEHMANLGREVKVLDPAGTYTGKALGIDEKGELIVEKADGKVIRVVSGEV 319


>gi|20089561|ref|NP_615636.1| biotin operon repressor/biotin-pyruvate carboxylase ligase
           [Methanosarcina acetivorans C2A]
 gi|19914476|gb|AAM04116.1| biotin operon repressor/biotin-pyruvate carboxylase ligase
           [Methanosarcina acetivorans C2A]
          Length = 325

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 18/243 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           +  +F+ +SSTN    + A S + G+L ++A  Q  GRGR   +WIS  G ++ S++L  
Sbjct: 84  KIHYFEEVSSTNSVAKEIAASEEEGSL-VIAEVQKVGRGRMGREWISPHGGIWMSVILKP 142

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I     + L+    +A+ +VI     +G D +IKWPND+ +  +K+ GIL E     + 
Sbjct: 143 GIPLRHASRLTLVAGLAVANVIRD---MGLDARIKWPNDVRINGKKVCGILTEAKAEVDR 199

Query: 135 LQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-----CIDLKDIFSLLFQDVARVLD 185
           +  V++GIG+NV     D P       T+L+ E G        L+D+   L Q   R   
Sbjct: 200 VDYVILGIGINVNMELKDIPESFRAGSTTLKVETGKHIRRVSFLQDLLFELEQQYIRF-- 257

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
              K     +I+N W   +  IG  + +      I G+ VGV   G L++ +      +I
Sbjct: 258 ---KTQPFSQILNDWLALSDTIGREVKVTTPSRIIEGKAVGVTPDGALIIRKSDDTKEEI 314

Query: 246 FTG 248
             G
Sbjct: 315 IAG 317


>gi|85859786|ref|YP_461988.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Syntrophus aciditrophicus SB]
 gi|85722877|gb|ABC77820.1| biotin operon repressor / biotin--[acetyl-CoA-carboxylase]
           synthetase [Syntrophus aciditrophicus SB]
          Length = 273

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            +  I STN        SG      ++A  Q  GRGR    W S  G NLY S+LL   I
Sbjct: 33  LYPEIDSTNSAAFHLGHSGAGEGTIVIADTQLKGRGRLHRPWQSPPGRNLYTSILLKPPI 92

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+    VA+  +++   P    V++KWPND+ +  +K+ GIL E     +G+ 
Sbjct: 93  EPSVAPQLTLLAGVAVADLLSFYCP--GSVRLKWPNDVQINGKKVCGILAEMKTSAHGID 150

Query: 137 AVVVGIGLNV--KHCPVDTPYP--VTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            + +GIG+NV  ++   D  +    TSL+ E G  +   DI   L+    +   L+  + 
Sbjct: 151 YIAIGIGINVNIRNEEFDETFRNLATSLREETGQVLPRMDIAVSLYDHFEKCYTLYLAE- 209

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           G + +   W  +A  +G+ + +        G   G+DD G LLL +++G + ++  GD
Sbjct: 210 GFQSLKERWLIYARILGEQLQVIFREEVQSGEVAGLDDSGALLLCDREGKITRVIAGD 267


>gi|332654407|ref|ZP_08420150.1| biotin-[acetyl-CoA-carboxylase] ligase [Ruminococcaceae bacterium
           D16]
 gi|332516371|gb|EGJ45977.1| biotin-[acetyl-CoA-carboxylase] ligase [Ruminococcaceae bacterium
           D16]
          Length = 335

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 115/240 (47%), Gaps = 12/240 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSIS 77
            DT+ STN EC ++A++G    L +++  QT GRGR    + S KG  LY S LL   + 
Sbjct: 91  LDTVDSTNTECKRQAMAGAPDGLVVISEEQTGGRGRLGRTFQSPKGRGLYVSALLRPQLP 150

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET--LNLKNGL 135
              +T  +  +AVA+   I +    G   +IKW NDI++  +K+ GIL E    +  N L
Sbjct: 151 PAEVTDFTAWVAVAVCDGIEAA--CGLRPQIKWTNDIILNGKKVCGILTEMGLESESNAL 208

Query: 136 QAVVVGIGLNVKHCPVD-----TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           Q ++ GIG+N  H P D      P   +  Q  G  +   ++   + + + R+   + + 
Sbjct: 209 QYLIPGIGINANHAPEDFSEDVRPMATSLAQELGHPVRRSELAVQVIRALDRMYAAFPQ- 267

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G++E ++ +R      G+ + +         + V +DD   L++E   G    +  G++
Sbjct: 268 -GKQEYLDKYRADCLTPGNQVQLITPVSRREAKAVAIDDEFRLVVEYPDGSREALSAGEV 326


>gi|305680154|ref|ZP_07402964.1| biotin--[acetyl-CoA-carboxylase] ligase [Corynebacterium
           matruchotii ATCC 14266]
 gi|305660774|gb|EFM50271.1| biotin--[acetyl-CoA-carboxylase] ligase [Corynebacterium
           matruchotii ATCC 14266]
          Length = 261

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 114/245 (46%), Gaps = 9/245 (3%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
              PY  R E+F  +SSTN E +  A  G       +   QTAGRGR    + +   +  
Sbjct: 18  ANGPYQ-RIEYFPEVSSTNTELVAAAHDGAPAWTAFLTDHQTAGRGRMGRSFSAPPRSQM 76

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
              +LI    +    L +  +A  +  + A   P    +++KWPND+++  RK+ GIL E
Sbjct: 77  PLSILIRPPHESVTRLGTMPLATGLALIDALATP---QIQLKWPNDLVIDGRKLCGILAE 133

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
            ++L +   AVV+G+GLN      + P P  TSL  EG   +  ++   +   +   L  
Sbjct: 134 AVSLGDQ-PAVVIGLGLNTSLTKEELPVPHATSLHLEGIPYERNELAVRVLNALHHRLTQ 192

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVRQI 245
           W  +T    +M  +R  +  IG    + L   + +LG   GV D G L + ++ G + ++
Sbjct: 193 W--ETNDPALMPDYRAVSATIGQNARVILPNDTELLGTAEGVADDGRLQVRDQTGTLHEL 250

Query: 246 FTGDI 250
             GD+
Sbjct: 251 TAGDV 255


>gi|223937560|ref|ZP_03629463.1| biotin/acetyl-CoA-carboxylase ligase [bacterium Ellin514]
 gi|223893723|gb|EEF60181.1| biotin/acetyl-CoA-carboxylase ligase [bacterium Ellin514]
          Length = 325

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 120/240 (50%), Gaps = 11/240 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
            F+  +STND   + A  G    + + A  QT GRGR    W+S  +  L+ S+LL   +
Sbjct: 86  VFEETTSTNDVVERLARDGVKEGVVVFAESQTKGRGRLGRIWMSPARQGLWFSILLRPQL 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S+T L+ A A A+   I S    G   +IKWPNDIL+  +K+AGIL E     + ++
Sbjct: 146 RPTSVTQLTIAAATALFRAIRSQ--TGVRPEIKWPNDILIDGKKVAGILTELSAELDKVK 203

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDT 191
            +++G+G++V     D P  +    TSL+ E G  I+  ++   + Q++ R  D  +  +
Sbjct: 204 YIILGVGVDVNLSAADFPPELRKIATSLKVESGQRINRAELAVRILQEMDR--DYERVCS 261

Query: 192 GR-EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G+ E +   W      IG  +TI +    I G    +D  G LL+  + G + +I  GD+
Sbjct: 262 GQFESVAGEWAEHCSTIGRNVTIHVGDRKIQGCAESLDTDGALLVRTQHGHLERIIGGDV 321


>gi|14590088|ref|NP_142152.1| biotin--protein ligase [Pyrococcus horikoshii OT3]
 gi|75765346|pdb|1WNL|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3 In Complex With
           Adp
 gi|75765347|pdb|1WNL|B Chain B, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3 In Complex With
           Adp
 gi|78100842|pdb|1WQ7|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3
 gi|78100843|pdb|1WQ7|B Chain B, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3
 gi|78100855|pdb|1WQW|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5-Amp
 gi|78100856|pdb|1WQW|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5-Amp
 gi|109156914|pdb|1X01|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Atp
 gi|109156915|pdb|1X01|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Atp
 gi|118137523|pdb|2DKG|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp,
           Pyrophosphate And Mg(2+)
 gi|118137524|pdb|2DKG|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp,
           Pyrophosphate And Mg(2+)
 gi|126030295|pdb|2DTH|A Chain A, The Crystal Structure Of The Orthorhombic Form Of Biotin
           Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex
           With Biotin And Adp
 gi|126030296|pdb|2DTH|B Chain B, The Crystal Structure Of The Orthorhombic Form Of Biotin
           Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex
           With Biotin And Adp
 gi|126030297|pdb|2DTI|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp,
           Pyrophosphate And Mn(2+)
 gi|126030298|pdb|2DTI|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp,
           Pyrophosphate And Mn(2+)
 gi|3256533|dbj|BAA29216.1| 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
           [Pyrococcus horikoshii OT3]
          Length = 235

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 123/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGRLNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  +KIAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|313496802|gb|ADR58168.1| BirA [Pseudomonas putida BIRD-1]
          Length = 319

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 113/225 (50%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 80  IHETIDSTNAEGLRLASEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDG 139

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + +A MR++ A  +    DV +KWPND+LV  +KI GIL+E +     +
Sbjct: 140 GMRQLEGLSLVVGLAVMRTLQAFGV---KDVGLKWPNDVLVRGQKITGILLELVGDPADV 196

Query: 136 QAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+GIG+NV    +  VD  +  TS++RE G  ID   + +LL Q +   L   ++  
Sbjct: 197 CHVVLGIGINVNMQVNEQVDQQW--TSMRREVGVVIDRNHLVALLSQQLQHELARHRR-Y 253

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           G       W       G  +++      I G  +GVD  G L LE
Sbjct: 254 GFAAFQEEWEQAHLWQGRNVSLVAGNTRIDGVVLGVDGQGGLRLE 298


>gi|327440754|dbj|BAK17119.1| biotin-(acetyl-CoA carboxylase) ligase [Solibacillus silvestris
           StLB046]
          Length = 328

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 118/245 (48%), Gaps = 8/245 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASL 70
           Y  +  +++T+ ST     +   +G      ++A  QTAGRGR   +W S +G  ++ ++
Sbjct: 82  YGRQVHYYETVESTQLVAHELIRAGAPDGTVVIAEHQTAGRGRMMREWESTEGQGIWMTV 141

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           ++   ++       +   AVA+   + S+    T  +IKWPNDIL+  +K  GIL E + 
Sbjct: 142 IIRPDVAPHQAPQFTLVTAVAIVEAMKSSFKNFTP-EIKWPNDILINGKKTTGILTEMVA 200

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQ-----REGGCIDLKDIFSLLFQDVARVLD 185
             + +QA+++GIG+NV     D P  + ++       EG  I+     + + + + +  D
Sbjct: 201 EADRIQALLIGIGINVNQKIDDFPEQLQTIATSIAIEEGEPIERVHFVANVLESLEKYSD 260

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
            + K+ G  +I  LW   +  IG  +        + G  V + + G L + +  G ++ I
Sbjct: 261 EYVKN-GFGQIKQLWEQSSGTIGKRVKATTLREVVEGEAVSITESGVLEIRQANGEIKGI 319

Query: 246 FTGDI 250
           ++ DI
Sbjct: 320 YSADI 324


>gi|296116521|ref|ZP_06835131.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295976733|gb|EFG83501.1| biotin/acetyl-CoA-carboxylase ligase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 258

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 115/242 (47%), Gaps = 9/242 (3%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
            +  E    + ST+D C++RA  G  G L I+A  QT GRG R   W+   GNL  S+LL
Sbjct: 19  PWHLEIHGELGSTSDLCLQRAREGAAGGLAILALKQTQGRGSRGRGWVDPGGNLSMSVLL 78

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                   + L  F   +A    +A  +  G  + +KWPND+L+   K+AGILIE  +  
Sbjct: 79  RPDRDTAPVGLWPFIAGLAFYDALAPWVGPGHVLGLKWPNDLLLDGCKMAGILIEAGDEG 138

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK---K 189
           +G + + +G+G N+   PV     +  + + G   D+  + S +      +LD+W     
Sbjct: 139 DG-RWLSLGMGANLCAAPVIEGRELACMAQAGPVPDVGQVASAVLT----MLDVWMARYA 193

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G   I   W   A  +G  + +  + G+I G F G+   G LLL    G +R I TG+
Sbjct: 194 TDGFGAIRTAWLHRAHPVGTPVRVVSATGTICGTFAGIGGDGLLLLRTPDG-LRHISTGE 252

Query: 250 IF 251
           + 
Sbjct: 253 VL 254


>gi|119478590|ref|ZP_01618512.1| biotin--protein ligase [marine gamma proteobacterium HTCC2143]
 gi|119448425|gb|EAW29675.1| biotin--protein ligase [marine gamma proteobacterium HTCC2143]
          Length = 320

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 118/249 (47%), Gaps = 13/249 (5%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           LS          +  D + STN   + RA  G  G +   A  QTAG+GRR   W S   
Sbjct: 71  LSSAAAEMVLTLDVRDVVDSTNIIALNRASPGSSGYI-CTAEHQTAGKGRRGKVWASPYA 129

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            NLY S +   +    +L  LS A+ VA+   ++     G  VK+KWPNDILV  RK+AG
Sbjct: 130 SNLYLSAVWEFADGAAALEGLSLAVGVAVADALSRAGVNG--VKLKWPNDILVDNRKLAG 187

Query: 124 ILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPY-PVTSLQREGGCIDLKDIFSLLFQD 179
           IL+E      G   VVVGIGLNV       +D P+  V  +  E    +   + +L+  +
Sbjct: 188 ILLEVTGEPAGPCRVVVGIGLNVNMITATDIDQPWIDVKEISLE--AANRNQLLALILNE 245

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +  +L  + +  G     + W       G  +TI +   S+ G+ +GVD+ G LL++   
Sbjct: 246 LMPLLSSFSQ-RGFLSYRDRWLALDAYAGLDVTILMGKESVNGKAMGVDNSGALLVQTDA 304

Query: 240 GCVRQIFTG 248
           G   Q F+G
Sbjct: 305 GI--QKFSG 311


>gi|261867631|ref|YP_003255553.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412963|gb|ACX82334.1| biotin-[acetyl-CoA-carboxylase] ligase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 310

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 124/253 (49%), Gaps = 20/253 (7%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
           + L++   PY    +    ISSTN    + +++   GDL     +A  QT GRGRR  +W
Sbjct: 63  ARLTQALAPYGVTLK--PVISSTNQYLLDHLEQLQKGDL----CLAEYQTTGRGRRGRQW 116

Query: 60  ISD-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
           IS   G +  S     + +K SL  LS  I +A+   +A     G   ++KWPNDILV  
Sbjct: 117 ISPFAGQIIMSFYWQLNPTK-SLDGLSSVIGLAIVQALAELDMYG--FQVKWPNDILVND 173

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSL 175
           RK+AGIL+E +N KNG+  ++VGIG+N+   ++  +D P+    L      +D + I   
Sbjct: 174 RKLAGILVEIVNRKNGMLNLIVGIGMNISLGQNKKIDQPW--AELSEFFPQVDREQIIIK 231

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           + + + R L+ +++     E+   W       G  + +     +I G   G+D  G+L +
Sbjct: 232 MTKTIYRYLERFEQHGIDAELQQQWLNHDAYFGAEVNVITEKSAISGTEQGIDAAGHLCV 291

Query: 236 EEKKGCVRQIFTG 248
             + G  RQ F  
Sbjct: 292 ITENG--RQYFNA 302


>gi|330969838|gb|EGH69904.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 319

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 112/230 (48%), Gaps = 8/230 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P  +    +D+I STN E  +    G    L +VA  QT+GRGRR  KWIS    NLY S
Sbjct: 73  PAGWSVRTYDSIDSTNAEAARLIAQGVPMPLLVVAEQQTSGRGRRGRKWISPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+   + V  D  +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMNVL-RDMGV-QDAGLKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSSSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMAV 249

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            +K+ G       W       G  + +      + G  +GVD  G L LE
Sbjct: 250 HRKE-GFAAFQKEWERGHVWQGAAVKLLSGVEVVEGLVLGVDSLGALRLE 298


>gi|66047791|ref|YP_237632.1| biotin--protein ligase [Pseudomonas syringae pv. syringae B728a]
 gi|63258498|gb|AAY39594.1| Biotin--acetyl-CoA-carboxylase ligase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 335

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 112/231 (48%), Gaps = 10/231 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P  +    +D+I STN E  +    G    L +VA  QT+GRGRR  KWIS    NLY S
Sbjct: 89  PAGWSVRTYDSIDSTNAEAARLIAQGVPMPLLVVAEQQTSGRGRRGRKWISPFAENLYYS 148

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT-DVKIKWPNDILVFQRKIAGILIET 128
           L+L        L  LS  + +A+ +V+     +G  D  +KWPND+LV ++KIAGIL+E 
Sbjct: 149 LVLRIDGGMRQLEGLSLLVGLAVMNVLRD---MGVQDAGLKWPNDVLVGRQKIAGILLEL 205

Query: 129 LNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           +     +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ 
Sbjct: 206 IGDPADVCHVIIGIGVNVNMRSSSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMA 264

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           + +K+ G       W       G  + +      + G  +GVD  G L LE
Sbjct: 265 VHRKE-GFAAFQKEWERGHVWQGAAVKLLSGVEVVEGLVLGVDSLGALRLE 314


>gi|325271339|ref|ZP_08137868.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas sp. TJI-51]
 gi|324103525|gb|EGC00843.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas sp. TJI-51]
          Length = 319

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 111/225 (49%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             DTI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 80  IHDTIDSTNAEGLRMAGEGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDG 139

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + +A MR++    +    DV +KWPND+LV   KI GIL+E +     +
Sbjct: 140 GMRQLEGLSLVVGLAVMRTLQGFGV---KDVGLKWPNDVLVRGMKITGILLELVGDPADV 196

Query: 136 QAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+G+G+NV    +  VD  +  TS++RE GG ID   + + L Q +   L   ++  
Sbjct: 197 CHVVLGVGINVNMQANEQVDQQW--TSMRRELGGAIDRNHLVASLTQHLQHELARHRR-Y 253

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           G       W       G  +++      + G  +GVD  G L LE
Sbjct: 254 GFAAFQEEWEQAHLWQGRSVSLIAGNTRVDGVVLGVDGQGGLRLE 298


>gi|251796454|ref|YP_003011185.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. JDR-2]
 gi|247544080|gb|ACT01099.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. JDR-2]
          Length = 326

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 121/243 (49%), Gaps = 14/243 (5%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E+ + + ST +   K A  G      ++A  Q  GRGR    W+S +G  ++ S++L  S
Sbjct: 84  EWHEAVDSTQNLAQKLAEEGAPEGTLVIAEQQHNGRGRMGRGWVSPQGKGIWMSMVLRPS 143

Query: 76  ISKDSLTLLSFAIAVAM-RSVIA-STLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           +       L+   AVA+ RS+   ++LP+G    IKWPND+L+  +KI+GIL+E+   + 
Sbjct: 144 VPIHFAPQLTLLTAVALCRSLRRITSLPIG----IKWPNDLLIEGKKISGILLESTAEEE 199

Query: 134 GLQAVVVGIGLNVKHCPVDTPYP----VTSLQ--REGGCIDLKDIFSLLFQDVARVLDLW 187
            L+ V+ GIG++V     D P      VTSL+    G   D   + +   Q+  ++ +L+
Sbjct: 200 RLRYVIAGIGISVNLEKTDYPEEMLEKVTSLRIANGGDGFDRITVITDFLQEWEQLYNLY 259

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D G   I+ LW   +  +     +    G+I G  +G+D  G L + +  G    +F+
Sbjct: 260 -LDKGFAPIITLWEALSVSLNKPARLITPQGTIDGVPIGLDASGALTVRKDDGSTVVVFS 318

Query: 248 GDI 250
            ++
Sbjct: 319 AEM 321


>gi|89892961|ref|YP_516448.1| hypothetical protein DSY0215 [Desulfitobacterium hafniense Y51]
 gi|219666228|ref|YP_002456663.1| biotin/acetyl-CoA-carboxylase ligase [Desulfitobacterium hafniense
           DCB-2]
 gi|89332409|dbj|BAE82004.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536488|gb|ACL18227.1| biotin/acetyl-CoA-carboxylase ligase [Desulfitobacterium hafniense
           DCB-2]
          Length = 326

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 107/225 (47%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           FF  +SSTND        G      ++A  QT G GR    W S +G L+ SLLL   +S
Sbjct: 84  FFAELSSTNDLLKDMVRQGREHGTVVIARRQTTGHGRMQRAWESPEGGLWLSLLLKPRLS 143

Query: 78  KDSLTLLSFAIAVAMRSVIASTLP--VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                 L+ +  VA+    A TL    G    IKWPND++V  RKIAGIL E       +
Sbjct: 144 LGDAAKLTLSTGVAL----AQTLQDLYGLAAGIKWPNDVVVQGRKIAGILGEVAGEWTTV 199

Query: 136 QAVVVGIGLNVKHC--PVDTPYPVTSLQR-EGGCIDLKDIFS-LLFQDVARVLDLWKKDT 191
           Q +++GIG+N         +  P T+LQ   G  ++L  + + LLF     V  L + D 
Sbjct: 200 QTLILGIGVNANFSGQTFSSKLPATTLQDILGYEVNLNHLAAQLLFNLEKEVQSLEQGDV 259

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             + ++  W  FA GI   + I+ +     G F G+ + G L+L+
Sbjct: 260 --QGLIQRWTSFAVGINQPVRIERAGTVYAGIFKGIREDGELILD 302


>gi|194334980|ref|YP_002016840.1| biotin/acetyl-CoA-carboxylase ligase [Prosthecochloris aestuarii
           DSM 271]
 gi|194312798|gb|ACF47193.1| biotin/acetyl-CoA-carboxylase ligase [Prosthecochloris aestuarii
           DSM 271]
          Length = 327

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 110/236 (46%), Gaps = 5/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           F+    STN      A +G      + A  Q+ GRGR    W S  G NLY S++L  S+
Sbjct: 86  FYPIAVSTNALAKSFARNGAGEGAVVTADAQSGGRGRMQRVWSSPAGVNLYFSVILRPSV 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           S   L  +   +A A+   ++ ++P G  V IKWPND+LV  RKI GIL E  +  +   
Sbjct: 146 SPLRLPQIPLLVAAALHRALSFSVP-GLQVLIKWPNDMLVNGRKICGILCEMESEADMAH 204

Query: 137 AVVVGIGLNV--KHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            V+ GIG+NV  +  P +     TSL  E G       + +  F     + D W ++   
Sbjct: 205 FVIAGIGINVNLRELPHEIRGIATSLFLETGEEYSRSALLASFFNAFEPIYDAWLEEEDL 264

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            +++     ++   G L+ ++     + GR  G+   G LLL+   G  R I +G+
Sbjct: 265 GQVLECLDEYSYLKGRLVEVEQFNRRLRGRAAGISRTGELLLDLDNGERRVISSGE 320


>gi|218289184|ref|ZP_03493420.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240767|gb|EED07946.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 335

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 110/243 (45%), Gaps = 16/243 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           + ++ +STND  ++ A  G      + A  QT GRGRRD  W S +G ++ ++ + +  +
Sbjct: 93  WAESRASTNDTALELAEKGLPHGAVVTAGEQTGGRGRRDRAWASPRGGMWFTVFVRNPCA 152

Query: 78  ---KDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 LTLL+  A+  A+R         G  V+IKWPNDIL+  +K  GIL +      
Sbjct: 153 LRHAPDLTLLAALAVCRALRGE-------GVPVEIKWPNDILLGGKKTGGILAQIRAEGE 205

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPV-----TSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            +   V+GIGLN      + P  +     T L   G  ID   + + +  ++ R+    +
Sbjct: 206 MVDHAVIGIGLNANFPIEELPEEIRDRATTILHATGRPIDRPKVLARILAELDRLYRDLR 265

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G + +   W      IG  + + +    + G    ++  G L+LE   G  R + +G
Sbjct: 266 DGRGFQAVHAEWTALCSTIGHEVEVAIGDQRVRGIARSIEPDGSLVLETSPGVTRTVVSG 325

Query: 249 DIF 251
           ++ 
Sbjct: 326 EVL 328


>gi|170723923|ref|YP_001751611.1| biotin--protein ligase [Pseudomonas putida W619]
 gi|169761926|gb|ACA75242.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas putida W619]
          Length = 321

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 110/223 (49%), Gaps = 8/223 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             +TI STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 82  IHETIDSTNAEGLRLAGQGQAAPFLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVEG 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGT-DVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + +A   V+ +   +G  +V +KWPND+LV  +KIAGIL+E +     +
Sbjct: 142 GMRQLEGLSLVVGLA---VMRTLEGIGVKEVGLKWPNDVLVRGQKIAGILLELVGDPADV 198

Query: 136 QAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             VV+GIG+NV     V      TS++RE G  ID   + ++L Q +   L   ++  G 
Sbjct: 199 CHVVLGIGVNVNMQVNVHVDQQWTSIRREVGSPIDRNRLVAMLSQQLQHELARHRR-YGF 257

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
                 W       G  +++      I G  +GVD  G L LE
Sbjct: 258 AAFQEEWEQAHLWQGRNVSLVAGSTQIDGVVLGVDGQGGLRLE 300


>gi|126030326|pdb|2DVE|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, Mutation
           Arg51ala
 gi|126030327|pdb|2DVE|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, Mutation
           Arg51ala
 gi|146387427|pdb|2E10|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutation R51a
 gi|146387428|pdb|2E10|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutation R51a
          Length = 235

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 123/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGRLNAKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  +KIAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|304406909|ref|ZP_07388563.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343896|gb|EFM09736.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus curdlanolyticus
           YK9]
          Length = 327

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 121/249 (48%), Gaps = 13/249 (5%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD--KGNLY 67
           N +       D + ST +E  + A  G      ++A  Q  GRGR    W+S   KG ++
Sbjct: 77  NRFGRSLRLLDVVDSTQNEAQRWAEDGAPEGAIVIAEQQLGGRGRMGRSWVSPYTKG-IW 135

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
            SL++  S        L+   AVA+ RS+  ST   G ++ IKWPND+L+  +KI+GIL+
Sbjct: 136 MSLIMRPSTPIHFAPQLTLLTAVALCRSLRKST---GLEIGIKWPNDLLISGKKISGILL 192

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVA 181
           E+      ++ V+ G G++V     D P  +    TSL  + G     + + +    +  
Sbjct: 193 ESAAEDERIKYVIAGTGISVNLDISDYPEELLERATSLSIQAGRRFSREQVIADFLLEWE 252

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
           ++ DL+ KD G   I  LW   A  +   +T++   G + GR  G+ + G L L    G 
Sbjct: 253 QLYDLYLKD-GFGAIQTLWEALAVTLHQEVTVQTPQGQLEGRATGLHESGALELLLSSGE 311

Query: 242 VRQIFTGDI 250
           +R +F+G++
Sbjct: 312 LRLVFSGEM 320


>gi|253681244|ref|ZP_04862042.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum D
           str. 1873]
 gi|253562482|gb|EES91933.1| biotin-(acetyl-CoA-carboxylase) ligase [Clostridium botulinum D
           str. 1873]
          Length = 328

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 123/239 (51%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           +F+TI STN++  +    G L    +++  QT GRGR   +W+S K   ++ S++L  +I
Sbjct: 84  YFNTIDSTNNKAKELGAKGILEGTVVISEEQTGGRGRLGRQWVSPKFKGIWMSIILRPNI 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + ++   A A+ SVI     +G DV IKWPNDI++  +KI GIL E     N + 
Sbjct: 144 EPMEASKITQIAAAAVCSVIKE---LGIDVYIKWPNDIVLNNKKICGILTEMSGEINKIN 200

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDT 191
            +V+GIG+NV     D P  +    TS++ E G  I  K++ + +F     + D +  + 
Sbjct: 201 YIVLGIGINVNIDKEDFPEYIKDIATSIKIETGLNIQRKELIAKIFNKFEILYDEFINEG 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             ++ + + +  +  +G  + I      +  + + + + G L++E   G V +I +G++
Sbjct: 261 TIKKSIEICKGNSALLGKEVKIIRKSTEVFAKALTIAEDGELIVEYDDGKVEKIVSGEV 319


>gi|189219642|ref|YP_001940283.1| Biotin-(acetyl-CoA carboxylase) ligase [Methylacidiphilum
           infernorum V4]
 gi|189186500|gb|ACD83685.1| Biotin-(acetyl-CoA carboxylase) ligase [Methylacidiphilum
           infernorum V4]
          Length = 333

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 119/247 (48%), Gaps = 17/247 (6%)

Query: 8   CQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NL 66
           C+ P+  R + F  I ST+DE ++R   G+   L ++A  Q  GRGR+   W S     L
Sbjct: 94  CRIPW--RVKIFQVIDSTSDEVLRRGRRGEKEGLVVIAERQLRGRGRQGRSWESSLALGL 151

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           Y +LLL  S     L    FA+  ++  V A       +V IKWPNDI+V  RK+ GILI
Sbjct: 152 YMTLLLEPSF--QPLLPQQFALMSSVAVVEALNNLGLENVGIKWPNDIVVDSRKLGGILI 209

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQDVAR 182
           ET    N  + + +GIG+NV    +    P+    TS+  E G   ++ +     + +A 
Sbjct: 210 ETDRGINSKRFIAIGIGINVNQAEIHFSGPLQNKATSIYMERGQ-PMRRV-----ELMAE 263

Query: 183 VLDLWKKDTGRE--EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           VL    ++ G    EI   W          +  +     I G   G+D+ G+L++E++ G
Sbjct: 264 VLKRIDRNYGLSFFEIKEKWMKKMVNRDREVEFEEDGQRIKGIIRGIDEMGWLVVEKENG 323

Query: 241 CVRQIFT 247
            +++ F+
Sbjct: 324 SIQKFFS 330


>gi|72162952|ref|YP_290609.1| biotin--acetyl-CoA-carboxylase ligase [Thermobifida fusca YX]
 gi|71916684|gb|AAZ56586.1| biotin--acetyl-CoA-carboxylase ligase [Thermobifida fusca YX]
          Length = 299

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 109/246 (44%), Gaps = 18/246 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
               ++ STN E + +A  G      +V   QTAGRGR    + +  +  L  S+LL  +
Sbjct: 54  HVVPSLGSTNTELLAQARQGAPAGTVLVTEHQTAGRGRLGRSFHTPARAALTFSVLLRPT 113

Query: 76  ISKDSLT----LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +          L+  A A  +R V A       D ++KWPND+L   RKIAGIL E +  
Sbjct: 114 VPSARYGWLPLLMGAATAAGVRRVAA------VDAQVKWPNDVLAQDRKIAGILSEAVFG 167

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK 189
            +G  AVV+G GLNV     + P P  TSL   G  C+D   +   + Q  A     W +
Sbjct: 168 PSG-PAVVIGTGLNVTQTAAELPVPTATSLALAGASCVDRGLLLCAILQAFADRYTRWVE 226

Query: 190 DTGREEIMNL---WRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQI 245
             G  E   L   +R     +G  + + L   S++ G  +G+D  G L +    G    +
Sbjct: 227 HDGDAERSGLAAEYRSVCSTLGQQVRVHLPGNSVVEGTAMGIDTDGRLQVRSDGGRDHAL 286

Query: 246 FTGDIF 251
             GD+ 
Sbjct: 287 TVGDVV 292


>gi|159043879|ref|YP_001532673.1| biotin--acetyl-CoA-carboxylase ligase [Dinoroseobacter shibae DFL
           12]
 gi|157911639|gb|ABV93072.1| biotin--acetyl-CoA-carboxylase ligase [Dinoroseobacter shibae DFL
           12]
          Length = 251

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 113/238 (47%), Gaps = 14/238 (5%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           + STN E  + A S   G  WI+   QTA RGRR   W + +GN  A+L++    + D +
Sbjct: 19  VDSTNAEAARIAAS-LTGPTWILGLRQTAARGRRGRAWANPEGNFAATLVMRPFETTDQV 77

Query: 82  TLLSFAIAVAMRS--VIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
            L SF  A+A+    ++A+  P    V +KWPND+L+   K+AGIL+E++  +  L  + 
Sbjct: 78  ALRSFVAALALMDALILATGRP--ESVSLKWPNDVLLNGGKVAGILLESMGTQGNLT-LA 134

Query: 140 VGIGLN-VKHCPVDT----PYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
           +GIG+N +   P D+      P  SL  E G  I  +    LL    AR  +      G 
Sbjct: 135 IGIGVNLIAAPPADSVEPGALPPVSLAGETGIEIGPEGFLDLLAPAYAR-REASFTTYGF 193

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             I   W   A  +G  I  +     + G F G+ + G L+L    G  R +   D+F
Sbjct: 194 APIRTAWLDAAAHLGAPIRARTMTEEVHGTFDGLAEDGALILTTASGR-RTLPAADVF 250


>gi|269958954|ref|YP_003328743.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma centrale str.
           Israel]
 gi|269848785|gb|ACZ49429.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma centrale str.
           Israel]
          Length = 242

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 120/234 (51%), Gaps = 11/234 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN E ++ A SG      ++A  QT+G GR   +W S KGNLY S++        +L+ 
Sbjct: 14  STNLEAIELAQSGAPDGTVVIADEQTSGTGRYGREWHSPKGNLYCSIITRMDAQVAALSF 73

Query: 84  LS-FAIAVAMRSVIAST--LPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           LS  A+ V +  V  +         ++ KWPND++V  +KI+G+L++T  +   +   V 
Sbjct: 74  LSSLAVGVTIEQVFEAYNCSTKKALIRYKWPNDVMVDGKKISGVLVKTKMIGGEIDWAVC 133

Query: 141 GIGLNVKHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDLWKKDTGREEIMN 198
           GIG+N+ + P   P    SL      + L   ++  L+ ++ A++ D+  K+ G  ++ +
Sbjct: 134 GIGVNI-YAP---PQYAASLHNHIPELKLSNLELLDLMLKNFAKLSDVL-KNMGFAQLRS 188

Query: 199 LWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           LW       GD I I  +  +++ G+FV ++  G ++LE   G +  +  G+I 
Sbjct: 189 LWMNRGHRPGDRICITTNNNTVMEGKFVDINTQGAMVLESDSGTLVSVNYGEIL 242


>gi|225388543|ref|ZP_03758267.1| hypothetical protein CLOSTASPAR_02279 [Clostridium asparagiforme
           DSM 15981]
 gi|225045388|gb|EEG55634.1| hypothetical protein CLOSTASPAR_02279 [Clostridium asparagiforme
           DSM 15981]
          Length = 326

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 114/237 (48%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           ++D+  STN    + A  G      +VA  QTAG+GRR   W +  G  ++ +L+L   +
Sbjct: 83  YYDSTDSTNTRARQLAEQGAPHGTLVVADSQTAGKGRRGRHWEAPDGTGIWMTLILRPEL 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                ++L+   A+A+   I      G +  IKWPNDI+   +K+ GIL E       ++
Sbjct: 143 EPQRASMLTLVTALAVADAIRGL--TGLEAAIKWPNDIVCGGKKVVGILTEMSTEAEWIR 200

Query: 137 AVVVGIGLNVKH--CPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            V+VGIG+NV     P +     TSL+ E G  +    + + +     +   L++K    
Sbjct: 201 YVIVGIGINVNMDGFPGELGKTATSLKLELGRGVKRSPLVAAVMNAFEKYYALFEKAGDL 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +++ +  ++   G  + +    G   G  +G+D  G LL++  +G V+ + +G++
Sbjct: 261 SGLVDTYNRWSANTGRQVRVLDPAGEYQGEALGIDSQGALLVKCSEGEVKSVISGEV 317


>gi|225874145|ref|YP_002755604.1| biotin--acetyl-CoA-carboxylase ligase [Acidobacterium capsulatum
           ATCC 51196]
 gi|225792370|gb|ACO32460.1| biotin--acetyl-CoA-carboxylase ligase [Acidobacterium capsulatum
           ATCC 51196]
          Length = 272

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 119/260 (45%), Gaps = 21/260 (8%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
           N +  + P++ R   F  I+STN   M    +G       VA  QT GRGR  + W S  
Sbjct: 14  NAALAETPFAGRITLFPAITSTNTHAMAEGDAGAAHGSVYVAEEQTGGRGRGAHAWASPP 73

Query: 64  GN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           G+ LY S+LL   ++      +S A  +A+R  +     +  D  ++WPND+++ ++K  
Sbjct: 74  GSGLYVSVLLRPQMAPGDALWISLAAGLAVRHAVEEMTTLQAD--LRWPNDLMLGKKKFC 131

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC--PVDTPYPVTSLQREGGCI-DLKDIFSLLFQD 179
           GIL E       ++ VVVGIG+NV     P       TSLQ E G     +D+   L Q 
Sbjct: 132 GILTEMHAEATRVRHVVVGIGINVLQMAFPEGLDAMATSLQIETGLQWSRQDLLVALLQA 191

Query: 180 VARVL----DLWKKDTGREEIMN-LWRCFACGIGDLITIKLSYGSILGRFVGVDDF---- 230
           + R +    D  + D  ++ I+  + R  +   G  + +    G     F GV D     
Sbjct: 192 LDREMSALGDAMRMDAAKQSILERIERASSWVRGKRVRVDEGAG-----FAGVTDGLNAQ 246

Query: 231 GYLLLEEKKGCVRQIFTGDI 250
           G+L +  + G +R + +G +
Sbjct: 247 GFLQVRTQDG-IRTVLSGGV 265


>gi|302345193|ref|YP_003813546.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella melaninogenica
           ATCC 25845]
 gi|302149551|gb|ADK95813.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella melaninogenica
           ATCC 25845]
          Length = 263

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 115/233 (49%), Gaps = 13/233 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            D + STN        + D     +VA  QTAG+G+  N W S+ G   L++ L+    +
Sbjct: 27  LDAVDSTNAYLRTYTPAEDEPMTVVVADYQTAGKGQGTNTWESEAGKNLLFSVLVHPTML 86

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S  LLS A A+A++  +A    V  D+++KWPNDI    +K++G LIET      ++
Sbjct: 87  PVRSQFLLSEAGALALKEALADY--VKEDIRLKWPNDIYWKDKKLSGTLIETKLASGRIK 144

Query: 137 AVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLL---FQDVARVLDLWKKDT 191
             V G+GLNV       D P PV+  Q  G  +D +++ + +   F ++ R+L++     
Sbjct: 145 DCVFGVGLNVNQEAFHSDAPNPVSLCQILGHEVDKEELLNKIIKKFSELYRLLEM----G 200

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           G  +I  ++       G     + + G   G  V V+D G+L+L +  G +R+
Sbjct: 201 GYNDISAMYHEALYRRGGFHKFRDADGEFEGAIVEVEDDGHLILRDSNGMIRE 253


>gi|148642826|ref|YP_001273339.1| biotin-[acetyl-CoA-carboxylase] ligase/biotin operon regulator
           bifunctional protein, BirA [Methanobrevibacter smithii
           ATCC 35061]
 gi|222445057|ref|ZP_03607572.1| hypothetical protein METSMIALI_00674 [Methanobrevibacter smithii
           DSM 2375]
 gi|261350374|ref|ZP_05975791.1| biotin-[acetyl-CoA-carboxylase] ligase [Methanobrevibacter smithii
           DSM 2374]
 gi|148551843|gb|ABQ86971.1| biotin-[acetyl-CoA-carboxylase] ligase/biotin operon regulator
           bifunctional protein, BirA [Methanobrevibacter smithii
           ATCC 35061]
 gi|222434622|gb|EEE41787.1| hypothetical protein METSMIALI_00674 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861157|gb|EFC93455.1| biotin-[acetyl-CoA-carboxylase] ligase [Methanobrevibacter smithii
           DSM 2374]
          Length = 305

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 123/239 (51%), Gaps = 11/239 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            F+ + STN      +++G      +++  QT  RGR    W S  G ++ S++L  +++
Sbjct: 66  IFNEVMSTNTIAKFLSMNGVGNGAVVISEKQTKARGRSGKNWESPLGGVWLSIILNPNVT 125

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              + L++ A  VA+ + +     +G  + +IKWPNDIL+  +K+ GIL E +   N ++
Sbjct: 126 HSKIPLITLATGVAVENTLKR---IGIENAEIKWPNDILIQDKKVCGILTEAITSFNTIE 182

Query: 137 AVVVGIG----LNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           +V++G+G    +N ++ P +    +T+L  E G  +D   +  L  ++  ++ + +  + 
Sbjct: 183 SVIIGVGIDANINTENFPQELQENMTTLNEEIGEKVDENLLIRLFLEEFEKISEQFINEE 242

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             E I+  WR  +  IG ++ +   +     G  +G+   G L++E+  G + ++ +G+
Sbjct: 243 -YETILKEWRKNSYTIGKIVEVHEPFSKPYDGYVLGISRDGSLVVEKIDGTLEKVISGE 300


>gi|308274536|emb|CBX31135.1| hypothetical protein N47_E46470 [uncultured Desulfobacterium sp.]
          Length = 305

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 114/236 (48%), Gaps = 7/236 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
            +F   SST D     A  G      ++A  Q  GRGR    W+S +G LY +L+L   I
Sbjct: 75  HYFPETSSTMDIARDLARKGCPHYTIVIAGRQKKGRGRLSRIWLSSEGGLYFTLVLRPDI 134

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + ++F  +V +   +     +  D K+KWPNDILV  +KI+G+L E     + + 
Sbjct: 135 PAAHASRITFLASVVLAQTLRKLYDI--DAKVKWPNDILVGGKKISGMLSEMEAEADMVS 192

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
            + +GIG+NV + P       TSL++ +G     K++ S+   +    L+    D    +
Sbjct: 193 FINIGIGVNVNNDPSIKEPVATSLKKLKGKEFLRKELLSVFLDEFENRLNTKSFD----D 248

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           I++ W+ +   +   + I     +  G  V VD+ G L+L+ + G ++++  GD F
Sbjct: 249 IISQWKQYTMTLNQPVKIVTYRDTYEGIAVDVDENGALILKLENGTLQKVVCGDCF 304


>gi|212224051|ref|YP_002307287.1| biotin--protein ligase [Thermococcus onnurineus NA1]
 gi|212009008|gb|ACJ16390.1| biotin-protein ligase [Thermococcus onnurineus NA1]
          Length = 340

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 121/237 (51%), Gaps = 18/237 (7%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           F  + STN+     AL    G + +VA  QTAG+GR+   W S +G L+ S++L      
Sbjct: 112 FHEVDSTNEYAKLIALDEREGTV-VVADRQTAGKGRKGRTWASPEGGLWMSVILKPKAEP 170

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
             L+ L F  A+A   V+ +    G +  IKWPND+ V  RKI G+L E    + G + V
Sbjct: 171 KHLSKLVFIGALA---VVDTLWKFGIEAGIKWPNDVWVNGRKICGVLTEG---RIG-EFV 223

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQRE--GGCIDLKDIFSLLFQDVARVLDLWKK--DTGR- 193
           ++GIGLNV +   +    + +  RE  G  + L ++F  L ++    LD W +    GR 
Sbjct: 224 ILGIGLNVNNDAPEELRKMATSMREFLGREVSLSEVFHALIRN----LDHWYRLFLNGRY 279

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            EI++  +  +  +G  + I      ++GR V +D  G L+LE  KG VR +  GD+
Sbjct: 280 AEIISALKERSIVLGKEVKIIDDETELVGRAVDIDVDGALILETPKGRVR-VLHGDV 335


>gi|254481030|ref|ZP_05094276.1| biotin-(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2148]
 gi|214038825|gb|EEB79486.1| biotin-(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2148]
          Length = 313

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 112/247 (45%), Gaps = 11/247 (4%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYAS 69
           P     +  D I STN E M +  +G        A  QTAGRGRR  +W+S    NLY S
Sbjct: 65  PLLAMLDLRDAIGSTNAEAMSQIAAGRGSGYVCTAEQQTAGRGRRGREWVSPYARNLYLS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
            +         L  +S A+ V + R++ A  +P    V++KWPND+L    K+ GIL+E 
Sbjct: 125 AVWEYEQGAAVLEGMSLAVGVVVARALAACGVP---PVRLKWPNDLLYEGAKLGGILLEM 181

Query: 129 LNLKNGLQAVVVGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARV 183
                G   VVVGIG+NV         +D  +   S    G  +D   + + +  ++  +
Sbjct: 182 TGDPAGACQVVVGIGVNVSMPGKAAEGIDQSWTDVSRINSGSPLDRNLLLAAILDELLPM 241

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L  ++  TG E   + W       G  + +        G+ +GVD  G LLL+     V+
Sbjct: 242 LASFEA-TGFEAWRDEWLLLDAYAGADVVLHSGNKKTAGKAMGVDKRGALLLQTVSAGVQ 300

Query: 244 QIFTGDI 250
            I+ G+I
Sbjct: 301 AIYGGEI 307


>gi|78100836|pdb|1WPY|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3 In Complex With
           Biotin
 gi|78100837|pdb|1WPY|B Chain B, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase)
           Ligase From Pyrococcus Horikoshii Ot3 In Complex With
           Biotin
 gi|114793881|pdb|2FYK|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Adp And Biotin
 gi|114793882|pdb|2FYK|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Adp And Biotin
 gi|126030299|pdb|2DTO|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 Complexed With Atp And Biotin
 gi|126030300|pdb|2DTO|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 Complexed With Atp And Biotin
          Length = 235

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 122/237 (51%), Gaps = 19/237 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTXGHGRLNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  +KIAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
              +V+GIGLNV +     P   TS + E G  + L  +F  L  ++ R+   + K+   
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSXKLELGSEVPLLSVFRSLITNLDRLYLNFLKNP-- 175

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 176 XDILNLVRDNXI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|332799851|ref|YP_004461350.1| biotin/acetyl-CoA-carboxylase ligase [Tepidanaerobacter sp. Re1]
 gi|332697586|gb|AEE92043.1| biotin/acetyl-CoA-carboxylase ligase [Tepidanaerobacter sp. Re1]
          Length = 331

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 104/235 (44%), Gaps = 4/235 (1%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           ++    STN++  K A  G      ++A  Q   RGR    W S  G L+ S++L  +  
Sbjct: 96  YYSITGSTNEDAKKLAREGVPDGTLVIAEKQHKARGRMGRAWNSPDGGLWLSVILRPNFV 155

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                 L+   AVA+   I  T   G   +IKWPNDIL   +K+ GIL E     + +  
Sbjct: 156 PMDAPKLTIMTAVAVTEAIIQT--TGIHAEIKWPNDILADGKKVCGILTEMSAEMDAINH 213

Query: 138 VVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           V++G+G+NV +   P +     TSL++  G    +               +  ++ G  E
Sbjct: 214 VIIGVGINVNNNDFPDELKGIGTSLKQIKGENINRLALLSALLKKLEYYYIKAENEGFHE 273

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +   WR     +G  I I        G  + +D+FG LL+  + G V ++ +GD+
Sbjct: 274 VFEKWRSLCINLGKKINITGKNDVFEGTAIDIDEFGALLVRTENGEVVRVLSGDV 328


>gi|317128613|ref|YP_004094895.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus cellulosilyticus DSM
           2522]
 gi|315473561|gb|ADU30164.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus cellulosilyticus DSM
           2522]
          Length = 323

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 117/243 (48%), Gaps = 17/243 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + DT++ST     K    G      IVA+ QT+GRGR   +W S     ++ SL++  +I
Sbjct: 84  YEDTVTSTQQVAYKLLGEGAPHGTLIVANEQTSGRGRLGREWYSPANTGIWMSLIMRPNI 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AVA+   I        DV+IKWPND++   +KIAGIL E  +  + ++
Sbjct: 144 EMQQTPQLTLVAAVALARAIKEA--TNYDVQIKWPNDLIFNGKKIAGILTEMQSDPDRVK 201

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFS--LLFQDVARVLDLWKKDTG 192
           +V++GIG+NV     P       +SL      ++ ++ F    + +   R    W   T 
Sbjct: 202 SVIIGIGINVNQQTFPESIANIASSL-----SLETRETFHRVAIIEHFLREFQ-WLYHTY 255

Query: 193 REE----IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            E+    I  LW   A  IG+ I  K + G + G   G+ D G LLL++ +G   +I++ 
Sbjct: 256 LEKGFSFIKPLWEARAISIGEEILAKTANGELKGVAEGISDEGVLLLKDSEGNSHRIYSA 315

Query: 249 DIF 251
           DI 
Sbjct: 316 DIH 318


>gi|237755774|ref|ZP_04584377.1| biotin-(acetyl-CoA-carboxylase) ligase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692062|gb|EEP61067.1| biotin-(acetyl-CoA-carboxylase) ligase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 318

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 126/246 (51%), Gaps = 21/246 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           +Y +F+ I STN +  KR    D     I A  QTAG+GR++ KWIS KG  LY +++L 
Sbjct: 79  KYLYFEEIDSTNIQA-KRENYED--GAVIFAESQTAGKGRKNRKWISHKGLGLYFTIVLK 135

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I  + L+  S     ++  V+ +   V   +KIKWPNDI +  +KIAG LIE+    N
Sbjct: 136 PEIEVNYLSHFSLLFNYSVFKVLRNY--VNGKIKIKWPNDIYLNGKKIAGFLIESSIENN 193

Query: 134 GLQAVVVGIGLNV----KHCPVDTPYPVTSLQ-REGGCIDLKDIFSLLFQDVAR-VLDLW 187
            +  ++VG+G+NV    K    D     TSL+  EG     K+IF  + Q + +  L   
Sbjct: 194 SISKLIVGVGINVNQSIKDFEEDIKEVATSLKIEEGKTFSRKEIFLDILQQIEKDYLKFI 253

Query: 188 KK---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           K+   D  + E   LW        D++ ++     + G+ +G+++ G L+L   +  +R 
Sbjct: 254 KENYLDIKKIEENLLWLN-----QDVMILEDGKPILSGKLIGLNEDGSLMLRTDED-LRF 307

Query: 245 IFTGDI 250
           ++ GD+
Sbjct: 308 VYVGDL 313


>gi|298674486|ref|YP_003726236.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalobium evestigatum
           Z-7303]
 gi|298287474|gb|ADI73440.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalobium evestigatum
           Z-7303]
          Length = 325

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 113/240 (47%), Gaps = 18/240 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            FD + STN+E  + A   D G + I++  Q +GRGR    W S +G +Y S++L  +I 
Sbjct: 87  HFDELESTNEEAKRLAPDEDEGTV-IISETQKSGRGRMGRDWTSPRGGIYMSVILKPTIP 145

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
                 L+    +A+ + I +   +G +  IKWPNDIL+  RK+ GIL E       +  
Sbjct: 146 ASHAYHLTLVAGIAVANAIRN---LGINACIKWPNDILINNRKVCGILTEINAEIEKIDY 202

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK--------- 188
           +V+G+G+N     VDT    + L+   G   LK       + V+ V +L           
Sbjct: 203 IVLGMGINAN---VDTGMFSSELKE--GSTSLKSELGKPVERVSFVQNLLYEFEQEYIKF 257

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K     +I++ W   +  IG  ++I      + G+ +GV   G L++++  G   +I  G
Sbjct: 258 KSKPFNDIVDEWISLSDTIGKEVSIMTPSKMVEGKAIGVTKNGALIVKKDDGEKEEIIAG 317


>gi|218658530|ref|ZP_03514460.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli
           IE4771]
          Length = 109

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           FR+E     SSTN EC+ RA +GD GNLW+ A  QT GRGRR   W+S++GNLYASLLLI
Sbjct: 14  FRHEALSETSSTNSECLARARAGDPGNLWVTAERQTGGRGRRGRLWVSERGNLYASLLLI 73

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD 105
           D    + L  L  A+AVA+   I   LP G +
Sbjct: 74  DPAPMERLGSLPLAVAVAVHQAIRQVLPPGAE 105


>gi|82523996|emb|CAI78675.1| Biotin-(acetyl-CoA carboxylase) ligase [uncultured gamma
           proteobacterium]
          Length = 336

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 120/248 (48%), Gaps = 17/248 (6%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASL 70
           Y  + + F  I STN   +  A          +A  Q++GRGRR   WIS   GNLY SL
Sbjct: 86  YLQQLDVFYDIESTNAYLLDVAKKSPQTAHACLAEQQSSGRGRRGRHWISPFGGNLYFSL 145

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           L   S     L  LS A+AVA+  V+A+   +G     +KWPNDILV  +K+AGIL+E  
Sbjct: 146 LWQFSAGASQLGGLSLAVAVAVMRVLAA---LGLRSAGVKWPNDILVNGKKLAGILLEVS 202

Query: 130 NLKNGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL 184
               G  AVV+G+GLNV+        +D P+  T L  E G         L  Q +  ++
Sbjct: 203 GEAAGPCAVVIGVGLNVRGGGQAMSALDQPW--TDL--ETGLGKPVSRNHLASQLICHLI 258

Query: 185 DLWK--KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           D+ +  +  G    +  W  +       + +    G+I G   GVD+ G L+L   +G V
Sbjct: 259 DVLREFETGGLSPFLKEWAIYDVFADSKVVLNTPQGNIHGIARGVDETGALILVTTEG-V 317

Query: 243 RQIFTGDI 250
           ++  +G++
Sbjct: 318 QRYHSGEV 325


>gi|323489709|ref|ZP_08094936.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Planococcus donghaensis MPA1U2]
 gi|323396840|gb|EGA89659.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Planococcus donghaensis MPA1U2]
          Length = 328

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 117/243 (48%), Gaps = 15/243 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
           E+ ++ +ST     + A  G      ++   QTAGRGR   KW S  K  ++ S++L  +
Sbjct: 87  EYVESCASTQIIAHQLAQEGAPDGTVVLTETQTAGRGRMARKWDSAAKKGVWMSIILRPN 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++       +   AVA+   I     +    KIKWPNDIL+  +K  GIL E  +  +G+
Sbjct: 147 VAPQKAPQFTLVTAVAIVRAIEEVTKL--QPKIKWPNDILLNGKKCTGILTELQSDADGI 204

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK- 189
           QA+++GIGLNV     D    V    TSL+   G  ++ +     L Q V   ++L+ + 
Sbjct: 205 QALIIGIGLNVNQEQEDFDPEVQDIATSLKMTSGETVNRQK----LVQSVLFYMELYTQM 260

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             D G   +  LW  ++  IG  +  +++  ++ G   G+ D G L L    G +  I++
Sbjct: 261 YIDEGFGMLKILWESYSTTIGHPVRARMTNHTLEGIAEGITDEGVLQLRTSDGKLHGIYS 320

Query: 248 GDI 250
            DI
Sbjct: 321 ADI 323


>gi|222151351|ref|YP_002560507.1| hypothetical protein MCCL_1104 [Macrococcus caseolyticus JCSC5402]
 gi|222120476|dbj|BAH17811.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 324

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 121/240 (50%), Gaps = 15/240 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSIS 77
           F+ + ST DE  K ALS +     +++  QT GRGR    W S     L+ S++L   IS
Sbjct: 90  FEELKSTQDEAEKIALS-ESQPFIVISEKQTDGRGRFKRHWSSQPNTGLWMSIVLQPDIS 148

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
              LT  +  IA+A+   + S     TDVKIKWPNDI + ++K++G L E    ++ +  
Sbjct: 149 LQKLTTFNLFIALALAKTVGS---YHTDVKIKWPNDIYLNEKKLSGFLTEIKGSQDNITQ 205

Query: 138 VVVGIGLNVKHCPVDTPYPV----TSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
           ++ GIG+N+     D P  +    TSL  E G  ID  +    L  +V +   L+   T 
Sbjct: 206 IICGIGVNLNTQRTDFPNELESTATSLHIETGNNIDRYEFLERLILNVEKYYYLFLTGTF 265

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGS--ILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             EI + +  +   I D I +K + GS  I+G+   ++D G L ++  +G + +  + DI
Sbjct: 266 -SEIKDEYESYTL-IFDRI-LKYTEGSRVIIGQAESLNDDGTLNVKSAEGDMHRFISADI 322


>gi|167462325|ref|ZP_02327414.1| BirA [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322381851|ref|ZP_08055805.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon
           repressor-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154239|gb|EFX46561.1| biotin acetyl-CoA-carboxylase ligase and biotin regulon
           repressor-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 326

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 111/240 (46%), Gaps = 9/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
            + +  +ST +        G      +VA  Q  GRGR    W S KG  +Y SLLL   
Sbjct: 83  HYAEETASTQNLAASLVSEGAKHGTLVVADAQNQGRGRHGRHWFSPKGKGIYMSLLLRPK 142

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +       L+   AVA+   I      G ++ IKWPND+L+  RK++GIL+E       L
Sbjct: 143 VPIFFAPQLTLVAAVALCRTIQKLY--GLNIGIKWPNDLLIGGRKVSGILLEISGEDERL 200

Query: 136 QAVVVGIGLNVK----HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
           + ++ GIG++        P D     TSL+ E G  +D +++ +   Q+  ++  L+  +
Sbjct: 201 KHIIAGIGISANIEAGDFPEDLREVATSLEAELGYKVDREELIAAFLQEFEQIYVLY-ME 259

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   I  LW   +  +   I ++ S G   G    +DD G L++      + ++++G++
Sbjct: 260 KGFAPIRTLWEAQSISLHRTIRVRTSDGEFEGIAECLDDAGALVVRTPGNKIYKMYSGEV 319


>gi|290969237|ref|ZP_06560762.1| biotin-(acetyl-CoA-carboxylase) ligase [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290780743|gb|EFD93346.1| biotin-(acetyl-CoA-carboxylase) ligase [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 328

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 112/240 (46%), Gaps = 11/240 (4%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
           + + I STN    K A SG      ++A  Q  GRGR D  ++S     L+ SL+L  S 
Sbjct: 84  YLEKIDSTNTYAKKIADSGAPEGTVVLAEEQRGGRGRLDRSFLSPFAQGLWFSLILRPSF 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           S   ++ L+   AVA+   +      G T+  IKWPNDILV  +K+ GIL E       +
Sbjct: 144 SPMEVSKLTLMAAVAVTKALHRC---GLTECGIKWPNDILVHDKKVVGILTELHASAEKI 200

Query: 136 QAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+GIG+NV    K  P +    VTS   E       DI   + +++     +   + 
Sbjct: 201 NYVVMGIGINVSLTKKMLPRELKRIVTSFAMENVEALRADILKTVLEELEHYY-ISVSEN 259

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G   I+  W+  +C +   + +        G+ VG+D+ G LL+E  KG  R +  GD+ 
Sbjct: 260 GFAPIIEEWKVLSCMMNREVEVSAIDRIFKGKAVGLDEDGNLLVETNKGTER-VLAGDVH 318


>gi|282163048|ref|YP_003355433.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Methanocella paludicola SANAE]
 gi|282155362|dbj|BAI60450.1| biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
           [Methanocella paludicola SANAE]
          Length = 320

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 117/238 (49%), Gaps = 17/238 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL---ID 74
             +   STN    + A  G      ++A  Q+ G+GR   KW++  G+L  S++L   ID
Sbjct: 84  HLNVTGSTNTVARQVAERGVEEGTVVLAETQSHGKGRLGRKWVAKPGSLAMSVILKPAID 143

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +   S+TL+      A  SV  +    G +  IKWPND+LV  +KI GIL E     + 
Sbjct: 144 PMHASSITLM------AAVSVTKALRGAGLEAAIKWPNDVLVNGKKICGILTEMSAETDI 197

Query: 135 LQAVVVGIGLNVKH-CPVDTPYPVTS-LQREGGCIDLKD-IFSLLFQDVARVLDLWKKDT 191
           +  +++GIG+NV +  P++T   + + L RE   +     +  +L +D      L  K+ 
Sbjct: 198 VNFIILGIGVNVNNDVPLETATTMKAELSREVDRVKFTQLLLEMLEEDY-----LTFKEE 252

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           G   I+  WR ++  +G L+ +      + G    VD+ G LL++   G +R+I +GD
Sbjct: 253 GFTPILWSWRRYSDTLGRLVEVTYQDEVVTGVAQDVDEDGSLLVKTADGSIRKIVSGD 310


>gi|89093743|ref|ZP_01166689.1| biotin operon repressor [Oceanospirillum sp. MED92]
 gi|89081873|gb|EAR61099.1| biotin operon repressor [Oceanospirillum sp. MED92]
          Length = 324

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 118/236 (50%), Gaps = 11/236 (4%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSISKD 79
           TI STN   MK +  GD      +A  QT GRGRR   W+S    NLY SL+        
Sbjct: 88  TIPSTNALAMKESQRGDCHGRIYLAEQQTEGRGRRGRTWVSPFARNLYFSLVWRFEQGAA 147

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
           ++  LS  + +AM   +   L +   V++KWPND+L   RK+AGIL+E     +G   VV
Sbjct: 148 AIEGLSLLVGLAMVKAM-EKLKIDA-VQLKWPNDLLSQGRKLAGILLEVHGEASGQCQVV 205

Query: 140 VGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           +G+G+NV+        +D P+ +      G  +D   + + +  ++   L+ ++++ G  
Sbjct: 206 IGVGVNVEMPRDLGEQIDQPW-IDLKTVSGRPVDRNLLLAEILNELVLRLNQFERN-GFA 263

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           E ++ W  +       IT+++   +I G   G+D  G LLLE + G +R    G++
Sbjct: 264 EFVDEWHGYHAMQSQPITLQVGSKAIEGVCQGIDTSGALLLESEDG-LRAYHGGEV 318


>gi|327404646|ref|YP_004345484.1| biotin/acetyl-CoA-carboxylase ligase [Fluviicola taffensis DSM
           16823]
 gi|327320154|gb|AEA44646.1| biotin/acetyl-CoA-carboxylase ligase [Fluviicola taffensis DSM
           16823]
          Length = 253

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 113/231 (48%), Gaps = 20/231 (8%)

Query: 22  ISSTNDECMKRALSGDLGN-LWIVASCQTAGRGRRDNKWISDKGNLYAS--LLLIDSISK 78
           + STN+   K  L G L +   I+A  QTAGRG+R   W S     +     L  D +S 
Sbjct: 12  VDSTNNYAAKLLLEGKLSHGTVILAEYQTAGRGQRGRNWQSSAAKQFTGTYFLKTDFLSV 71

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG-LQA 137
           D L  L+  +A+++R +I S       V IKWPNDI +  +KIAGILIET N KNG ++ 
Sbjct: 72  DHLCYLNMCVALSVRELIQSY--TKKKVSIKWPNDIFIENQKIAGILIET-NWKNGRVEG 128

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGG----CIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            +VGIG+N+   PV +    TSL+   G     +++ D  S    +    L   + D  +
Sbjct: 129 AIVGIGINI--SPVQSVLHATSLEEISGKSPETLNVLDFLSRYLNEFYEHLQHAEFDYLK 186

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSI--LGRFVGVDDFGYLLLEEKKGCV 242
           +     +  F       IT++    ++   G   GVD  G LL+ EK G V
Sbjct: 187 KR----YESFLWNKDLEITMEERQDTVPFQGIIRGVDQIGNLLV-EKNGIV 232


>gi|153853509|ref|ZP_01994889.1| hypothetical protein DORLON_00878 [Dorea longicatena DSM 13814]
 gi|149753664|gb|EDM63595.1| hypothetical protein DORLON_00878 [Dorea longicatena DSM 13814]
          Length = 326

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 108/237 (45%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           ++D I STN+   +   +G       VA  Q AG+GRR   W S  G+ +Y ++LL   I
Sbjct: 83  YYDEIDSTNNRAKEAGDNGAAHGTLFVADMQVAGKGRRGRVWKSPSGSSIYMTILLYPDI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+  +A+A+   I      G + KIKWPNDI+V  RKI GIL E     + + 
Sbjct: 143 PPVKAPQLTLLMAIAVAEGIQEV--TGLETKIKWPNDIVVNGRKICGILTEMSTEIDYIN 200

Query: 137 AVVVGIGLNVKH--CPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV+G G+NV     P D     +SL+ E G  +   ++ + + +   +  +++ K    
Sbjct: 201 HVVIGAGINVNQDTFPDDIKATASSLKLELGKSVKRSELIAAVMKSFEKCYEIFIKTEDL 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +  L+          + +           +G++  G L++    G  ++I+ G++
Sbjct: 261 SGLQELYNSMLVNRDQEVKVLEPGNEYKAHAIGINQTGELIVRTPDGKEKEIYAGEV 317


>gi|157692743|ref|YP_001487205.1| bifunctional transcriptional
           regulator/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus pumilus SAFR-032]
 gi|157681501|gb|ABV62645.1| bifunctional transcriptional
           regulator/biotin--[acetyl-CoA-carboxylase] ligase
           [Bacillus pumilus SAFR-032]
          Length = 327

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 117/246 (47%), Gaps = 20/246 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL 72
           F+ E   T    +D   + A  G L    +V+  QT G+GR    W S  G  ++ SL+L
Sbjct: 88  FQKEVASTQLIAHDLVNEGAPHGTL----VVSDHQTNGKGRLQRAWHSPNGTGIWMSLIL 143

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              I       ++   +VA+   I      G    IKWPNDIL+  +K+ GIL E     
Sbjct: 144 RPEIPLHKAPQMTLLASVAIAEAIKDQ--TGLRPSIKWPNDILLNGKKVVGILTELKAEA 201

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIFSLLFQDVA----RVL 184
           + + AV++G G+NV     D P  +    TSL+ E    D  D  +L+ Q ++    R  
Sbjct: 202 DQVHAVIIGPGINVNQTADDFPDELKNVATSLRME--LNDKVDRAALIQQIMSTFEKRYA 259

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           D  K   G   I  LW  +A  IG  I  +   G   G+ +G+++ G LLLE ++G +++
Sbjct: 260 DYIKH--GFAPIKQLWESYAMTIGQHIVARTVNGQYTGKALGINEEGVLLLETEEG-IQK 316

Query: 245 IFTGDI 250
           I++ DI
Sbjct: 317 IYSADI 322


>gi|291563815|emb|CBL42631.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region
           [butyrate-producing bacterium SS3/4]
          Length = 326

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 112/237 (47%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           FF+   STN+E  + A  G       VA  Q  G+GRR   W S  G  ++ S+LL   I
Sbjct: 83  FFEETDSTNNEIRRLAEQGAPHGTLAVAERQLGGKGRRGRVWTSPAGVGIWMSMLLRPQI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              + ++L+  +A++ R  I      G   +IKWPND+++ ++KI GIL E       +Q
Sbjct: 143 DPMAASMLTLVMALSTRRGIEKA--TGLKSEIKWPNDLVLNKKKICGILTEMSTELMEIQ 200

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLK-DIFSLLFQDVARVLDLWKKDTGR 193
            V+ G G+NV     P D     TSL+ E G I  + +I + + +      D + +    
Sbjct: 201 YVIPGTGINVNQMEFPDDIKATATSLRIESGKIQKRSEIIAAIMEAFEGYYDTFIETQDM 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             ++  +      +G+ + +    G   G   G++  G LL+    G +++I +G++
Sbjct: 261 SGLIEEYNANLVNLGNEVCVLDPAGEYRGVSEGINKEGALLVRLSDGTLKEIISGEV 317


>gi|282897103|ref|ZP_06305105.1| Biotin--acetyl-CoA-carboxylase ligase [Raphidiopsis brookii D9]
 gi|281197755|gb|EFA72649.1| Biotin--acetyl-CoA-carboxylase ligase [Raphidiopsis brookii D9]
          Length = 286

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 120/244 (49%), Gaps = 17/244 (6%)

Query: 6   SECQNPYSFR-YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG 64
           SE Q P+ F     FD++ STN    +    G+     ++A  QT G+G+   +W+S +G
Sbjct: 18  SEHQQPHLFSSVHVFDSLPSTNQMAWQLLSQGEKQGCVVIAQQQTGGKGQWGRQWLSPQG 77

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
            LY SL +   +   +   L+ A A  + S + +    G + +IKWPND+++ +RK+ GI
Sbjct: 78  GLYISLGIPLQLEVANGYQLTLASAWGIASQLEN---CGVEARIKWPNDLVLNRRKLGGI 134

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE--GGCIDLKDIFSLLFQDVAR 182
           L ET   +  +  VV+G+G+N K+   +T   + S Q E       L+ + + +   +  
Sbjct: 135 LTETKVQQGQITQVVIGVGVNWKNPVPETGINLHSWQNENLSPISGLEMLAAQVLLGIGF 194

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG----------SILGRFVGVDDFGY 232
            LD W+K+ G   +++ +      +GD + + + +           S+L   VGV   G+
Sbjct: 195 GLDCWQKE-GISILLSRYLDLLINLGDQVYVNIPFSKGNEDHWLGTSVLATVVGVTPQGH 253

Query: 233 LLLE 236
           L L+
Sbjct: 254 LRLQ 257


>gi|167031483|ref|YP_001666714.1| biotin--protein ligase [Pseudomonas putida GB-1]
 gi|166857971|gb|ABY96378.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas putida GB-1]
          Length = 319

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 112/225 (49%), Gaps = 12/225 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
             +++ STN E ++ A  G      ++A  Q+AGRGRR  +W+S    NLY SL+L    
Sbjct: 80  IHESVDSTNAEGLRLANQGQAAPFVVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDG 139

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L  LS  + VA MR++ A  +    DV +KWPND+LV  +KI GIL+E +     +
Sbjct: 140 GMRQLEGLSLVVGVAVMRTLQAFGV---KDVGLKWPNDVLVRGQKITGILLELVGDPADV 196

Query: 136 QAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
             VV+GIG+NV    +  VD  +  TS++RE G  ID   + + L Q +   L   ++  
Sbjct: 197 CHVVLGIGINVNMQANDQVDQEW--TSMRREVGAAIDRNHLVASLNQQLQHELARHRR-Y 253

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           G       W       G  +++      I G  +GVD  G L LE
Sbjct: 254 GFAAFQEEWEQAHLWQGRNVSLVAGSTRIDGVVLGVDGQGGLRLE 298


>gi|229544024|ref|ZP_04433083.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus coagulans 36D1]
 gi|229325163|gb|EEN90839.1| biotin/acetyl-CoA-carboxylase ligase [Bacillus coagulans 36D1]
          Length = 325

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 110/242 (45%), Gaps = 15/242 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDS 75
            + +TI ST     +    G      ++A  QT GRGR    W S K   ++ S++L   
Sbjct: 87  HYRETIDSTQRLAHQLVQEGCPDGTLVIAEQQTGGRGRLRRSWYSPKYTGIWMSIVLRPD 146

Query: 76  ISKD---SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
           +        TL++           A  +P     +IKWPND+L+  +K AGIL E     
Sbjct: 147 LPPQMAPPFTLIAAVAVAQAIEETAGIVP-----EIKWPNDLLIGGKKCAGILTELEADT 201

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDI-FSLLFQDVARVLDLWKK-- 189
           + +QAV+ GIG+NV     D P P+ S+         K +  +LL Q +   L+ +++  
Sbjct: 202 DRIQAVITGIGINVNET--DFPDPLKSIATSLSLASGKKVKRALLIQRILEKLEKYEEIY 259

Query: 190 -DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   +  LW  +A   G  IT     G I GR VG+ D G L LE + G +  I++ 
Sbjct: 260 LQNGFAPLKILWESYANVAGKKITAHTLKGDISGRAVGITDDGVLQLEGEDGQMHAIYSA 319

Query: 249 DI 250
           DI
Sbjct: 320 DI 321


>gi|120402722|ref|YP_952551.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955540|gb|ABM12545.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium vanbaalenii
           PYR-1]
          Length = 257

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 114/241 (47%), Gaps = 15/241 (6%)

Query: 15  RYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           R +  +   STN + + RA +G D+    ++A  QTAGRGR    W +   +  +  + +
Sbjct: 21  RVDVVEETGSTNADLIARAAAGEDIAGAVLLAEHQTAGRGRHGRSWSAPPRSQISMSVGV 80

Query: 74  DS--ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           D+  +  +    L     +A+  V+      G D  +KWPNDILV   K+AGIL E    
Sbjct: 81  DATGVPAERWGWLPLLTGLAVAHVVREDY--GVDAGVKWPNDILVGTGKLAGILAEV--- 135

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
                 +VVG+GLNV     + P P   SL   G   D   + + + Q+++R L  W+  
Sbjct: 136 --SAPVIVVGLGLNVSFTADELPDPNAVSLMMLGHDADRTALAATVLQELSRQLHRWR-- 191

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            G   +   +R  +  +G  +   L  GS I+G   G+DD G LL+++  G    +  GD
Sbjct: 192 AGDPGLAADYRNASTTLGAPVRAVLPGGSEIVGVATGIDDAGRLLIDD-DGTTVTVSAGD 250

Query: 250 I 250
           I
Sbjct: 251 I 251


>gi|240103812|ref|YP_002960121.1| biotin--protein ligase [Thermococcus gammatolerans EJ3]
 gi|239911366|gb|ACS34257.1| Biotin--acetyl-CoA-carboxylase ligase (birA) [Thermococcus
           gammatolerans EJ3]
          Length = 237

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 130/238 (54%), Gaps = 19/238 (7%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
            D + STN+   + A +   G + +VA  QTAGRGR+  +W S +G L+ +++L      
Sbjct: 8   LDEVDSTNEYARRIAPTAPEGTV-VVAKRQTAGRGRKGRRWASPEGGLWMTVILKPKSGP 66

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE-TLNLKNGLQA 137
           + +T L F  A+A   V+ +    G   ++KWPND+LV  +KIAGIL E  LN       
Sbjct: 67  EHVTKLVFVGALA---VLDTLHEYGIRGELKWPNDVLVDGKKIAGILSECRLN-----HF 118

Query: 138 VVVGIGLNVKH-CPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGRE- 194
            ++GIGLNV +  P +      S++   G  IDL+++ + + ++++R   L++   GR  
Sbjct: 119 ALLGIGLNVNNEIPDELRESAVSMKEVLGRAIDLEEVLNRVLRNLSRWYGLFR--NGRHG 176

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSIL--GRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           EI+   +  +  +G  + I +  G I+  G  V +D+ G L+L+ ++  VR ++ GD+
Sbjct: 177 EILKAVKGSSAVLGKRVRI-IEDGEIIAEGIAVDIDNSGALILKGEENTVRVLY-GDV 232


>gi|159899868|ref|YP_001546115.1| biotin--acetyl-CoA-carboxylase ligase [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892907|gb|ABX05987.1| biotin--acetyl-CoA-carboxylase ligase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 272

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 111/240 (46%), Gaps = 12/240 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS--- 75
            +  +STN    +RA +G    L IVA+ QTAGRGRR   W +  G+     LL+     
Sbjct: 29  LEQTASTNSLIRERAFAGVSEGLVIVANEQTAGRGRRGRTWSAPAGSSLLLSLLLRPTWL 88

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL-KNG 134
           +  +S  LL+   AVA+   I         V++KWPND+L+  RK+AGIL+E        
Sbjct: 89  LPSESF-LLTMLAAVAISEAIERE--TNCKVELKWPNDLLINGRKLAGILVELETAGPER 145

Query: 135 LQAVVVGIGLNVKHCPVDTP---YPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
           L+  V+G G+NV   P + P      TSL  E G  +D   +   + Q   R   L  + 
Sbjct: 146 LRWAVIGSGINVNWQPTEDPSINQAATSLALECGKDVDRAALLRAILQSYDRQY-LSLRS 204

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             RE +   W      +G  + ++LS  +  G    VD  G L +    G +  ++ GD+
Sbjct: 205 GRREALRQAWLSRLTTLGQTVEVELSSHNFTGVAESVDQHGGLQVRSSDGQLHTVYAGDV 264


>gi|302524264|ref|ZP_07276606.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces sp. AA4]
 gi|302433159|gb|EFL04975.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces sp. AA4]
          Length = 269

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 115/251 (45%), Gaps = 19/251 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R +  +T  STN +  +  L+G      ++A  QTAG GRR   W S KG  LY S+ L 
Sbjct: 19  RLDVVETTGSTNADLREALLAGAEDRTVLLAEHQTAGVGRRARSWSSPKGAGLYLSIALR 78

Query: 74  D-SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF--QRKIAGILIETLN 130
              +   +L  LS    +A+ ++      +G DV +KWPND+L    + K AGIL E + 
Sbjct: 79  PVGVPFSALGSLSVVAGLAVHALATD---LGVDVALKWPNDVLAGPERAKCAGILAEAVG 135

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPY-----PVTSLQREGGCIDLKDIFSL----LFQDVA 181
              G  AVV+GIGLNV     D P      P TSL  +G     +   +L     F D+ 
Sbjct: 136 --TGDPAVVLGIGLNVLPLGDDVPAGPGGLPATSLAEQGATTTDRTEVALGLLTRFDDLE 193

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKG 240
           R       D     ++  +R     +G  + ++L  GS L GR   +D  G L ++   G
Sbjct: 194 RRWRTAGGDLTEAGLLGDYRARCATLGQDVQVQLPDGSTLTGRAADLDASGQLQVDVPDG 253

Query: 241 CVRQIFTGDIF 251
               +F GD+ 
Sbjct: 254 RRLTVFAGDVV 264


>gi|118137515|pdb|2DJZ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111a
           Mutation
 gi|118137516|pdb|2DJZ|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111a
           Mutation
 gi|126030627|pdb|2HNI|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, K111a Mutation
 gi|126030628|pdb|2HNI|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, K111a Mutation
          Length = 235

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 122/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGRLNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  + IAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|21227931|ref|NP_633853.1| biotin operon repressor [Methanosarcina mazei Go1]
 gi|20906352|gb|AAM31525.1| biotin--[acetyl-COA-carboxylase] synthetase [Methanosarcina mazei
           Go1]
          Length = 325

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 113/240 (47%), Gaps = 12/240 (5%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           +  +F+ +SSTN    + A S + G L ++A  Q  GRGR   +W+S  G ++ S++L  
Sbjct: 84  KIHYFEEVSSTNSVAKEIAASEEEGAL-VIAEIQKGGRGRMGREWVSPHGGIWMSVILKP 142

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I     + L+    +A+ +VI     +G D +IKWPND+ +  +K+ GIL E     + 
Sbjct: 143 GIPLRHASRLTLVAGLAVANVIRD---MGLDARIKWPNDVRINGKKVCGILTEAKAEVDR 199

Query: 135 LQAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIF--SLLFQDVARVLDLWK 188
           +  VV+GIG+NV     D P       T+L+ E G    +  F    LF+   + +    
Sbjct: 200 VDYVVLGIGINVNMDLKDIPESFRAGSTTLKVELGKHIRRVSFLQDFLFELEQQYISF-- 257

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           K      I+N W   +  IG  + +      I GR VGV   G L++ +      +I  G
Sbjct: 258 KTQPFSHILNDWLALSDTIGREVKVTTPSRIIEGRAVGVTPDGALIIRKADNTKEEIIAG 317


>gi|15384001|gb|AAK96079.1|AF393466_13 biotin acetyl-CoA-carboxylase ligase [uncultured crenarchaeote
           74A4]
          Length = 229

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 110/217 (50%), Gaps = 13/217 (5%)

Query: 43  IVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV 102
           I+A  QT GRGR   KWIS KG ++ S++L         TL   A ++A+   I  T  +
Sbjct: 12  IIAEKQTGGRGRSGRKWISPKGGIWLSIILHPKFDISITTLFPIASSLALSYAIEKTCKI 71

Query: 103 GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGL----NVKHCPVDTP---- 154
                +KWPND+ V  +K+AG+L++     N ++++V+G+G+    NVK    +      
Sbjct: 72  SP--LLKWPNDLTVNGKKLAGMLVDASMQSNRIESLVLGVGINFNVNVKEIGKELKNTLN 129

Query: 155 -YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITI 213
            Y + SL  +   +   ++      ++ ++ +L   +  + +I++ W   +  IG  + I
Sbjct: 130 YYGIASLSEQKNKVTAIELVQSFLLELEKIYELLNTNQTK-KIISEWTKRSSTIGKKVEI 188

Query: 214 KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               G I G  + +D++G L+++  KG + ++  GDI
Sbjct: 189 DTVNGKIKGDAIKIDEYGRLIIKN-KGKISKVIAGDI 224


>gi|227549996|ref|ZP_03980045.1| biotin--protein ligase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227077905|gb|EEI15868.1| biotin--protein ligase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 247

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 112/220 (50%), Gaps = 15/220 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           + +TI STN E +     G +    ++A  QTAGRGR   +W+S  G++ A  +L+D+  
Sbjct: 26  WVETIGSTNTELLATGKPGSV----LIADEQTAGRGRMGREWVSPAGSILALSVLVDAPL 81

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
            D+L L S A  +A+  V+          ++KWPND L+  +K AGIL E  ++    + 
Sbjct: 82  TDNLGLASLAAGLALTDVVPQ-------AELKWPNDALLNGKKFAGILSEA-DITGDSRR 133

Query: 138 VVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           VVVGIG+N      D P    TSL  EG  ID  +    L + +A  L+ W+  TG  ++
Sbjct: 134 VVVGIGINAAWRAEDLPVDNATSLNLEGIEIDFDEFTIDLLRALATRLEQWQ--TGDGKL 191

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           +  +R     IG  + ++   G + G    V D G +L+E
Sbjct: 192 LENYRAVCSTIGKTVRLERHGGDVEGTVEDVTDVGEILIE 231


>gi|127511076|ref|YP_001092273.1| biotin--protein ligase [Shewanella loihica PV-4]
 gi|126636371|gb|ABO22014.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella loihica PV-4]
          Length = 319

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 120/233 (51%), Gaps = 20/233 (8%)

Query: 18  FFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           +F+ I+STN    E +K   SGD+     VA  Q+AGRGRR  +W+S  G +LY S    
Sbjct: 83  YFNEINSTNGFLLEHVKDLSSGDI----CVAEYQSAGRGRRGRQWVSPYGCHLYTSFYWQ 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLK 132
            S        LS  +  ++ +V+ S   +G D + +KWPNDI +  +K+AGILIE     
Sbjct: 139 FSQGMAQAMGLSLVVGCSLVTVLRS---LGVDGIGVKWPNDIYLNHKKLAGILIEMSGQA 195

Query: 133 NGLQAVVVGIGLNVKHCP-----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
           + +  +V+GIG+N+   P     +D P+  + L       D  ++   L Q +   L+L+
Sbjct: 196 DSVCDLVIGIGINLSMSPAQADKIDQPW--SDLSELTQLPDKTELMIALQQQLVTDLELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           ++  G +   + WR      G+ I + +   S+ G   G+D+ G +LL+ ++G
Sbjct: 254 QRQ-GLKAFQSRWREADLFDGEPIKLLMGENSVEGICCGIDEQGAILLKTEEG 305


>gi|30250381|ref|NP_842451.1| birA_ligase: biotin--acetyl-CoA-carboxylase ligase [Nitrosomonas
           europaea ATCC 19718]
 gi|30181176|emb|CAD86372.1| birA_ligase: biotin--acetyl-CoA-carboxylase ligase [Nitrosomonas
           europaea ATCC 19718]
          Length = 337

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 126/251 (50%), Gaps = 19/251 (7%)

Query: 13  SFRYEFFDTISSTNDECMKRA----LSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LY 67
           S + E  + + STN   ++RA    +S +     +V   QT GRGRR   W S  G+ L 
Sbjct: 80  SIQIEIVEAVESTNSLLLQRAVEQGISANRIKQVLVTELQTQGRGRRGRSWSSGLGDSLT 139

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV-FQRKIAGILI 126
            S+L       ++L+ LS A+ VA+  V A TL    D+ +KWPND+L     K+AG+LI
Sbjct: 140 FSVLWPSQCPVNTLSGLSLAVGVAI--VRALTLLGIRDIALKWPNDVLSGSHAKLAGVLI 197

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPY------PVTSLQREGGCIDLKDIFSLLFQDV 180
           E       L  VV+G+GLN++   V           +TS+   G   D   + ++L +++
Sbjct: 198 ELHGDMLSLGTVVIGVGLNLRLSGVTKARIDQKVTDITSI--TGQMPDRNQLLAVLLKEL 255

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKK 239
           ARVLD +++  G E  +  W  +      ++ +  + GS+  G  + V   G LL++   
Sbjct: 256 ARVLDTFERH-GFEPFIEEWTRYHAYQDKMVQVSFAEGSVRNGVAISVAADGALLVDTST 314

Query: 240 GCVRQIFTGDI 250
           G V Q+ +G+I
Sbjct: 315 GVV-QLRSGEI 324


>gi|330812092|ref|YP_004356554.1| bifunctional protein (birA): biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380200|gb|AEA71550.1| putative bifunctional protein (birA): biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 318

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 116/241 (48%), Gaps = 10/241 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASL 70
           + +    FDTI STN E ++    G      ++A  Q AGRGRR  KW+S    NLY SL
Sbjct: 73  HEWPVHIFDTIDSTNAEALRLIERGVAAPFMVLAERQVAGRGRRGRKWVSPFAENLYHSL 132

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVG-TDVKIKWPNDILVFQRKIAGILIETL 129
           +L        +  LS  + +A   V+ +   +G  +  +KWPND+LV ++KIAGIL+E +
Sbjct: 133 VLRIDGGMRQIEGLSLVVGLA---VMHALRDMGIAEAGLKWPNDVLVGEKKIAGILLELV 189

Query: 130 NLKNGLQAVVVGIGLNVKHCPVD-TPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLW 187
                +  VV+G+G+NV     D      TS+  E G   D  ++ + L   +   L+L 
Sbjct: 190 GDPADVCHVVLGVGINVNMQSTDEVDQQWTSMCLEAGRNFDRNELVARLGAKLQHYLEL- 248

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            + +G   I + W       G  +++      I G  +G+D  G L L  K   V + F+
Sbjct: 249 HRASGFAAIQSEWEQHHLWQGRAVSLIAGVNKIDGIVLGIDHQGALRL--KVEGVEKNFS 306

Query: 248 G 248
           G
Sbjct: 307 G 307


>gi|330966927|gb|EGH67187.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 319

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 112/238 (47%), Gaps = 8/238 (3%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + + E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S 
Sbjct: 65  AAMVESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           AGIL+E +     +  V++GIG+NV       VD  +    LQ  G   D   I + +  
Sbjct: 183 AGILLELIGDPADVCHVIIGIGVNVNMRASTEVDQLWASVRLQ-TGAPADRNTIAARISA 241

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            +  +L + +++ G       W       G  + +     ++ G  +GVD  G L LE
Sbjct: 242 QLEALLAVHRQE-GFSAFQKEWERGHLWQGAAVKLLSGIETVEGVVLGVDSLGALRLE 298


>gi|114793686|pdb|2DEQ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111g
           Mutation
 gi|114793687|pdb|2DEQ|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111g
           Mutation
 gi|146386462|pdb|2E1H|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, K111g Mutation
 gi|146386463|pdb|2E1H|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, K111g Mutation
          Length = 235

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 122/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGRLNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  + IAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|139438566|ref|ZP_01772082.1| Hypothetical protein COLAER_01080 [Collinsella aerofaciens ATCC
           25986]
 gi|133776105|gb|EBA39925.1| Hypothetical protein COLAER_01080 [Collinsella aerofaciens ATCC
           25986]
          Length = 258

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 107/240 (44%), Gaps = 16/240 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
             D   STND+ ++    G      + A  QTAGRGRR +KW S  GNL  SL+L   ++
Sbjct: 7   IVDVTGSTNDDLLEAGKQGAPHGTGLAARAQTAGRGRRGHKWDSTVGNLLLSLVLRPCVN 66

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
               + L+    +A+   +     +  ++++KWPND++   RK+ GIL+E      G   
Sbjct: 67  PAKFSGLAAVSGLAVLEALEKQ-GLANEIRLKWPNDLVARGRKLGGILVEAARDNEGKPF 125

Query: 138 VVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKD-IFSLLFQDVARVLDLW-KKDTG 192
            V GIG+NV + P + P    P   L      +   D +   ++  V    D W ++   
Sbjct: 126 AVCGIGVNVNYAPQEVPDGGLPAIGLSDLNESVPAVDMLLDEVYHAVIDAADAWAERLNA 185

Query: 193 REE-------IMNLWRCFACGIGDLITIKLSYGSILGR--FVGVDDFGYLLLEEKKG-CV 242
           +EE       + + +      IG  +  +   G  L R  F  VDD G   +E + G CV
Sbjct: 186 KEEDAGPLAPVHDEYIAHLNWIGKHVIARSPAGDELARGIFRTVDDCGRACIETESGLCV 245


>gi|169830343|ref|YP_001716325.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637187|gb|ACA58693.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 325

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 110/240 (45%), Gaps = 9/240 (3%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           Y +  T+SSTND+  + A  G      IVA  Q+ GRGR    W S +G L+ S  ++  
Sbjct: 81  YLYHPTLSSTNDQAKESARRGAPEGTTIVAEEQSGGRGRLGRSWHSPRGGLWFS--VVLR 138

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                          A+  V A     G  V +KWPND +   RK+ GIL E     + +
Sbjct: 139 PPLPPARAPEAVFVAAVAGVEALAAYPGVQVGLKWPNDFVWRGRKLGGILTEVTGELDQI 198

Query: 136 QAVVVGIGLNV----KHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +VVGIGLNV    +  P +    VTS++   GG +   ++   L   +     +W K 
Sbjct: 199 NHLVVGIGLNVNLDLQDFPPELRTGVTSVREITGGDVSRSELLRQLLAALEHWYLVWLKQ 258

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   ++  W+     +  L+ +    G ++GR V VD  G LLL    G VR++ TG++
Sbjct: 259 -GFTPVLAAWKRHNACLDRLLRVLTPEGELVGRAVDVDADGALLL-ATAGGVRRVVTGEL 316


>gi|114327952|ref|YP_745109.1| biotin--[acetyl-CoA-carboxylase] synthetase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316126|gb|ABI62186.1| biotin operon repressor [Granulibacter bethesdensis CGDNIH1]
          Length = 261

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 118/250 (47%), Gaps = 18/250 (7%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
           P+ +R E   ++ ST+D  + RA  G+   L ++A  QT  R  R   W   +GNL  SL
Sbjct: 12  PHPWRLEVHASLPSTSDYLVARASQGEPDGLAVLALRQTLPRATRGRAWTEPEGNLALSL 71

Query: 71  LLIDS-----ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           L+        +S       +F   +A+   I   +     V +KWPNDI+V  RK+ GIL
Sbjct: 72  LIRPGQGPAFLSAREAGHWAFVAGLAVFDAIWPYVDDPQAVFLKWPNDIMVGDRKLGGIL 131

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI-DLKD---IFSLLFQDVA 181
           I+        + +V+GIG+NV   PV  P  +T+      C+ D+ D   +  +L Q + 
Sbjct: 132 IDAAIAAAEPEWLVIGIGVNVASAPV-VPGRMTA------CLADISDRVPMPQVLAQKIV 184

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
             L  W+      EI + WR  A   G  +T++     + G F G+ + G LLL+    C
Sbjct: 185 TRLSAWRH-AAPLEIRDAWRRAAHPPGTRLTVRCQGEVLDGLFTGIGEDGALLLDCGGEC 243

Query: 242 VRQIFTGDIF 251
            R + TG+I 
Sbjct: 244 -RVVHTGEIL 252


>gi|146308940|ref|YP_001189405.1| biotin--protein ligase [Pseudomonas mendocina ymp]
 gi|145577141|gb|ABP86673.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas mendocina ymp]
          Length = 321

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 116/237 (48%), Gaps = 18/237 (7%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSISKD 79
           ++ STN E  +R  SG      +++  QTAGRGRR   W S    NLY SL L       
Sbjct: 83  SLDSTNAEVFRRLDSGCGAPFVLLSERQTAGRGRRGRAWASPFAENLYCSLALRVDGGMR 142

Query: 80  SLTLLSFAIAVAMRSVIASTLPVG--TDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
            +  LS  + +A    +A  L V       +KWPND+LV  +KIAGIL+E       +  
Sbjct: 143 QVEALSLTVGLA----VAKALQVSGLEAAGLKWPNDVLVNGQKIAGILLELSGDPADVCH 198

Query: 138 VVVGIGLNVKHCPVDTP----YPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDL-WKKDT 191
           VV+G+G+NV +  VDT      P TS+++  G  ID  ++   + + + R + L W+  +
Sbjct: 199 VVIGVGINV-NMAVDTTAAIDQPWTSMRQHLGRMIDRNELAGEVLRQLTRYVSLHWQ--S 255

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           G   + + W       G  + +     + LG  +GVDD G + LE     V Q+F+G
Sbjct: 256 GFSSVRDEWEVLHLWRGRPVALLAGTNATLGVVLGVDDRGAIRLEVDG--VEQVFSG 310


>gi|145628535|ref|ZP_01784335.1| biotin--protein ligase [Haemophilus influenzae 22.1-21]
 gi|144979005|gb|EDJ88691.1| biotin--protein ligase [Haemophilus influenzae 22.1-21]
          Length = 200

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 13/137 (9%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           PYS  Y+    ISSTN+  ++  LS   G+L  VA  QTAGRGRR  +W+S   G +  S
Sbjct: 68  PYSIHYQ--PIISSTNEWILQNILSLKKGDL-CVAEYQTAGRGRRGRQWLSPFAGQIMFS 124

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
                   K S+  LS  I +A+  V+        +V++KWPNDIL  +RK+ GIL+E  
Sbjct: 125 FYWTFD-PKKSIEGLSLVIGLAIAEVL--------NVQVKWPNDILFDERKLGGILVEIA 175

Query: 130 NLKNGLQAVVVGIGLNV 146
           N KNG+  +V+GIG+NV
Sbjct: 176 NHKNGMLNLVIGIGINV 192


>gi|210635430|ref|ZP_03298534.1| hypothetical protein COLSTE_02465 [Collinsella stercoris DSM 13279]
 gi|210158377|gb|EEA89348.1| hypothetical protein COLSTE_02465 [Collinsella stercoris DSM 13279]
          Length = 291

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 116/275 (42%), Gaps = 54/275 (19%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           E  D I STN E  +R   G      + A  QTAGRG+R + W S  G LY S+LL   +
Sbjct: 9   EVVDEIGSTNAEMKRRGREGAPHGAALRARVQTAGRGQRTHMWASPAGGLYLSVLLRPDV 68

Query: 77  SKDSLTLLSFAIAV-AMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           S  +L  L  A A+ AM ++  +  P    V++KWPNDI+V  RK+AG+L E      G 
Sbjct: 69  SATALPALPVACAMGAMGALREAGCP---GVRLKWPNDIVVGGRKLAGVLTELAMSDEGA 125

Query: 136 QAVVVGIGLNVK--HCPVD----TPYPVTSLQRE----GGCIDLKDIFSLLFQD------ 179
            A V GIG+N++    P       P P T L+        C DL D+ +   +D      
Sbjct: 126 FA-VCGIGVNIETPELPASDGALAPLPATGLRDALAPGASCPDL-DVLADAIRDGILKFV 183

Query: 180 -----------------------VARVLDLWKKDTGR-------EEIMNLWRCFACGIGD 209
                                   +  +D W KD  R         ++  +      IG 
Sbjct: 184 EGWSAADRWNRKYPSPDSSAQQTSSAEVDRWIKDPVRGGAEGPLAPLLAAYNASLAFIGT 243

Query: 210 LITIKLSYGS--ILGRFVGVDDFGYLLLEEKKGCV 242
            + +    G   + G F+GVD +GY L+    G V
Sbjct: 244 RVRVITIEGEELVCGLFLGVDGYGYALVSHDGGIV 278


>gi|134104167|pdb|2DXT|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Atp And Biotin, Mutation D104a
 gi|134104168|pdb|2DXT|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Atp And Biotin, Mutation D104a
 gi|145579273|pdb|2DZ9|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Biotinyl-5'-Amp, Mutation
           D104a
 gi|145579274|pdb|2DZ9|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Biotinyl-5'-Amp, Mutation
           D104a
 gi|151567532|pdb|2E65|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, Mutation D104a
 gi|151567533|pdb|2E65|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Ot3, Mutation D104a
          Length = 235

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 122/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G GR + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGRLNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPN +LV  +KIAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|330879471|gb|EGH13620.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 319

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 117/245 (47%), Gaps = 22/245 (8%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           + + E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S 
Sbjct: 65  AAMVESGMPGEWSVRTYDSIDSTNAEASRLIARGAPMPLLVVAEQQTAGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           AGIL+E +     +  V++GIG+NV       VD  +    LQ  G   D   I + +  
Sbjct: 183 AGILLELIGDPADVCHVIIGIGVNVNMRASTEVDQLWTSVRLQ-TGAPADRNTIAARISA 241

Query: 179 DVARVLDLWKKD-----TGREEIMNLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFG 231
            +  +L + +++         E  +LW+  A        +KL  G  ++ G  +GVD  G
Sbjct: 242 QLEALLAVHRQEGFLAFQKEWERGHLWQGAA--------VKLLSGIETVEGVVLGVDSLG 293

Query: 232 YLLLE 236
            L LE
Sbjct: 294 ALRLE 298


>gi|134104169|pdb|2DXU|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a
 gi|134104170|pdb|2DXU|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a
 gi|145579279|pdb|2DZC|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutation R48a
 gi|145579280|pdb|2DZC|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutation R48a
 gi|170292169|pdb|2EJG|A Chain A, Crystal Structure Of The Biotin Protein Ligase (Mutation
           R48a) And Biotin Carboxyl Carrier Protein Complex From
           Pyrococcus Horikoshii Ot3
 gi|170292170|pdb|2EJG|B Chain B, Crystal Structure Of The Biotin Protein Ligase (Mutation
           R48a) And Biotin Carboxyl Carrier Protein Complex From
           Pyrococcus Horikoshii Ot3
          Length = 235

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 122/238 (51%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G G  + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGALNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  +KIAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|253996034|ref|YP_003048098.1| biotin/acetyl-CoA-carboxylase ligase [Methylotenera mobilis JLW8]
 gi|253982713|gb|ACT47571.1| biotin/acetyl-CoA-carboxylase ligase [Methylotenera mobilis JLW8]
          Length = 330

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 121/248 (48%), Gaps = 27/248 (10%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           E FDTI STN   M+  +S       ++A+ QT GRGRR  +W +  G +L  SLL    
Sbjct: 85  EVFDTIDSTNSYLMQN-MSAKTHGTCVIANLQTNGRGRRGREWQASLGASLTFSLLWRFQ 143

Query: 76  ISKDSLTLLSFAIAVAM----RSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
               +L+ LS A+ VA+      + AS        ++KWPNDILV Q+K+AGILIE    
Sbjct: 144 CGAAALSGLSLAVGVALIRGLHEIDASA------AQLKWPNDILVNQQKLAGILIELQGD 197

Query: 132 KNGLQAVVVGIGLNVKHCPVD----TPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDL 186
            +G    V+G+G+N+ H P         PVT L       ++   + + L + +  VL  
Sbjct: 198 MDGPSTAVIGVGINL-HLPEQLLQKIDQPVTDLNHATPSNVNPNALMAKLLEHMVEVLST 256

Query: 187 WKK---DTGREEIMNLWRCFACGIGDLITIKLSYGS-ILGRFVGVDDFGYLLLEEKKGCV 242
           +++   D  REE    W          + + +  GS + G    + D G L++E   G +
Sbjct: 257 FEQAGFDALREE----WVAHHAYHQQPVRMLMPDGSEVTGVVQDISDNGTLIVETANG-L 311

Query: 243 RQIFTGDI 250
           +++ +G+I
Sbjct: 312 QKMMSGEI 319


>gi|160941163|ref|ZP_02088500.1| hypothetical protein CLOBOL_06056 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435724|gb|EDP13491.1| hypothetical protein CLOBOL_06056 [Clostridium bolteae ATCC
           BAA-613]
          Length = 326

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 115/241 (47%), Gaps = 8/241 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           R E+FD   STN    K A  G      +VA  QTAG+GRR   W+S  G  ++ S++L 
Sbjct: 80  RLEYFDETDSTNIRARKLAEEGAPHGTLVVADRQTAGKGRRGKSWVSPAGTGIWMSMVLR 139

Query: 74  DSISKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +S  S ++L+    ++ +R V  ST   G +  IKWPND ++  +KI GIL E     
Sbjct: 140 PVMSPMSASMLTLIAGLSVVRGVKEST---GLEAMIKWPNDAVLNGKKICGILTEMSTEV 196

Query: 133 NGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK 189
             ++ V+ GIG+NV     P +     TSL+ E G  I    + + +        D++ K
Sbjct: 197 ECIRYVIPGIGINVNIDDFPEEIRATATSLKLEAGRSIKRSLVIAAVADSFEYYYDIFMK 256

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
                 + + +      +   + +    G   G+ +G+D+ G LL+  + G +  + +G+
Sbjct: 257 TCDMSGLRDDYNKALVNLNKEVLVLDPRGQYKGKALGIDNEGSLLVRREDGNISAVISGE 316

Query: 250 I 250
           +
Sbjct: 317 V 317


>gi|288802993|ref|ZP_06408429.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella melaninogenica
           D18]
 gi|288334510|gb|EFC72949.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella melaninogenica
           D18]
          Length = 263

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 111/230 (48%), Gaps = 7/230 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            D + STN        + D     +VA  QTAG+G+  N W S+ G   L++ L+    +
Sbjct: 27  LDAVDSTNAYLRTYTPAEDEPMTVVVADYQTAGKGQGTNTWESEAGKNLLFSVLVHPTML 86

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S  LLS A A+A++  +A    V  D+ +KWPNDI    +K++G LIET      ++
Sbjct: 87  PVRSQFLLSEAGALALKEALADY--VKEDISLKWPNDIYWKDKKLSGTLIETKLAAGRIK 144

Query: 137 AVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             V G+GLNV       D P PV+  Q  G  +D +++   + +  + +  L +   G  
Sbjct: 145 DCVFGVGLNVNQETFHSDAPNPVSLCQILGYEVDKEELLKKIIKKFSELYQLLEM-GGYN 203

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           ++  ++       G     + + G   G  V V+D G+L+L + KG +R+
Sbjct: 204 DVSAMYHEALYRRGGFHKFRDADGEFEGAIVEVEDDGHLILRDSKGMIRE 253


>gi|288556124|ref|YP_003428059.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus pseudofirmus OF4]
 gi|288547284|gb|ADC51167.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Bacillus pseudofirmus OF4]
          Length = 329

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 109/248 (43%), Gaps = 23/248 (9%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLIDSI 76
           +FD   ST     K A  G      +VA+ QT G+GR    W S    ++  S++L   +
Sbjct: 84  YFDATESTQQIAHKLAQDGAEEGHVVVANEQTKGKGRLGRVWHSRSNTSISMSMILRPPL 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AVA+   I      G   +IKWPNDIL+  +K+ GIL E     + + 
Sbjct: 144 PPQKTPQLTLLAAVAVVQAIKKN--TGLQCEIKWPNDILLKGKKLVGILTEMQADPDLVH 201

Query: 137 AVVVGIGLNVKHCP----VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVL-------- 184
           +V++GIGLNV         D  +  TSL  E      KD  S    D AR++        
Sbjct: 202 SVIIGIGLNVNQTSEDFGEDIAHLATSLHLE------KDGASGEPVDRARLIADILLEFE 255

Query: 185 --DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
                  + G + I  LW  ++  +G  I  ++    I G   G+ D G LL+E++ G  
Sbjct: 256 ELYEEYLENGFQSIRPLWESYSISVGTYIYARMIKDVIYGYAKGITDDGVLLVEDESGKT 315

Query: 243 RQIFTGDI 250
             I++ DI
Sbjct: 316 HHIYSADI 323


>gi|303237274|ref|ZP_07323844.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella disiens
           FB035-09AN]
 gi|302482661|gb|EFL45686.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella disiens
           FB035-09AN]
          Length = 261

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 110/229 (48%), Gaps = 7/229 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            +++ STND         +     ++A  QTAGRG+  NKW S+ G   L++ LL    I
Sbjct: 24  LESVESTNDYLRTYKPEENEPMTVVMADYQTAGRGQGTNKWESEAGKNLLFSVLLHPYEI 83

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              +  LLS   A+ +R V+  T  VG D+ +KWPNDI    +K++G LIET      ++
Sbjct: 84  PIATQFLLSMYGALCLRDVL--TKYVGEDITLKWPNDIYWKNKKLSGTLIETKLSGGRIK 141

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             + G+GLNV       D P PV+  Q  G  ID + +   + Q   R  + W +     
Sbjct: 142 DCIFGVGLNVNQTVFKSDAPNPVSLCQILGKEIDREALLQKIVQAFERNYE-WIRSANYG 200

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            I +++             +   G+  G  V V+D G+L+L +++G +R
Sbjct: 201 AISSMYHDALYRGKGFYWYEDKDGAFEGAIVEVEDNGHLILRDREGRIR 249


>gi|332981873|ref|YP_004463314.1| biotin/acetyl-CoA-carboxylase ligase [Mahella australiensis 50-1
           BON]
 gi|332699551|gb|AEE96492.1| biotin/acetyl-CoA-carboxylase ligase [Mahella australiensis 50-1
           BON]
          Length = 330

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 120/242 (49%), Gaps = 14/242 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL---I 73
            F +I STND+  + A +G    L +VA  QT GRGR   +W+S +   ++ S++L   I
Sbjct: 85  HFLSIGSTNDKAKELANNGCREGLIVVAEEQTGGRGRLGRQWVSPQYRGIWMSVVLRPDI 144

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +    LTLLS   A+A+ + I      G  V IKWPND++V  +KI GIL E     +
Sbjct: 145 QPMEAQKLTLLS---ALAVSNAIEEC--TGLKVDIKWPNDLVVSGKKICGILTEMSAEVD 199

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPV----TSLQRE-GGCIDLKDIFSLLFQDVARVLDLWK 188
            +  VV+GIG+N      D P  +    TSL  E G  +D K++F  + +++  +   + 
Sbjct: 200 KVNHVVIGIGINANMSAEDIPDELKDKATSLAIELGYNVDRKNLFRYISRNIDELYTCFI 259

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                 ++M  +R     +G    I     S  G    +DD G L++ +  G  ++I +G
Sbjct: 260 NANQWHDLMVEYREKCINVGRRAVISKGDVSWEGMVTDIDDDGALIVLDGHGEKKRIISG 319

Query: 249 DI 250
           D+
Sbjct: 320 DV 321


>gi|158319495|ref|YP_001512002.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus oremlandii
           OhILAs]
 gi|158139694|gb|ABW18006.1| biotin--acetyl-CoA-carboxylase ligase [Alkaliphilus oremlandii
           OhILAs]
          Length = 326

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 117/240 (48%), Gaps = 15/240 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSIS 77
           FD+I STN      A     G + I++  Q AGRGRR   W S KG  ++ S++L   I 
Sbjct: 85  FDSIDSTNTYGKNNADHLMDGTI-ILSEEQLAGRGRRGKDWSSPKGTGIWMSMVLKPDIP 143

Query: 78  K----DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +  + + A+  A+R +       G D  IKWPNDI+V  RK+ GIL E     N
Sbjct: 144 PTEGVKTTQIAAAAVCKAIRDL------TGLDALIKWPNDIVVNGRKVCGILTEMAGQLN 197

Query: 134 GLQAVVVGIGLNVKHC--PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKD 190
            +  +VVGIG+NV +   P       TSLQ E G  ID K++   + ++   +   + ++
Sbjct: 198 KIDYIVVGIGINVNNTEFPEGISAVATSLQIEYGKKIDRKELIVRIIKNFEALYHSYIEN 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               E++ + R ++  IG  I +       +     +D+ G+L++E   G    IF+G++
Sbjct: 258 LNLTEVVAIVRDYSAVIGKEIKVIHGTSERIVTVHDIDEEGFLIVESGDGKREVIFSGEV 317


>gi|56461103|ref|YP_156384.1| biotin--protein ligase [Idiomarina loihiensis L2TR]
 gi|56180113|gb|AAV82835.1| Biotin operon repressor/biotin--protein ligase fusion protein
           [Idiomarina loihiensis L2TR]
          Length = 331

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 115/254 (45%), Gaps = 14/254 (5%)

Query: 7   ECQNPYSFR----YEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWIS 61
           E ++P  +R    +E    + S+ND   + A  G L     I A  QTAGRGRR  KWIS
Sbjct: 73  ENESPEKWRQSPEFEVKSVVDSSNDRVKELAKEGPLEAGFSIFAEAQTAGRGRRGKKWIS 132

Query: 62  DKGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
             GN LY S+             LS A  VA+          G  V +KWPND+ +  +K
Sbjct: 133 PFGNNLYFSVYWPLDEGIHGAMGLSLAAGVALAECFTDLGIEG--VSVKWPNDVYIRGKK 190

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQRE-GGCIDLKDIFSLL 176
           + GIL++      G    ++GIG+N+   +H         T L  E    +    I + +
Sbjct: 191 VTGILVDLETSPEGAAHSIIGIGINLTMPEHVGASIDQAWTDLNSELPQPMSRNHIAAQV 250

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
              V   L  +++  G       WR + C +   + + +     LG   G+D+ G LL+E
Sbjct: 251 RASVLSALQQYEQH-GLAAFQQSWRRYDCFLDKPVKLIMGQRVCLGTCRGIDENGALLVE 309

Query: 237 EKKGCVRQIFTGDI 250
           +++G VR+ F G++
Sbjct: 310 DEQG-VRRYFGGEV 322


>gi|289578944|ref|YP_003477571.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter italicus
           Ab9]
 gi|289528657|gb|ADD03009.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter italicus
           Ab9]
          Length = 326

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKD 79
           TI STN+   + A     G + I+A  Q+AGRGR    W+S KG  ++ S++L  +I   
Sbjct: 88  TIDSTNNLAKEIASKVPDGTV-IIAEEQSAGRGRLGRSWLSQKGCGIWMSVILKPNIQPQ 146

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+   A+++   I     V  + KIKWPNDI+V  +K+ GIL E  +  + +  VV
Sbjct: 147 EAINLTQVAAISVVKAIEELSHV--ENKIKWPNDIIVNNKKVCGILTEMSSEIDKINYVV 204

Query: 140 VGIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I
Sbjct: 205 IGIGVNVNCYNFPEELKGKATSLNLETNSKVDRKKLTASILNNLEFYYNTYLQK-GFEYI 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G ++G+ V +D  G L++E K+G    I +GD+
Sbjct: 264 RPICIAKSITIGREIKVIYNEGEMVGKAVTIDSNGSLIVETKEGKRLSIMSGDV 317


>gi|118444008|ref|YP_877003.1| birA bifunctional protein [Clostridium novyi NT]
 gi|118134464|gb|ABK61508.1| birA bifunctional protein, putative [Clostridium novyi NT]
          Length = 328

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 130/259 (50%), Gaps = 21/259 (8%)

Query: 7   ECQNPY-SFRY-----EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           E  NPY + +Y      +++TI STN +  +   +G      +++  QT GRGR   +W+
Sbjct: 67  EEVNPYLNTKYIGKDIRYYNTIDSTNTKAKELGTAGAKEGTVVISEEQTGGRGRLGRQWV 126

Query: 61  SDKGN-LYASLLL---IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
           S K N ++ S++L   I+ +    +T +  A AV M     S   +G    IKWPNDI++
Sbjct: 127 SPKFNGIWMSIILKPDIEPMDASKITQIGAA-AVCM-----SINELGLKATIKWPNDIVL 180

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGG-CIDLKD 171
             +K+ GIL E     N +  +++GIG+NV    +  P D     TS++ E G  +  K+
Sbjct: 181 NGKKVCGILTEMSGELNKINYIIMGIGINVNIEDEDFPGDIKDIATSIKIESGKKVKRKE 240

Query: 172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
           + + +F +   + D +      +  +N+ R  +  IG+ I I      +  + +G+ + G
Sbjct: 241 LVASIFNNFESLYDEFINSETIKRSINICRENSALIGNDIKIIKRNEEVFAKAIGLTEDG 300

Query: 232 YLLLEEKKGCVRQIFTGDI 250
            L++E   G V +I +G++
Sbjct: 301 ELIVEYNDGKVDKIVSGEV 319


>gi|303256357|ref|ZP_07342371.1| biotin-[acetyl-CoA-carboxylase] ligase [Burkholderiales bacterium
           1_1_47]
 gi|331001519|ref|ZP_08325137.1| biotin--[acetyl-CoA-carboxylase] ligase [Parasutterella
           excrementihominis YIT 11859]
 gi|302859848|gb|EFL82925.1| biotin-[acetyl-CoA-carboxylase] ligase [Burkholderiales bacterium
           1_1_47]
 gi|329568248|gb|EGG50065.1| biotin--[acetyl-CoA-carboxylase] ligase [Parasutterella
           excrementihominis YIT 11859]
          Length = 263

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 119/234 (50%), Gaps = 19/234 (8%)

Query: 17  EFFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           + FD I STN+   + +KR  S     + +VA  QTAG+G +  KW+    +L  SLL+ 
Sbjct: 20  QVFDEIDSTNEYLKKLVKREASSLAQPILVVAQRQTAGKGTKGRKWMDSPASLKFSLLIG 79

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                + L LLS  IA+ +R V+++      +VKIKWPND+  F  K AGIL E +  K 
Sbjct: 80  FEEESERLALLSPYIALKLRKVLSAA--AKEEVKIKWPNDLYCFGGKTAGILTEVIQ-KK 136

Query: 134 GLQAVVVGIGLNVKHCPV---DTPYPVTSLQREGGCIDLKDIFSLLF----QDVARVLDL 186
           G+  +++G+G+N+   P    +   PV SL +     +L+ + SL+     +++ R +  
Sbjct: 137 GMAYLIIGVGINLATDPEVVRNINSPVGSLFKHIEPEELERVRSLILSCACEEIIRAVRS 196

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSIL---GRFVGVDDFGYLLLEE 237
             +    EEI   W       G    ++L  G  +   G+ +G+D  G +LL++
Sbjct: 197 LPEKFSAEEIKE-WNHSDLYKGR--KLRLIEGEKIVSEGQNMGIDKKGRILLQD 247


>gi|254440354|ref|ZP_05053848.1| hypothetical protein OA307_5224 [Octadecabacter antarcticus 307]
 gi|198255800|gb|EDY80114.1| hypothetical protein OA307_5224 [Octadecabacter antarcticus 307]
          Length = 193

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 98/197 (49%), Gaps = 15/197 (7%)

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           GN Y +L +  S   ++ +L SF  A+A+   + + +  G  + +KWPND+L+   K+AG
Sbjct: 2   GNFYGTLSVPCS-DPETASLRSFVAALAVHDALRAVMGDGPKLALKWPNDVLLNDGKVAG 60

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLF 177
           IL+E++ ++  +  V VGIG+N+   P          YPV S++ E G     D F    
Sbjct: 61  ILLESILVQGQMWGVAVGIGVNLIAAPDMAQVEEGALYPV-SVKTESGVDVTPDAF---L 116

Query: 178 QDVARVLDLWKKDT---GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           + +A     W       G   I   W   A  +G+ IT +L    ++GRF  VD+ GYL+
Sbjct: 117 KHLAPAFAQWDGQLTTYGFAPIRTAWLARAARLGETITARLPTEDVIGRFDTVDENGYLV 176

Query: 235 LEEKKGCVRQIFTGDIF 251
           L   KG  R I   D+F
Sbjct: 177 LNTAKGP-RNIAAADVF 192


>gi|258511620|ref|YP_003185054.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478346|gb|ACV58665.1| biotin/acetyl-CoA-carboxylase ligase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 333

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 109/243 (44%), Gaps = 16/243 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
           + ++ +STND  ++ A  G      + A  QT GRGRRD  W S +G ++ ++ + +  +
Sbjct: 91  WAESRASTNDTALELAEKGLPHGAVVTAGEQTGGRGRRDRAWASPRGGMWFTVFVRNPCA 150

Query: 78  ---KDSLTLL-SFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 LTLL + A+  A+R         G  V+IKWPNDIL+  +K  GIL +      
Sbjct: 151 LRHAPDLTLLAALAVCRALRG-------EGVPVEIKWPNDILLGGKKTGGILAQIRAEGE 203

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPV-----TSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
            +   V+GIGLN      + P  +     T L   G  ID     + +  ++ R+    +
Sbjct: 204 LVDHAVIGIGLNANFPIEELPEEIRDRATTILHAMGRPIDRPKALARILMELDRLYRDLR 263

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G + +   W      IG  + + +    + G    ++  G L++E   G  R + +G
Sbjct: 264 DGRGFQAVHAEWTALCSTIGHEVEVAIGDQRVRGMARSIEPDGSLVIETSPGVTRTVVSG 323

Query: 249 DIF 251
           ++ 
Sbjct: 324 EVL 326


>gi|149184621|ref|ZP_01862939.1| biotin protein ligase [Erythrobacter sp. SD-21]
 gi|148831941|gb|EDL50374.1| biotin protein ligase [Erythrobacter sp. SD-21]
          Length = 240

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 109/232 (46%), Gaps = 11/232 (4%)

Query: 24  STNDECMKRALSGD-LGNL-WIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSL 81
           STN +   +  +G+ +G   W+VA  QTAGRGR+   W    GN   S ++       + 
Sbjct: 10  STNADLAAQLRAGEAVGEASWLVADRQTAGRGRQGRTWFDGHGNFMGSTIVRPHERDPAP 69

Query: 82  TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVG 141
             L+   A+A+   +   +   +++ +KWPND+++   K++GIL+E    + G  A++VG
Sbjct: 70  ASLALVSALAVYEAVVPLIANPSELSLKWPNDLMLAGAKLSGILLE----REG-DAIIVG 124

Query: 142 IGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSL-LFQDVARVLDLWKKDTGREEIMNLW 200
           IG+N+   P D P   T      G    +D F+  L     R L+ W+   G E ++  W
Sbjct: 125 IGVNLAAAP-DLPDRRTVALSAFGPAPERDTFAHSLAASFDRELERWRS-VGLEPLVRRW 182

Query: 201 RCFACGIGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
              A   G  + +       ILG + G+ + G L L    G  R I  GD+ 
Sbjct: 183 ESVAHPPGTSLRVHPPGEEPILGEYAGLTEDGALRLRLAGGESRVIHAGDVM 234


>gi|226324184|ref|ZP_03799702.1| hypothetical protein COPCOM_01963 [Coprococcus comes ATCC 27758]
 gi|225207733|gb|EEG90087.1| hypothetical protein COPCOM_01963 [Coprococcus comes ATCC 27758]
          Length = 326

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 116/244 (47%), Gaps = 18/244 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E++D I STN+       +G       VA  QTAG+GRR   W S  G+ +  S+LL   
Sbjct: 82  EYYDEIDSTNNRAKALGEAGGADGTLFVAETQTAGKGRRGRCWQSPAGSSISMSILLRPV 141

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++     +L+  +A A    +     +  D+ IKWPND++V  +KI+GIL E     + +
Sbjct: 142 MNPSDAPMLTLVMAYAATKALREKTEL--DIGIKWPNDLVVSGKKISGILTEMSAEIDYI 199

Query: 136 QAVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK---- 189
             VV+GIG+NV  +  P D     TSL+ E G    K+     F+ +A +++ ++K    
Sbjct: 200 NHVVIGIGINVNMESFPEDIAKTATSLRIEAG----KEFRR--FELIAAIMEHFEKAYEA 253

Query: 190 --DTGR-EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
             + G  E IM  +       G  + +           +G+D  G L +E + G  + +F
Sbjct: 254 VCEAGSLEPIMEDYNRLLVNCGRRVRVLEPEHEYDALALGIDKTGELQVECEDGSRKSVF 313

Query: 247 TGDI 250
            G++
Sbjct: 314 AGEV 317


>gi|226942164|ref|YP_002797238.1| BirA [Laribacter hongkongensis HLHK9]
 gi|226717091|gb|ACO76229.1| BirA [Laribacter hongkongensis HLHK9]
          Length = 311

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 120/241 (49%), Gaps = 14/241 (5%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNL--YASLL 71
           +  E  + + STN   + R+ S   G L + A  Q AGRGRR  +W +  G    ++ L 
Sbjct: 75  WEVEVAERVDSTNTRLLARS-SSHAGPLALFAEHQMAGRGRRGRQWHTRLGEALTFSVLW 133

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
            +D      L+ LS A+ +A+   +A     G  V +KWPND+L+  RK+AGIL+E    
Sbjct: 134 QVDG-GVARLSGLSLAVGLAIVRALAG---FGLPVALKWPNDVLLQGRKLAGILVELAGD 189

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             G  +VV+G+G+N++   VD P   V  ++ E   +   ++   L  ++A+VLD + + 
Sbjct: 190 TLGPTSVVIGVGINLQSPEVDQPTAGVRDIRPE---LSRNELAGALLTELAQVLDEFAQG 246

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            G   +   W+         + +  + G  I G   GVD  G LLLE   G V++  +GD
Sbjct: 247 -GFAGLRQDWQQHHLWQDQPVELIHADGLRITGIARGVDSLGALLLETSDG-VQRFHSGD 304

Query: 250 I 250
           +
Sbjct: 305 V 305


>gi|260574778|ref|ZP_05842781.1| biotin/acetyl-CoA-carboxylase ligase [Rhodobacter sp. SW2]
 gi|259023195|gb|EEW26488.1| biotin/acetyl-CoA-carboxylase ligase [Rhodobacter sp. SW2]
          Length = 239

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 113/240 (47%), Gaps = 14/240 (5%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDS 80
           ++ ST+ +  + A +G     W++A  QTAG+GRR   W S +GN YASL++  +   + 
Sbjct: 4   SVDSTSAQAARLAAAGLTSPAWVLAGEQTAGKGRRGRPWASPRGNFYASLVMQPAEPPEQ 63

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           + L SFA A+A+R  +     +     +KWPND+L+   K+AGIL+E+      L  +V+
Sbjct: 64  VALRSFAAALALREALVGLTGLPQVFALKWPNDVLLNGGKLAGILLESTGANGRLGNLVI 123

Query: 141 GIGLNVKHCP------VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK---DT 191
           GIG+N+   P           PV+ L   G  I  +     L    AR    W+      
Sbjct: 124 GIGVNLTTAPDPAEVEPGAVTPVSLLAETGLRITPEAFLDALAPAYAR----WEAVFTTY 179

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G   + + W   A  +G  I  +    +  G F  VD  G L+L   +G V  I   ++F
Sbjct: 180 GFAPLRDEWLRHAARLGQTIRARTGTQTRTGIFETVDATGALVLTTPEGRV-AIPAAEVF 238


>gi|118579093|ref|YP_900343.1| biotin--acetyl-CoA-carboxylase ligase [Pelobacter propionicus DSM
           2379]
 gi|118501803|gb|ABK98285.1| biotin--acetyl-CoA-carboxylase ligase [Pelobacter propionicus DSM
           2379]
          Length = 324

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 122/246 (49%), Gaps = 24/246 (9%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
            +  +STN +  + A  G      ++A  Q+ G+GR    W S  G NLY S++L  +I 
Sbjct: 86  LEQTASTNGDAFRLAEQGAAEGTVVLADTQSGGKGRMGRVWSSPPGVNLYCSIILRPAIM 145

Query: 78  KDSLTLLSFAIAVAM-RSV--IASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                 L+F  AVA+ RS+  I++ +P     +IKWPND+L+  +K+AG+L E     + 
Sbjct: 146 PYEAPQLTFLSAVAVARSIERISAIVP-----EIKWPNDVLIKGQKVAGLLNEMSAETDA 200

Query: 135 LQAVVVGIGLNVK----HCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK 189
           +  V++GIG+N+       P D  +P TS+  E G  +      +++  ++ R+   ++ 
Sbjct: 201 VNFVILGIGVNLNMTAGQFPDDLRHPATSILLESGRPVGRAGFCAIMLNELDRLYADFRT 260

Query: 190 DTGREEIMNLW--RCFACGIGDLITIKLSYGS---ILGRFVGVDDFGYLLLEEKKGCVRQ 244
             G   +   W  RC A G      + +S G    + G F G+D  G LL+    G + +
Sbjct: 261 H-GFGPVREEWQRRCNAHG----RELSVSDGGSEVVRGMFAGIDGSGALLVSGADGAISK 315

Query: 245 IFTGDI 250
           I +GD+
Sbjct: 316 ILSGDV 321


>gi|124484959|ref|YP_001029575.1| hypothetical protein Mlab_0131 [Methanocorpusculum labreanum Z]
 gi|124362500|gb|ABN06308.1| biotin--acetyl-CoA-carboxylase ligase [Methanocorpusculum labreanum
           Z]
          Length = 328

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 121/246 (49%), Gaps = 17/246 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGN-----LWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
             F+ + STN   + R +  ++G+       ++A  QT G GR +  W+S +G ++A+++
Sbjct: 87  HHFEQVPSTN--ALARQMMHEVGDEVQPGTVLIAEQQTGGLGRMNRVWMSPEGGIWATIV 144

Query: 72  LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           ++  +  D   L+  A ++++   I     +     I+WPND+ +  +K+AG  +E    
Sbjct: 145 VMPKLHVDQTFLIMMAASISLARAIRHEFELSA--LIQWPNDVFIGDKKVAGTTLELAAD 202

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYP-----VTSLQRE-GGCIDLKDIFSLLFQDVARVLD 185
           ++ ++  +VGIG++V  C V+   P     VTSL  E G  +D   +FS+  ++  R   
Sbjct: 203 EDIIKYCLVGIGVDVNVC-VEKVMPNLSKIVTSLSDELGHDVDRAQLFSVFLKEFERRYQ 261

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +  K    E +   WR  +  +   + ++    S  G  + VD+ G L++ +  G V ++
Sbjct: 262 MILKGET-EPLFREWRSLSRTLHRRVRVRTIRESFEGEALDVDERGALIIHKDNGEVERV 320

Query: 246 FTGDIF 251
             GD +
Sbjct: 321 IAGDCY 326


>gi|312963382|ref|ZP_07777865.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas fluorescens WH6]
 gi|311282462|gb|EFQ61060.1| biotin--acetyl-CoA-carboxylase ligase [Pseudomonas fluorescens WH6]
          Length = 319

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 108/223 (48%), Gaps = 6/223 (2%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
             +D+I STN E ++   +       ++A  Q AGRGRR  KWIS    N+Y SL+L   
Sbjct: 79  HIYDSIDSTNAEALRLVNATCATPFLVLAEQQVAGRGRRGRKWISPFAQNIYYSLVLRIQ 138

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                L  LS  + +A+   +  +   G    +KWPND+LV Q+KIAGIL+E +     +
Sbjct: 139 DGLRQLEGLSLVVGLAVIQALRESGVQGA--VLKWPNDVLVGQKKIAGILLELVGDPADI 196

Query: 136 QAVVVGIGLNVKHCPVD-TPYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             VV+GIG+NV     D      TS+Q E G  +D   + +L+   + R LD   K +G 
Sbjct: 197 CHVVIGIGINVNMQRADEVDQQWTSMQLETGVAVDRNTLVALVGLQLQRYLDR-HKASGF 255

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             +   W       G  +++      + G  +GVD  G L L+
Sbjct: 256 AALQEEWEQNHGWQGRSVSLIAGVNRVDGVVLGVDQQGALRLD 298


>gi|307266004|ref|ZP_07547551.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918966|gb|EFN49193.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 326

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 124/234 (52%), Gaps = 10/234 (4%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS-KD 79
           I STN+   + A +   G + I+A  QTAGRGR    WIS KG  ++ S++L  +I  K+
Sbjct: 89  IDSTNNFAKEIASNVPDGTV-IIAEEQTAGRGRLGRSWISQKGCGIWMSIILKPNIQPKE 147

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
           ++ L   A A+++   I     V  + KIKWPNDI++  +K+ GIL E  +  + +  V+
Sbjct: 148 AINLTQLA-AISVVKAIEEVFHV--ESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVI 204

Query: 140 VGIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I
Sbjct: 205 IGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQK-GFEYI 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 264 RPICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|210623233|ref|ZP_03293672.1| hypothetical protein CLOHIR_01622 [Clostridium hiranonis DSM 13275]
 gi|210153770|gb|EEA84776.1| hypothetical protein CLOHIR_01622 [Clostridium hiranonis DSM 13275]
          Length = 329

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 123/238 (51%), Gaps = 9/238 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           ++F  I STN+       S   G L I++  Q+AG+GR    W S+ G  ++ SL+L   
Sbjct: 88  KYFQEIDSTNNYAKDNFESLKDGTL-IISEYQSAGKGRLGKNWQSNIGEGIWMSLMLKPE 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I       L+    VA  +++ +   +G D +IKWPNDI++  +KI GIL E +     +
Sbjct: 147 IPVYKAPFLTL---VAGAAILNAFRNIGVDAEIKWPNDIVLNGKKICGILTEMVAEVERV 203

Query: 136 QAVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
             VV+G+G+NV     P +     TSL++EG  +   DI   +  +  ++   + +   +
Sbjct: 204 GCVVIGMGINVNTMLFPGELSEKATSLKKEGFELKRSDIIREIMHEFEKLYTTYIEYGSK 263

Query: 194 EEIMNLWRCFACGIG-DLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           EE++++ R ++  IG D+  I  ++   +   + + D G L+++   G + ++ +G++
Sbjct: 264 EEVISVCRKYSVLIGKDVYIINKNHREKV-YCMDISDDGNLIVKHDDGVIEEVISGEV 320


>gi|193083923|gb|ACF09601.1| biotin acetyl-CoA-carboxylase ligase [uncultured marine
           crenarchaeote KM3-34-D9]
          Length = 332

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 125/247 (50%), Gaps = 17/247 (6%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +FD+I ST +  ++ A +       I++  QT G GR   KW S  G ++ S+++  
Sbjct: 89  RIYYFDSIDSTQNFAVEIAPNRKENGTVIISKKQTEGMGRLKRKWKSPVGGIWLSVIIHP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
             S   +TL+  A ++A+   I   L  G    +KWPND+ + ++K+AGIL++T    N 
Sbjct: 149 KFSTSQITLVPIATSLALHKAIEKVL--GIKPMLKWPNDLTLKKKKVAGILLDTSIQSNK 206

Query: 135 LQAVVVGIGLNVKHCPVD-------TP--YPVTSL-QREGGCIDLKDIFSLLFQDVARVL 184
           ++ +V+G+G+N K  P +       TP  Y  ++L ++    + L   F    +++ +++
Sbjct: 207 IEFLVLGVGINFKIKPHNLEKLLKKTPNFYGASTLIEKNEKPLPLVKQFLHELENIFQMI 266

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +        ++I+  W   +  IG  +++    G   G+ + +D+ G L++   K   ++
Sbjct: 267 N----SGSNKKIVTEWTKRSSTIGKNVSVITDDGRFNGKAIKLDNDGGLIITRGKKT-KK 321

Query: 245 IFTGDIF 251
           +F GD+ 
Sbjct: 322 LFVGDVL 328


>gi|297625933|ref|YP_003687696.1| BirA, Biotin-(acetyl-CoA carboxylase) ligase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296921698|emb|CBL56256.1| BirA, Biotin-(acetyl-CoA carboxylase) ligase [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 263

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 114/251 (45%), Gaps = 16/251 (6%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           +N Y    ++     STND+ +  A  G    L +++  Q  GR R D  W    G   A
Sbjct: 18  KNSYWGPIQWRPETGSTNDDLVALAKKGAATGLVVMSEHQVGGRARFDRVWQDTAGTSVA 77

Query: 69  SLLLIDSISKD-SLTLLSFAIAVAMRSVIAS-TLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + +L+           LS  + VA+R  + + T  V   V +KWPND+L+ +RKI GIL 
Sbjct: 78  TSVLVAPTPPPLQWGWLSLLVGVAVREGVENYTGAVPGRVTLKWPNDVLLDERKICGILS 137

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV-TSLQREGGCIDLKDIFSLLFQDVARVLD 185
           E +  +      V+G GLNV     + P P  TSL   G       + + + Q +     
Sbjct: 138 ERVGDR-----AVLGWGLNVSMSQEELPVPTGTSLLLAGLPHAKTPLMAAVLQALDHWFA 192

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSY-----GSILGRFVGVDDFGYLLLEEKKG 240
           +W++   R EI   +      IG  +T+ L +     GSI G   GVD  G L++++ +G
Sbjct: 193 VWQR---RGEIREEYARVCATIGRRVTVHLDFEHPDRGSITGVATGVDRNGALVVDDDQG 249

Query: 241 CVRQIFTGDIF 251
             R +  GD+ 
Sbjct: 250 TRRVLTAGDVV 260


>gi|326389755|ref|ZP_08211320.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325994237|gb|EGD52664.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 326

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 124/234 (52%), Gaps = 10/234 (4%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS-KD 79
           I STN+   + A +   G + I+A  QTAGRGR    WIS KG  ++ S++L  +I  K+
Sbjct: 89  IDSTNNFAKEIASNVPDGTV-IIAEEQTAGRGRLGRSWISQKGCGIWMSIILKPNIQPKE 147

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
           ++ L   A A+++   I     V  + KIKWPNDI++  +K+ GIL E  +  + +  V+
Sbjct: 148 AINLTQLA-AISVVKAIEEVFHV--ESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVI 204

Query: 140 VGIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I
Sbjct: 205 IGIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQK-GFEYI 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 264 RPICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|238062713|ref|ZP_04607422.1| biotin-acetyl-CoA-carboxylase ligase [Micromonospora sp. ATCC
           39149]
 gi|237884524|gb|EEP73352.1| biotin-acetyl-CoA-carboxylase ligase [Micromonospora sp. ATCC
           39149]
          Length = 291

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 117/270 (43%), Gaps = 27/270 (10%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DK 63
           L+    P++ R E      STN +  + A SG+   L ++A  QTAGRGRR   W S  +
Sbjct: 23  LTAPHGPWA-RLELRAETGSTNADVAEAARSGEPEGLVVIAERQTAGRGRRGRVWQSPPR 81

Query: 64  GNLYASLLLI----------DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPND 113
             +  S+LL                     L     VA+   +A    +  D  +KWPND
Sbjct: 82  AGIATSVLLRPGEAVAERDWPPAPATGYGWLPLLAGVALVEAVARLAEL--DAALKWPND 139

Query: 114 ILVFQRKIAGILIETL--NLKNGLQAVVVGIGLNVK----HCPVD-TPYPVTSLQREGG- 165
           +L+   K AGIL E +     +   A+V+GIGLNV       P + T  P TSLQ  G  
Sbjct: 140 LLIGDAKCAGILAEAVPGPAPDQPPAIVLGIGLNVTLRADELPANPTGLPATSLQLAGAV 199

Query: 166 CIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCF--ACG-IGDLITIKLSYGS-IL 221
             D   +   L + VA   D W+   G      L   +  AC  +G  + + L  G+ + 
Sbjct: 200 ATDRDPLLRALLRSVADWYDRWRHAGGDAVASGLRDAYLAACATVGRPVRVLLPGGAEVT 259

Query: 222 GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           G   GVD  G LL++   G  R +  GD+ 
Sbjct: 260 GVATGVDADGRLLVDTPAGP-RTLAAGDVL 288


>gi|260592644|ref|ZP_05858102.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella veroralis F0319]
 gi|260535414|gb|EEX18031.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella veroralis F0319]
          Length = 263

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 114/230 (49%), Gaps = 13/230 (5%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSISKD 79
           + STN+       + D     +VA  QT+GRG+  N W S+ G   L++ L+    +   
Sbjct: 30  VDSTNNFLRNYTPAEDELMTVVVAEHQTSGRGQGTNTWESESGKNLLFSILVHPIMLPVR 89

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
           S  LLS A A+A++  + S   V  D+++KWPNDI    +K++G LIET      ++  +
Sbjct: 90  SQFLLSEAGALALKEALTSY--VADDIRLKWPNDIYWKDKKLSGTLIETKLSGGHIKDCI 147

Query: 140 VGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLL---FQDVARVLDLWKKDTGRE 194
            G+GLNV       D P PV+  Q  G  +D +++   +   FQ+   +L+L     G  
Sbjct: 148 FGVGLNVNQSTFVSDAPNPVSLCQILGHEVDKEELLKQIIAKFQECYHLLEL----GGYN 203

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +I  ++       G     + + G   G  V V+D G+L+L ++ G +R+
Sbjct: 204 DISAMYHDALYRKGGFHQYRDTDGEFEGAIVEVEDDGHLILRDRSGMIRE 253


>gi|331018144|gb|EGH98200.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 319

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 115/241 (47%), Gaps = 22/241 (9%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGN 65
           E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S    N
Sbjct: 69  ESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFAEN 128

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL
Sbjct: 129 LYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGIL 186

Query: 126 IETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           +E +     +  V++G+G+NV       VD  +    LQ  G   D   I + L   +  
Sbjct: 187 LELIGDPADVCHVIIGVGVNVNMRASTEVDQLWTSVRLQ-TGAPADRNTIAARLSSQLEA 245

Query: 183 VLDLWKKD-----TGREEIMNLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFGYLLL 235
           +L + +++         E  +LW+  A        +KL  G  ++ G  +GVD  G L L
Sbjct: 246 LLVVHRQEGFLAFQKEWEQGHLWQGAA--------VKLLSGIETVEGVVLGVDSLGALRL 297

Query: 236 E 236
           E
Sbjct: 298 E 298


>gi|254450279|ref|ZP_05063716.1| BirA bifunctional protein, putative [Octadecabacter antarcticus
           238]
 gi|198264685|gb|EDY88955.1| BirA bifunctional protein, putative [Octadecabacter antarcticus
           238]
          Length = 193

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 98/197 (49%), Gaps = 15/197 (7%)

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           GN Y +L L      ++ +L SF   +A+   + + +  G  + +KWPND+L+   K+AG
Sbjct: 2   GNFYGTLSL-PCNDPETASLRSFVAVLAVDDALRAVMGDGPKLALKWPNDVLLNGGKVAG 60

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTP------YPVTSLQREGGCIDLKDIFSLLF 177
           IL+E+L +K  +  V VGIG+N+   P  T       YPV S++ E G     D F    
Sbjct: 61  ILLESLVVKGQMWGVAVGIGVNLIAAPDMTQVEDGAVYPV-SVKVESGVDVTPDGF---L 116

Query: 178 QDVARVLDLWKKDT---GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
           + +A     W +     G   I   W   A  +G+ IT +L   ++ GRF  VD+ GYL+
Sbjct: 117 KHLAPAFAQWDRQLTTYGFAPIRTAWLARAARLGETITARLPNENVTGRFDTVDENGYLV 176

Query: 235 LEEKKGCVRQIFTGDIF 251
           L   KG  R I   D+F
Sbjct: 177 LNTAKGP-RNIAAADVF 192


>gi|323524590|ref|YP_004226743.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1001]
 gi|323381592|gb|ADX53683.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1001]
          Length = 305

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 120/265 (45%), Gaps = 30/265 (11%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMSRVKALPRRAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC----------PVDTPYPV-----TSLQREGGCI 167
           GILIET    +   AVV+GIG NVK              +TP        T+LQR     
Sbjct: 155 GILIETAWSTDTASAVVIGIGTNVKGADELAAKLGALSAETPPQARGTAPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVG 226
           +L D  +     +   L  +  + G       W       G +++ ++  +    G   G
Sbjct: 215 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAMHAYAGREVVLLEQGHEVTRGVAAG 273

Query: 227 VDDFGYLLLEEKKGCVRQ-IFTGDI 250
           VD+ G LLL+   G  RQ I TGD+
Sbjct: 274 VDERGQLLLDTDAG--RQSIATGDV 296


>gi|283795506|ref|ZP_06344659.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. M62/1]
 gi|291077171|gb|EFE14535.1| biotin-[acetyl-CoA-carboxylase] ligase [Clostridium sp. M62/1]
 gi|295091188|emb|CBK77295.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Clostridium
           cf. saccharolyticum K10]
          Length = 326

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 114/237 (48%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + D + STN    K A +G +    +V+  QT G+GRR   W S +G  ++ +L+L  ++
Sbjct: 83  YLDEVDSTNTAAKKAAENGAVHGTLVVSERQTGGKGRRGRAWDSPRGTGIFMTLILRPNM 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           +    ++L+   A+A+   I      G +  IKWPNDI++  +KI GIL E     + + 
Sbjct: 143 APVHASMLTLVAALAVADGIREC--TGAESLIKWPNDIVMSGKKICGILTEMSADPDCIN 200

Query: 137 AVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIF-SLLFQDVARVLDLWKKDTGR 193
            V VGIG+NV  +  P +      S+  E G    + +  S +     R  +++ K T  
Sbjct: 201 YVAVGIGINVNMEEFPEEIRGVAASIFTETGKKTKRSLLISAVMAAFERYYEVFMKTTDM 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             ++  +       G  + +    G   G  +G+D  G LL+E +   VR++ +G++
Sbjct: 261 SGLLEDYNGKLANCGRTVRVLDPAGEYSGTAIGIDREGELLVEMEDTTVRRVLSGEV 317


>gi|325856361|ref|ZP_08172077.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella denticola CRIS
           18C-A]
 gi|325483545|gb|EGC86517.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella denticola CRIS
           18C-A]
          Length = 263

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 112/232 (48%), Gaps = 13/232 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            +T+ STN        + D      VA+ QTAGRG+  N W S+ G   L++ L+    +
Sbjct: 27  LETVDSTNSFLRTYTPAADEPMTVAVAAYQTAGRGQGANTWESEAGKNLLFSVLVHPVML 86

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S  LLS A A+A++  +A    V  D+++KWPNDI    RK++G LIET      ++
Sbjct: 87  PVRSRFLLSEAGALALKEALADY--VKDDIRLKWPNDIYWKDRKLSGTLIETKLGGGHIK 144

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLL---FQDVARVLDLWKKDT 191
             + G+GLNV       D P PV+  Q  G  +D  ++   +   F D   +L++     
Sbjct: 145 DCIFGVGLNVNQTVFHSDAPNPVSLCQILGHEVDKDELLDKIIRKFSDFYHLLEM----G 200

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           G  +I  ++       G     + + G   G  + V+D G+L+L ++ G +R
Sbjct: 201 GYNDISAMYHEALYRRGGFHRFRDADGDFDGSIIEVEDDGHLILRDRNGSIR 252


>gi|330962541|gb|EGH62801.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 319

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 115/237 (48%), Gaps = 6/237 (2%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           S +++   P  +    +D+I STN E  +    G    L ++A  QT+GRGRR  KW+S 
Sbjct: 65  SAITQSGLPEGWTVRTYDSIDSTNAEAARLIAEGISMPLLVLAEQQTSGRGRRGRKWVSP 124

Query: 63  -KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
              NLY S++L        L  LS  + +A+ +V+      G    +KWPND+LV ++KI
Sbjct: 125 FAENLYYSVVLRIDGGMRQLEGLSLLVGLAVMNVLRDLGVSGAG--LKWPNDVLVGKQKI 182

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVK-HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQD 179
           AGIL+E +     +  V++GIG+NV      +     TS++ E G   D  ++ + +   
Sbjct: 183 AGILLELIGDPADVCHVIIGIGVNVNMQASTEVDQSWTSIRLETGNLADRNEVAARISAR 242

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
           +  +L +  +D G       W       G  +T+     ++ G  +GVD  G L LE
Sbjct: 243 LDALLHV-HRDKGFAAFREDWERGHLWQGSAVTLLSGVQTVEGVVLGVDLLGALRLE 298


>gi|213969198|ref|ZP_03397336.1| birA bifunctional protein [Pseudomonas syringae pv. tomato T1]
 gi|301381705|ref|ZP_07230123.1| biotin--protein ligase [Pseudomonas syringae pv. tomato Max13]
 gi|302062649|ref|ZP_07254190.1| biotin--protein ligase [Pseudomonas syringae pv. tomato K40]
 gi|302130764|ref|ZP_07256754.1| biotin--protein ligase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213925876|gb|EEB59433.1| birA bifunctional protein [Pseudomonas syringae pv. tomato T1]
          Length = 319

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 115/241 (47%), Gaps = 22/241 (9%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGN 65
           E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S    N
Sbjct: 69  ESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFAEN 128

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL
Sbjct: 129 LYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGIL 186

Query: 126 IETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           +E +     +  V++G+G+NV       VD  +    LQ  G   D   I + +   +  
Sbjct: 187 LELIGDPADVCHVIIGVGVNVNMRVSTEVDQLWTSVRLQ-TGAPADRNTIAARISAQLEA 245

Query: 183 VLDLWKKD-----TGREEIMNLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFGYLLL 235
           +L + +++         E  +LW+  A        +KL  G  ++ G  +GVD  G L L
Sbjct: 246 LLAVHRQEGFLAFQKEWEQGHLWQGAA--------VKLLSGIETVEGVVLGVDSLGALRL 297

Query: 236 E 236
           E
Sbjct: 298 E 298


>gi|148658140|ref|YP_001278345.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus sp. RS-1]
 gi|148570250|gb|ABQ92395.1| biotin--acetyl-CoA-carboxylase ligase [Roseiflexus sp. RS-1]
          Length = 272

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 115/249 (46%), Gaps = 24/249 (9%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL----I 73
           ++ ++STND   +RA SG    L ++A  Q+AGRGR    W++  G+ L  S+LL    +
Sbjct: 29  YERVASTNDIARERARSGAAEGLIVLAEEQSAGRGRLGRNWVASYGDALLMSVLLRPVWL 88

Query: 74  DSISKDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGILIET 128
                 +LT+L+  A+  A+  V A         ++KWPND+L+F     RK AGIL E 
Sbjct: 89  PPGEAFTLTMLAGVALCEAVEQVAA------VRAQLKWPNDLLLFANGAWRKGAGILTEI 142

Query: 129 LNLKNGLQAVVVGIGLNVKHCPV------DTPYPVTSLQREGGC-IDLKDIFSLLFQDVA 181
               + ++  ++GIGLNV   P       +     TS+    G  I    +   L   + 
Sbjct: 143 SVAGDAIEWAIIGIGLNVNQAPTGAVNGRNLQQTATSVSAAAGQRISRTALLETLLTSLD 202

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
               L +    R  +   WR     +G+ +T+ L  G + G    V   G LLL +  G 
Sbjct: 203 ERYALLRSGE-RATLFADWRARLAYLGETVTVTLPNGELRGIAEDVAADGTLLLRDAAGV 261

Query: 242 VRQIFTGDI 250
           +  I TGD+
Sbjct: 262 LHTIHTGDV 270


>gi|83592657|ref|YP_426409.1| biotin--acetyl-CoA-carboxylase ligase [Rhodospirillum rubrum ATCC
           11170]
 gi|83575571|gb|ABC22122.1| Biotin--acetyl-CoA-carboxylase ligase [Rhodospirillum rubrum ATCC
           11170]
          Length = 277

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 111/235 (47%), Gaps = 10/235 (4%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSISKDS 80
           + STN      A  G L    +VA  Q AGRG+ +  W S  G  L  S+LL      + 
Sbjct: 37  VDSTNRLMGGLARDGALPGTVVVADHQVAGRGKGERPWFSRPGEGLCLSILLSPKRPIEE 96

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG-LQAVV 139
           +  L+  IAVA+   I  T   G   ++KWPND+LV  RK+ GIL E L+  +G +  V+
Sbjct: 97  VPQLTLVIAVAVAEAI--TRATGVQPRVKWPNDLLVDGRKLCGILCELLSSADGDVHHVI 154

Query: 140 VGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
            GIGLN      D P  +    TSL  E G  ID   +  +L   +   ++LW+++ G  
Sbjct: 155 AGIGLNTGLSVDDFPGSLQAIGTSLAIESGRAIDRFAVLPVLLDHLEAWVELWERE-GFA 213

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            + + W   +C +G  IT++       G  V +   G L + ++ G V     G+
Sbjct: 214 PVRDAWVRLSCTLGKDITLESEGTRCHGVAVDLGIDGSLSIRDESGEVHHFHYGE 268


>gi|89099891|ref|ZP_01172763.1| biotin [acetyl-CoA carboxylase] synthetase [Bacillus sp. NRRL
           B-14911]
 gi|89085449|gb|EAR64578.1| biotin [acetyl-CoA carboxylase] synthetase [Bacillus sp. NRRL
           B-14911]
          Length = 327

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 118/239 (49%), Gaps = 9/239 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
           + +++ ST     + A         +VA  Q  GRGR D KW S K   ++ S++L   I
Sbjct: 88  YEESVDSTQKIAHRLAYDDAPEGTIVVAEEQLNGRGRMDRKWHSPKYTGIWMSVILRPEI 147

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                  L+   AVA+   I     +    +IKWPNDIL+  +K+ GIL E     + + 
Sbjct: 148 PLPRAPQLTLLAAVAVVQSIEECTALSP--QIKWPNDILIGGKKVTGILTELQAEADRIF 205

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
           ++++GIG+NV     D P  +    TSL  E GG +   ++  ++ Q +  +  L+  + 
Sbjct: 206 SIIIGIGINVNQQLEDYPEELRGTATSLAIEKGGNLSRAELVRVVLQKLENLYKLY-MEK 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  IT +   GSI G+ +G+ + G L +E++ G +  +++ DI
Sbjct: 265 GFYPIRLLWESYAVSIGKQITARTISGSISGKALGITEEGVLRIEDEAGEIHHVYSADI 323


>gi|27468062|ref|NP_764699.1| biotin ligase [Staphylococcus epidermidis ATCC 12228]
 gi|57866956|ref|YP_188603.1| birA bifunctional protein [Staphylococcus epidermidis RP62A]
 gi|251810884|ref|ZP_04825357.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282876110|ref|ZP_06284977.1| biotin-(acetyl-CoA-carboxylase) ligase [Staphylococcus epidermidis
           SK135]
 gi|293366575|ref|ZP_06613252.1| biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315607|gb|AAO04741.1|AE016747_238 biotin ligase [Staphylococcus epidermidis ATCC 12228]
 gi|57637614|gb|AAW54402.1| birA bifunctional protein [Staphylococcus epidermidis RP62A]
 gi|251805564|gb|EES58221.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281295135|gb|EFA87662.1| biotin-(acetyl-CoA-carboxylase) ligase [Staphylococcus epidermidis
           SK135]
 gi|291319344|gb|EFE59713.1| biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329735344|gb|EGG71636.1| biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus epidermidis
           VCU045]
 gi|329737382|gb|EGG73636.1| biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus epidermidis
           VCU028]
          Length = 323

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 119/246 (48%), Gaps = 22/246 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E + T+ ST  +  KRAL G+     I++  QT GRGR +  W S KG  L+ SL+L   
Sbjct: 86  EVYHTVDSTQLKA-KRALVGNKDTFLILSDEQTEGRGRFNRNWESSKGKGLWMSLVLRPD 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +   +  IA+ +R  I         V IKWPNDI +  +KI G L E +   + +
Sbjct: 145 VPFSMIPKFNLFIALGIRDAIQQF--SNERVTIKWPNDIYIGNKKICGFLTEMVANYDEI 202

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGGCIDLKDIF--SLLFQDVARVLDLWKK 189
           +A++ GIG+N+ H   D    +    TS++     I  +  F  +LL Q + R      +
Sbjct: 203 EAIICGIGINMNHVESDFDEDIKDKATSIRMHSDSIINRYTFLTALLTQIIHRFDQFLHQ 262

Query: 190 --DTGREEIM---NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             ++ REE +   N+W          +    +    LG  + +D  G+L+++++KG + +
Sbjct: 263 TFESIREEYIHATNIWHR-------QLKFTENNHQFLGEAIDIDSDGFLIVKDEKGQLHR 315

Query: 245 IFTGDI 250
           + + DI
Sbjct: 316 LMSADI 321


>gi|50954284|ref|YP_061572.1| biotin acetyl-CoA-carboxylase synthetase [Leifsonia xyli subsp.
           xyli str. CTCB07]
 gi|50950766|gb|AAT88467.1| biotin acetyl-CoA-carboxylase synthetase [Leifsonia xyli subsp.
           xyli str. CTCB07]
          Length = 270

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 119/244 (48%), Gaps = 19/244 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASC-QTAGRGRRDNKWISDKGNLYA--SLLLI 73
           +  +   STND    R  SGDL +L +V +  QT GRGR    W++  G   A   LL  
Sbjct: 31  DVLEEAGSTNDVMQAR--SGDLPDLAVVVTGNQTGGRGRLGRVWVAPPGKTLAISVLLKP 88

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           + +  D+         +AMR  +A  +P   +V++KWPND+L+   K++GIL E L    
Sbjct: 89  EGLKPDAFGWFPLLAGLAMRRALAGFVP--REVEVKWPNDVLIDGAKVSGILTELL---P 143

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK--DT 191
           G++ VVVG G+N+     + P P  +     G  D  D  ++L   +  ++ L++     
Sbjct: 144 GMRGVVVGAGVNLTVAGDELPVPTATSLLLAGATD-PDTDAVLAAYLIELVVLYRDFLTA 202

Query: 192 GREEIMNLWR---CFACG-IGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           G + + +  R     AC  IG  + ++L   GS+ G  V +DD G L++E   G    + 
Sbjct: 203 GGDAVRSALRGEVAAACHTIGRAVRVELPGGGSLTGVAVALDDTGRLIVESDAGRT-AVA 261

Query: 247 TGDI 250
            GD+
Sbjct: 262 AGDV 265


>gi|304413255|ref|ZP_07394728.1| biotin-(acetyl-CoA carboxylase) ligase [Candidatus Regiella
           insecticola LSR1]
 gi|304284098|gb|EFL92491.1| biotin-(acetyl-CoA carboxylase) ligase [Candidatus Regiella
           insecticola LSR1]
          Length = 322

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 117/244 (47%), Gaps = 20/244 (8%)

Query: 17  EFFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL 72
           E    I STN    E M    SGD      VA  Q +GRGRR  +W+S  G N+Y S+  
Sbjct: 84  EVLSVIDSTNQYLLERMNELQSGDA----CVAEHQYSGRGRRGRQWVSPFGSNIYFSMFW 139

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGT-DVKIKWPNDILVFQRKIAGILIETLNL 131
                 +S+T LS  I  A+  V+     +G  D+++KWPND+ +  +K+AGIL+E    
Sbjct: 140 RLEQGPESVTGLSLVIGTAIAEVLKQ---MGVEDIRVKWPNDLYLHGKKLAGILVELTGK 196

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPV-----TSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                 +V+G+G+N+   P+           T+LQ  G  ID   + + +F  + R +  
Sbjct: 197 MGDAVQLVMGVGINI-LMPITAQKESINQDWTTLQEAGITIDRNKLTAEVFAALKRDMTQ 255

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++K+ G    ++ WR      G  + + +    I G   G+D  G LLLE+  G V+   
Sbjct: 256 FEKE-GLTAFIDRWRQLDNYCGCPVKLIVGKKEIRGIARGIDSQGALLLEQ-NGTVKAYS 313

Query: 247 TGDI 250
            G+I
Sbjct: 314 GGEI 317


>gi|229592919|ref|YP_002875038.1| biotin--protein ligase [Pseudomonas fluorescens SBW25]
 gi|229364785|emb|CAY52793.1| bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-CoA-carboxylase] synthetase
           (biotin--protein ligase)] [Pseudomonas fluorescens
           SBW25]
          Length = 319

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 114/233 (48%), Gaps = 10/233 (4%)

Query: 20  DTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSISK 78
           D+I STN E ++   +G      ++A  QTAGRGRR  KW+S    N+Y SL+L      
Sbjct: 82  DSIDSTNAEALRLVDAGCAAPFLVLAEQQTAGRGRRGRKWVSPFAQNVYYSLVLRIESGL 141

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
             L  LS  + +A+   +  +   G    +KWPND+LV Q+KIAGIL+E +     +  V
Sbjct: 142 RQLEGLSLVVGLAVMQALRESGVRGA--ALKWPNDVLVGQKKIAGILLELVGDPADICHV 199

Query: 139 VVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREE 195
           V+GIG+NV   +   VD  +  + L   G  +D   + + L   + R L+   ++ G   
Sbjct: 200 VLGIGINVNMQRADEVDQQW-TSVLLETGSSVDRNALVAQLGVQLQRYLER-HREGGFVA 257

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +   W       G  +++      + G  +GVD  G L L  +   V +I++G
Sbjct: 258 LQEEWEQSHAWQGRSVSLIAGVNQVDGVVLGVDRQGALRLSVE--GVEKIYSG 308


>gi|315634470|ref|ZP_07889755.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Aggregatibacter segnis ATCC 33393]
 gi|315476697|gb|EFU67444.1| biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase
           [Aggregatibacter segnis ATCC 33393]
          Length = 310

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 115/242 (47%), Gaps = 14/242 (5%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           L+E   PY    +    ISSTN   ++       G L  +A  QTAGRGRR  +WIS   
Sbjct: 65  LAEALKPYHVVVK--PVISSTNQYLLENVAHLQKGAL-CLAEYQTAGRGRRGRQWISPFA 121

Query: 64  GNLYASLL-LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           G +  S    +D   +  L  LS  I +A+   +      G   ++KWPNDILV +RK+A
Sbjct: 122 GQIIMSFYWQLDP--RKPLDGLSTVIGLAIVQALVELDMYG--FQVKWPNDILVNERKLA 177

Query: 123 GILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           GIL+E +N  NG   +VVGIG+NV   +   +D P+    L      ID + +   +   
Sbjct: 178 GILVEIVNRPNGKLNLVVGIGMNVSLGQEKQIDQPW--AELAEFFPHIDRERLIIQMVNT 235

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           + R L  +++     E+   W  +   +G  + +     +I G   G++  G+L L  +K
Sbjct: 236 IYRYLARFEQHGIDAEMQQQWLEYDAYLGTEVNVISEKNTISGIEQGINAQGHLCLMTEK 295

Query: 240 GC 241
           G 
Sbjct: 296 GV 297


>gi|118472517|ref|YP_886193.1| biotin-[acetyl-CoA-carboxylase] ligase [Mycobacterium smegmatis
           str. MC2 155]
 gi|118173804|gb|ABK74700.1| biotin-[acetyl-CoA-carboxylase] ligase [Mycobacterium smegmatis
           str. MC2 155]
          Length = 270

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 122/245 (49%), Gaps = 16/245 (6%)

Query: 16  YEFFDTIS---STNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLL 71
           +  FD ++   STN + + RA SG D+    + A  QTAGRGR   +W +   +  A  +
Sbjct: 26  WRSFDVVAETGSTNADLLARARSGTDINGAVLAAEHQTAGRGRNGRQWTTPPRSQIAVSV 85

Query: 72  LIDSISKDSLT--LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
            ID+    S    LL  A  VA+   I++    G + K+KWPND+LV   K+AGIL E  
Sbjct: 86  GIDTTGVPSTAWGLLPLATGVAVVDAISAV--TGVEAKLKWPNDVLVDTGKLAGILAE-- 141

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTPYPV-TSLQR-EGGCIDLKDIFSLLFQDVARVLDLW 187
            + +    VV+G GLNV   P D P  V TSL       +D   + +     +A  ++ W
Sbjct: 142 -VASPAPTVVIGTGLNVSVMPDDVPDSVATSLAMLTDAPVDRSALLTEFLTRLADRVESW 200

Query: 188 KKDTGREE-IMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQI 245
           +   G ++ +++ +R  +  +G  + + L     +LG  V +D+ G LL+ + +G    +
Sbjct: 201 RAAGGADDRLLDDYRQCSGTLGTAVRVLLPGDRQLLGDAVDIDESGRLLI-DSEGERITV 259

Query: 246 FTGDI 250
             GD+
Sbjct: 260 AAGDV 264


>gi|297545155|ref|YP_003677457.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842930|gb|ADH61446.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 326

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 119/234 (50%), Gaps = 8/234 (3%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKD 79
           TI STN+   + A     G + I+A  Q+AGRGR    W+S KG  ++ S++L  +I   
Sbjct: 88  TIDSTNNFAKEIASKVPDGTV-IIAEEQSAGRGRLGRSWLSQKGCGIWMSVILKPNIQPQ 146

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L+   A+++   I     V  + KIKWPNDI+V  +K+ GIL E  +  + +  VV
Sbjct: 147 EAINLTQVAAISVVKAIEELSHV--ENKIKWPNDIIVNNKKVCGILTEMSSEIDKINYVV 204

Query: 140 VGIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I
Sbjct: 205 IGIGVNVNCYNFPEELKGKATSLNLETNSKVDRKKLTASILNNLEFYYNTYLQK-GFEYI 263

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +    +  IG  I +  + G + G+ V +D  G L++E K+G    I +GD+
Sbjct: 264 RPICIAKSITIGREIKVIYNEGEMEGKAVTIDSNGSLIVETKEGKRLSIMSGDV 317


>gi|288931763|ref|YP_003435823.1| biotin/acetyl-CoA-carboxylase ligase [Ferroglobus placidus DSM
           10642]
 gi|288894011|gb|ADC65548.1| biotin/acetyl-CoA-carboxylase ligase [Ferroglobus placidus DSM
           10642]
          Length = 301

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 120/242 (49%), Gaps = 29/242 (11%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           ++ +F+ + STN+   K   S       ++A  QTAGRGR   KW S++G LY S     
Sbjct: 82  KFLYFEEVDSTNNVAKKEERS------CVLAKRQTAGRGRLGRKWESEEGGLYFSF---- 131

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
              +    + +  + +    V+A TL    + KIKWPNDIL+  +K++GIL E +  +  
Sbjct: 132 EFPRKVPAVKAHRVTILTGLVVAKTLE-KFNAKIKWPNDILIDGKKVSGILCELVG-EEL 189

Query: 135 LQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL-WKKDTG 192
              V+VG+G+NVK+  P +     T+L+     + + +IF     + A VL+L W K   
Sbjct: 190 SSRVIVGVGINVKNELPEELKDRATTLKNYN--VSITEIFCSFANNFAEVLNLEWSK--- 244

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC---VRQIFTGD 249
              I+  WR     IG  + ++       G  + VDD G L+++    C   + ++F+G+
Sbjct: 245 ---ILEKWRQLLDTIGKEVEVRAGSEVYRGIALDVDDEGALIVK----CGDELERVFSGE 297

Query: 250 IF 251
            F
Sbjct: 298 CF 299


>gi|167754147|ref|ZP_02426274.1| hypothetical protein ALIPUT_02440 [Alistipes putredinis DSM 17216]
 gi|167658772|gb|EDS02902.1| hypothetical protein ALIPUT_02440 [Alistipes putredinis DSM 17216]
          Length = 259

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 111/232 (47%), Gaps = 16/232 (6%)

Query: 12  YSFRYEFFDTISSTNDECMK-RALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYAS 69
           +  RY F +  +STNDE    R   GD     I A  QTAGRG+R + W S++G NL  S
Sbjct: 2   HRTRYHFLEETTSTNDEARNPRYGHGDA----ICAERQTAGRGQRGHTWSSEEGRNLMFS 57

Query: 70  LLLIDS-ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           L+     +      LLS A+A+A+  +       G D +IKW NDI    RK+ GILIE 
Sbjct: 58  LVWEPRFLPVSEQFLLSEAVALALTDLFGG---YGIDARIKWTNDIYAGDRKLVGILIEH 114

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGC-IDLKDIFSLLFQDV-ARVLD 185
               + L   +VGIG+NV     D   P  +S+  E GC  D +++   L   + AR   
Sbjct: 115 NLTGDRLSRTIVGIGVNVNQTRFDPSLPNPSSMCLETGCEYDRQEVLHRLGDCLAARYEQ 174

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLE 236
           L K D  RE +   +R     +G+    +   G ++     GV   G LLLE
Sbjct: 175 LEKGD--REALQADYRRRMYRLGERHRYRYPDGRTVEAVLRGVRPSGELLLE 224


>gi|219850088|ref|YP_002464521.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus aggregans DSM
           9485]
 gi|219544347|gb|ACL26085.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus aggregans DSM
           9485]
          Length = 267

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 106/220 (48%), Gaps = 18/220 (8%)

Query: 43  IVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL 100
           IVA  QTAGRGR   +W++  G+  L++  L   + +  + T L +  AVA+   I +  
Sbjct: 50  IVAEEQTAGRGRLGRRWVAPPGSALLFSLGLQPPAAATSTPTALIWLAAVALLETIEAET 109

Query: 101 PVGTDVKIKWPNDILVFQR----KIAGILIETLNLKNGLQAVVVGIGLNVKHCP--VDTP 154
           P+     +KWPND+LV       K AGIL+E    +  L   ++G G+N+   P    T 
Sbjct: 110 PL--TAGLKWPNDVLVNTSAGWAKTAGILLEGGWDEGQLVWAIIGCGINISAAPDPQTTL 167

Query: 155 YPVTSLQREGGCIDLKDIFSLLF-QDVARVLDLWKK---DTGREEIMNLWRCFACGIGDL 210
           YP T+L   G      D+  L F Q + R  D W +       + + + WR     +G  
Sbjct: 168 YPATALTLAGA----PDVDRLRFLQALLRRYDFWLQRLYAGDSDSLWSTWRSRLLTLGQN 223

Query: 211 ITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           +TI   +G I G  + VD  G L++    G + +I +GD+
Sbjct: 224 VTINTGHGVIHGEAIDVDRQGTLIVRAPHGNIHRIESGDV 263


>gi|28867838|ref|NP_790457.1| birA bifunctional protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851074|gb|AAO54152.1| birA bifunctional protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 319

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 115/241 (47%), Gaps = 22/241 (9%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGN 65
           E   P  +    +D+I STN E  +    G    L +VA  QTAGRGRR  KW+S    N
Sbjct: 69  ESGMPGEWSVRTYDSIDSTNAEASRLIALGAPMPLLVVAEQQTAGRGRRGRKWVSPFAEN 128

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY SL+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL
Sbjct: 129 LYYSLVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGIL 186

Query: 126 IETLNLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVAR 182
           +E +     +  V++G+G+NV       VD  +    LQ  G   D   I + +   +  
Sbjct: 187 LELIGDPADVCHVIIGVGVNVNMRASTEVDQLWTSVRLQ-TGAPADRNTIAARISSQLEA 245

Query: 183 VLDLWKKD-----TGREEIMNLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFGYLLL 235
           +L + +++         E  +LW+  A        +KL  G  ++ G  +GVD  G L L
Sbjct: 246 LLVVHRQEGFLAFQKEWEQGHLWQGAA--------VKLLSGIETVEGVVLGVDSLGALRL 297

Query: 236 E 236
           E
Sbjct: 298 E 298


>gi|134298046|ref|YP_001111542.1| biotin--acetyl-CoA-carboxylase ligase [Desulfotomaculum reducens
           MI-1]
 gi|134050746|gb|ABO48717.1| biotin--acetyl-CoA-carboxylase ligase [Desulfotomaculum reducens
           MI-1]
          Length = 333

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 113/238 (47%), Gaps = 8/238 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLLIDSI 76
           ++ T +STN+     A  G      I+   Q+ GRGR    W    +  L  S++L    
Sbjct: 92  YYKTTTSTNEVAKDLARQGITEGAIIITEEQSKGRGRLGRTWQCPPRTGLCFSVVLFPRA 151

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           +   +   +   AVA+   +  TL  G   ++KWPND+ +   KI GIL E     + ++
Sbjct: 152 NPMEVPQFTMLAAVAVVKALYRTL--GLRAQVKWPNDVYIEGLKICGILAEMAAEADRVK 209

Query: 137 AVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLK-DIFSLLFQDVARVLDLWKKDTG 192
            VV+GIGLNV     D        TSL+ + G   L+  I  +L +++  +  LW+++ G
Sbjct: 210 YVVLGIGLNVNQSKEDLVCFGNTATSLRVQLGRTLLRSQILKVLLEELDNLYTLWQQE-G 268

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +  LWR  A  IG+ + +     +  G   G+DD G LLL    G ++  ++G++
Sbjct: 269 FLPLKGLWRDNALWIGNKVQVSGLNSNYQGTMEGIDDGGALLLRLYDGTIKTFYSGEV 326


>gi|300087947|ref|YP_003758469.1| biotin/acetyl-CoA-carboxylase ligase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527680|gb|ADJ26148.1| biotin/acetyl-CoA-carboxylase ligase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 255

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 117/255 (45%), Gaps = 17/255 (6%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           +N S   + +S    F+ ++ ST D   + A  G      +VA+ Q AGRGR    W+S 
Sbjct: 7   NNESWEGSTWSTHTHFYPSVDSTMDIARQMAKGGCTEGTNVVAARQHAGRGRLSRVWLSP 66

Query: 63  KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           +G++  S++L   +++ S  ++   +AV    V A     G    +KWPNDI++   K+ 
Sbjct: 67  EGSVSMSVVLFPELNRLSHLVMIAGVAV----VEALESFTGVSPALKWPNDIIIRGLKLG 122

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD--- 179
           GIL+E+  +     A V+GIGLNV     D P      +  G    L DI    F++   
Sbjct: 123 GILVESGTVSERRYA-VIGIGLNVNVTIGDYP------EIAGIATSLFDITGKNFRETEV 175

Query: 180 ---VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
              + R L+ + +     EI   WR     I   +T++     I G    V+  G L++ 
Sbjct: 176 SRSIVRSLEHYYRGIDNSEIFQRWRSRLDTIDRRVTVETGGNHIEGIARDVNPDGSLIIR 235

Query: 237 EKKGCVRQIFTGDIF 251
              G   Q+F GDI+
Sbjct: 236 SDDGIDHQVFAGDIW 250


>gi|291520203|emb|CBK75424.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Butyrivibrio
           fibrisolvens 16/4]
          Length = 240

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 87/153 (56%), Gaps = 8/153 (5%)

Query: 13  SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL 72
             RYE+++++ STN+    RA   +   L I A  QTAG+GR   KW S      A+ LL
Sbjct: 4   EIRYEYYESVDSTNERIKSRAHQDESQGLVISAGHQTAGKGRIGRKWESPSHESIATSLL 63

Query: 73  ID--SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +    IS +++  ++   A+A+R  I      G + +IKWPNDI++  +KI GIL E + 
Sbjct: 64  LTPAEISLEAIPTITVVAAMAVRDAIHRIY--GLEGQIKWPNDIVIDGKKICGILTE-ME 120

Query: 131 LKNG-LQAVVVGIGLNV--KHCPVDTPYPVTSL 160
           +++G +  VVVGIG+NV  K  P +  +  TS+
Sbjct: 121 MRDGKVWYVVVGIGVNVHNKTFPKEIAFKATSI 153


>gi|167626055|ref|YP_001676349.1| biotin--protein ligase [Shewanella halifaxensis HAW-EB4]
 gi|167356077|gb|ABZ78690.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella halifaxensis
           HAW-EB4]
          Length = 320

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 121/244 (49%), Gaps = 18/244 (7%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISD 62
           ++ ++  S R  +FD I STN   +K A   +SGD+     VA  Q+AGRGRR   W+S 
Sbjct: 71  TKLKSQMSNRCFYFDEIPSTNAFILKHAEELISGDI----CVAEYQSAGRGRRGRVWVSP 126

Query: 63  KG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
            G +LY S+             LS  +A ++ SV+   L V  DV +KWPNDI +  +K+
Sbjct: 127 YGCHLYFSMYWQFPQGMAQAMGLSLVVACSIVSVL-EKLGV-KDVGVKWPNDIYLDNKKL 184

Query: 122 AGILIETLNLKNGLQAVVVGIGLNV----KHCP-VDTPYPVTSLQREGGCIDLKDIFSLL 176
           AG+LIE     +    +V+GIGLN+    +H   +D P+  + L  +    D   +  LL
Sbjct: 185 AGVLIEMSGQADSECNLVIGIGLNMVMGEQHAAQIDQPW--SDLSGQARMPDKTALLILL 242

Query: 177 FQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
            + + + L L+ +++G       WR      G  + + +    I G   GVD+ G ++LE
Sbjct: 243 QKQLHQDLSLF-QNSGLTPFQERWRAADLFQGKPVKLLMGQDEIHGVCRGVDEQGAIVLE 301

Query: 237 EKKG 240
              G
Sbjct: 302 TDSG 305


>gi|149241260|pdb|2E41|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With The Reaction Product Analog
           Biotinol-5'-Amp, Mutations R48a And K111a
 gi|149241261|pdb|2E41|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With The Reaction Product Analog
           Biotinol-5'-Amp, Mutations R48a And K111a
 gi|151567530|pdb|2E64|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutations R48a And K111a
 gi|151567531|pdb|2E64|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii, Mutations R48a And K111a
 gi|167013385|pdb|2ZGW|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Adenosine And Biotin,
           Mutations R48a And K111a
 gi|167013386|pdb|2ZGW|B Chain B, Crystal Structure Of Biotin Protein Ligase From Pyrococcus
           Horikoshii Complexed With Adenosine And Biotin,
           Mutations R48a And K111a
 gi|170292165|pdb|2EJF|A Chain A, Crystal Structure Of The Biotin Protein Ligase (Mutations
           R48a And K111a) And Biotin Carboxyl Carrier Protein
           Complex From Pyrococcus Horikoshii Ot3
 gi|170292166|pdb|2EJF|B Chain B, Crystal Structure Of The Biotin Protein Ligase (Mutations
           R48a And K111a) And Biotin Carboxyl Carrier Protein
           Complex From Pyrococcus Horikoshii Ot3
          Length = 235

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 121/238 (50%), Gaps = 21/238 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L  + G + IVA  QT G G  + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYL--EEGTV-IVADKQTMGHGALNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV    V+ +      D +IKWPND+LV  + IAG+L+E    K  
Sbjct: 69  KVPQKDLPKIVFLGAVG---VVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDK-- 123

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARV-LDLWKKDTG 192
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+ L+  K    
Sbjct: 124 ---IVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPM- 176

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +I+NL R     +G  + I L  GS  G    +DDFG L++    G V+++  GD+
Sbjct: 177 --DILNLVRDNMI-LGVRVKI-LGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDV 230


>gi|307353844|ref|YP_003894895.1| biotin/acetyl-CoA-carboxylase ligase [Methanoplanus petrolearius
           DSM 11571]
 gi|307157077|gb|ADN36457.1| biotin/acetyl-CoA-carboxylase ligase [Methanoplanus petrolearius
           DSM 11571]
          Length = 332

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 117/244 (47%), Gaps = 13/244 (5%)

Query: 14  FRYEFFDTISST---NDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASL 70
            RY F +T S+T    D C K+      G + ++A  QT G GR    W S  G ++ ++
Sbjct: 90  IRY-FKNTPSTTWVAKDLCSKKDAENFNGTI-LIAEEQTGGVGRLGRAWFSPSGGIWTTI 147

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L  +I  D L  ++ + ++A+   I     +G    IKWPNDI +  +K++GIL+E   
Sbjct: 148 ILKPTIPIDKLFFVTMSASIAVARTIRRMYDIG--ALIKWPNDIYIGDKKVSGILLELAA 205

Query: 131 LKNGLQAVVVGIGLNVKHCPVD----TPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLD 185
             + +   ++GIG++    P D       P+TSL  E G  ID     + +  +  R   
Sbjct: 206 EADQIHYCLLGIGIDANIKPEDLQCSLQTPITSLNIEIGHDIDRAKFLATMLGEFERRYK 265

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI 245
           L ++   +  I   W+  +  +   + I     +  G  + +D++G L++++  G V +I
Sbjct: 266 LVEEGEYK-AISREWKSLSLTLEKRVRITTPRRTFEGEAIDLDEYGALIIKKDNGKVERI 324

Query: 246 FTGD 249
            +GD
Sbjct: 325 LSGD 328


>gi|300782902|ref|YP_003763193.1| biotin-[acetyl-CoA-carboxylase] ligase [Amycolatopsis mediterranei
           U32]
 gi|299792416|gb|ADJ42791.1| biotin-[acetyl-CoA-carboxylase] ligase [Amycolatopsis mediterranei
           U32]
          Length = 263

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 116/250 (46%), Gaps = 18/250 (7%)

Query: 15  RYEFFDTIS---STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           RY   D +    STN +  K   +G      ++A  QTAG GRR   W S KG  LY S+
Sbjct: 14  RYAKIDVVERTGSTNADLRKALETGAADRTVLLAEEQTAGVGRRARSWSSPKGAGLYLSV 73

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
            L   +    L  LS    +A+R+  AS   VG D  +KWPND+LV   K AGIL E + 
Sbjct: 74  ALRPGVPFAVLGSLSVVAGLAVRAAAAS---VGVDAVLKWPNDVLVDGAKCAGILAEAVA 130

Query: 131 LKNGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGC-IDLKDI-FSLL--FQDVAR 182
             +   ++V+GIGLNV       P     P TSL   G    D  D+  +LL  F D+ R
Sbjct: 131 GDD--PSIVLGIGLNVLPLGDVQPGPGGLPATSLAERGATNTDRTDVAIALLTGFDDLER 188

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGC 241
              L   D     ++  +R     +G  + ++L  G S+ GR   +D  G L ++   G 
Sbjct: 189 RWRLAGGDLTEAGLLGDYRAHCATLGQDVEVQLPDGTSLTGRAADIDAAGQLQVDVAGGQ 248

Query: 242 VRQIFTGDIF 251
              +F GD+ 
Sbjct: 249 RHTVFAGDVV 258


>gi|226356961|ref|YP_002786701.1| bifunctional biotin operon repressor/biotin--acetyl-CoA-carboxylase
           ligase [Deinococcus deserti VCD115]
 gi|226318951|gb|ACO46947.1| putative bifunctional protein BirA: biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Deinococcus deserti VCD115]
          Length = 321

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 104/238 (43%), Gaps = 20/238 (8%)

Query: 17  EFFDTISSTNDEC---MKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
            +  T +ST D+     +   S       +VA  QTAGRGRR   W + +  L  S+LL 
Sbjct: 86  RYTGTTTSTQDDLRLWAEHPTSPAPHGAVVVAERQTAGRGRRGRAWDTPQDTLVFSVLLC 145

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ-RKIAGILIETLNLK 132
             ++   L L+  A  VA+     +         +KWPND+L    RK+AGIL+E     
Sbjct: 146 APLTLPDLALMPLAAGVAVHEACRTG-------GLKWPNDLLTLDGRKLAGILLEADLRG 198

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
              +  V+GIG+NV   P    +    L      +   ++   L       L+ W     
Sbjct: 199 EEARRAVLGIGVNVGSAPPGAAH----LHETQPGLTRAELLGRLLG----ALEHWLVQPA 250

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            E++++ WR  +  +G  + +    G++ G  + +D  G L +++  G V  I  GD+
Sbjct: 251 -EDVLSAWRAASLTLGQAVHVNTPRGTVQGTAIDLDTHGNLQVQDPDGQVHTISAGDV 307


>gi|83648870|ref|YP_437305.1| biotin-(acetyl-CoA carboxylase) ligase [Hahella chejuensis KCTC
           2396]
 gi|83636913|gb|ABC32880.1| Biotin-(acetyl-CoA carboxylase) ligase [Hahella chejuensis KCTC
           2396]
          Length = 295

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 117/248 (47%), Gaps = 23/248 (9%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISD-KGNLYASLLLI 73
           +    ++ STN E ++ +    +G   I+ A  QTAGRGRR   W+S    N+Y S+ + 
Sbjct: 52  FNVLKSVGSTNAELLESSKDLPVGLYDILLAERQTAGRGRRGRVWVSPFAQNIYMSVAVR 111

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            S     L  LS AI  A+   I +    G  V +KWPND+   ++K+AG+L+E    + 
Sbjct: 112 LSGGFSVLNGLSLAIGAAVADAIKTV--CGIQVSLKWPNDVWYSEKKLAGLLLEVQGEQE 169

Query: 134 GLQAVVVGIGLNV-----KHCPVDTPYPVTS------LQREGGCIDLKDIFSLLFQDVAR 182
           G   V++G+G+NV         +D P+   S      + R+  C+ L D        V  
Sbjct: 170 GPVHVIIGLGVNVLMEREAGQAIDQPWTALSESCDVRVDRDQLCVALAD-------SVLA 222

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
            L+ +K + G   +  LW  +    G  + +        G ++GV D GY L+  + GC+
Sbjct: 223 CLESYKAE-GFAGLRELWDEYDLLKGRNVMVMSGDKCWSGEYLGVSDEGYALVRGEDGCL 281

Query: 243 RQIFTGDI 250
           R +  G+I
Sbjct: 282 RSLAGGEI 289


>gi|16554497|ref|NP_444221.1| biotin operon repressor and biotin-(acetyl-CoA carboxylase) ligase
           [Halobacterium sp. NRC-1]
          Length = 319

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 120/245 (48%), Gaps = 20/245 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E  D++ STND   +RA  G    + ++A+ QT+GRGRRD  W S  G ++ASL+L 
Sbjct: 79  FTIEHHDSLPSTNDRARERAADGARDTV-VLATRQTSGRGRRDRSWESPAGGVWASLVLG 137

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF-------QRKIAGILI 126
             +    + LL+FA AVA+          G D  IKWPND++V         RK+AGIL 
Sbjct: 138 PDLPPARVPLLTFAAAVAVTDAARE---AGVDAAIKWPNDVVVPGEPAARGNRKLAGILT 194

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E     + +  VVVG+G+NV   P       TS++   G  D + +F      V RVL+ 
Sbjct: 195 EMEGEASRVSWVVVGLGVNVNVDPAALAPGATSVRALAGETDRR-VF------VQRVLER 247

Query: 187 WKKDTGREE-IMNLWRCFACGIGDLITI-KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +    GR E  +  WR  A  +G+ + I +    +I GR V V   G L++         
Sbjct: 248 FDALRGRPEAALAAWRERAATLGEHVRITQDDDNTITGRAVDVTAHGALVVATGGESTTV 307

Query: 245 IFTGD 249
           +  GD
Sbjct: 308 VHAGD 312


>gi|260909428|ref|ZP_05916135.1| biotin-acetyl-CoA-carboxylase ligase [Prevotella sp. oral taxon 472
           str. F0295]
 gi|260636444|gb|EEX54427.1| biotin-acetyl-CoA-carboxylase ligase [Prevotella sp. oral taxon 472
           str. F0295]
          Length = 251

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 114/239 (47%), Gaps = 21/239 (8%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLI 73
           R+   +  +STND     A   D   + + A  QTAGRG+  N+W S++  NL  SL+  
Sbjct: 4   RHIHLEETASTNDYIKGVAFEAD-EMVVVSADWQTAGRGQGVNRWESERCQNLLFSLMAR 62

Query: 74  DS-ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
            S ++      LS A A+A++ V+    P   D++IKWPNDI    RKI+G LIET   +
Sbjct: 63  PSFVAVQQQFTLSMAGALAIKGVLDHITP---DIRIKWPNDIYWRDRKISGTLIETSIAR 119

Query: 133 NGLQAVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
             +   V G+GLNV       D P P++  Q  G  + L  +   + +     L L   +
Sbjct: 120 GEISRFVYGVGLNVNQTQFVSDAPNPISLAQITGKQVALMPLLDSIVEGFLAQLSLL--E 177

Query: 191 TGREEIMN------LWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            G+ +++       L+R  A G         S G+     VGVD  G + L ++KG +R
Sbjct: 178 AGKSQLITAHYNAALYR--ATGFH---RYHDSMGAFEAELVGVDTNGIITLRDRKGQLR 231


>gi|169236255|ref|YP_001689455.1| biotin--[acetyl-CoA-carboxylase] ligase 1 [Halobacterium salinarum
           R1]
 gi|167727321|emb|CAP14107.1| biotin--[acetyl-CoA-carboxylase] ligase 1 [Halobacterium salinarum
           R1]
          Length = 315

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 120/245 (48%), Gaps = 20/245 (8%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E  D++ STND   +RA  G    + ++A+ QT+GRGRRD  W S  G ++ASL+L 
Sbjct: 75  FTIEHHDSLPSTNDRARERAADGARDTV-VLATRQTSGRGRRDRSWESPAGGVWASLVLG 133

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF-------QRKIAGILI 126
             +    + LL+FA AVA+          G D  IKWPND++V         RK+AGIL 
Sbjct: 134 PDLPPARVPLLTFAAAVAVTDAARE---AGVDAAIKWPNDVVVPGEPAARGNRKLAGILT 190

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
           E     + +  VVVG+G+NV   P       TS++   G  D + +F      V RVL+ 
Sbjct: 191 EMEGEASRVSWVVVGLGVNVNVDPAALAPGATSVRALAGETDRR-VF------VQRVLER 243

Query: 187 WKKDTGREE-IMNLWRCFACGIGDLITI-KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +    GR E  +  WR  A  +G+ + I +    +I GR V V   G L++         
Sbjct: 244 FDALRGRPEAALAAWRERAATLGEHVRITQDDDNTITGRAVDVTAHGALVVATGGESTTV 303

Query: 245 IFTGD 249
           +  GD
Sbjct: 304 VHAGD 308


>gi|256750642|ref|ZP_05491528.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750482|gb|EEU63500.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 326

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 118/233 (50%), Gaps = 8/233 (3%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           I STN+   + A     G + I+A  Q AGRGR    WIS KG  ++ S++L  +I    
Sbjct: 89  IDSTNNFAKEMASKVPDGTV-IIAEEQIAGRGRLGRSWISQKGCGIWMSIILKPNIQPQE 147

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L+   A+++   I     V  + KIKWPNDI++  +K+ GIL E  +  + +  V++
Sbjct: 148 ALNLTQVAAISVVKAIEEVFHV--ESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVII 205

Query: 141 GIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
           GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I 
Sbjct: 206 GIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQK-GFEYIR 264

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 265 PICIEKSITIGRQIKVIANEGEIEGKAVNIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|147920738|ref|YP_685458.1| putative pyruvate carboxylase, subunit A [uncultured methanogenic
           archaeon RC-I]
 gi|56295631|emb|CAH04872.1| pyruvate carboxylase subunit a [uncultured archaeon]
 gi|110620854|emb|CAJ36132.1| putative pyruvate carboxylase, subunit A [uncultured methanogenic
           archaeon RC-I]
          Length = 722

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 116/248 (46%), Gaps = 11/248 (4%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAG-RGRRDNKWISDKGNLYASL 70
           +  +  +F+ ++STN    + A +G      I+A  Q+ G +GR   +WIS  G +  SL
Sbjct: 465 FGHKIHYFEEVASTNRIAKEMAATGAEEGTMILAETQSGGIKGRIGREWISPFGGVSFSL 524

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
           +L    +  + + ++ A A A+   I      G D +I WPND+L+  RK+ GIL +   
Sbjct: 525 VLRPKAAPRNASKITLAAASAVCKTIREMY--GLDARISWPNDVLIGGRKVCGILTDIAM 582

Query: 131 LKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLD 185
             N ++ +V+G G+NV       P       TS++ E G  +  KD    L ++     +
Sbjct: 583 DVNSIKYIVLGFGVNVNVEMLSFPTKIQKSATSIKEELGKTVSRKDFIDALLREFEIQYE 642

Query: 186 LWKKDTGR-EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +  + GR EEI+  ++     +G  + +K       G  V + + G  +++ K G +  
Sbjct: 643 HF--NEGRYEEILTGYKSLIYPLGSRVIVKDQDNLYEGISVDITEDGAFVMKAKDGSLMT 700

Query: 245 IFTGDIFT 252
             TGD+  
Sbjct: 701 FMTGDVHA 708


>gi|150399869|ref|YP_001323636.1| biotin--acetyl-CoA-carboxylase ligase [Methanococcus vannielii SB]
 gi|150012572|gb|ABR55024.1| biotin--acetyl-CoA-carboxylase ligase [Methanococcus vannielii SB]
          Length = 231

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 119/235 (50%), Gaps = 28/235 (11%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLG-----NLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           F Y + + I STN        + DLG     NL IV+  QT+G+GR D  WIS +G LY 
Sbjct: 3   FEYIYLEEIDSTN------KFAYDLGKQCKRNLVIVSKIQTSGKGRMDRTWISKEGGLYF 56

Query: 69  SLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV--GTDVKIKWPNDILVFQRKIAGILI 126
           S+L+ D    + +  ++F  +V+    +  TL      + +IKWPNDIL   +KI GIL 
Sbjct: 57  SILM-DISRVNPIEKINFLASVS----VLETLKYFSNENFQIKWPNDILCNDKKICGILT 111

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV-TSLQ-REGGCIDLKDIFSLLFQDVARVL 184
           E LN+  G    V+GIGLN+ +    +   V TSL   E    D+K IF    ++    +
Sbjct: 112 E-LNVLKGY--FVLGIGLNINNKIESSIKNVGTSLYCLEKENFDIKQIFEEFIKNFK--V 166

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           +L+  +     I+  ++ ++  I   + + L   ++ GR V +D  G  LL EK+
Sbjct: 167 NLYMDNNA---ILEKYKTYSKTINSNVNLILPNKTVFGRVVEIDFNGIYLLNEKE 218


>gi|20808369|ref|NP_623540.1| biotin-(acetyl-CoA carboxylase) ligase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516980|gb|AAM25144.1| Biotin-(acetyl-CoA carboxylase) ligase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 326

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 120/242 (49%), Gaps = 14/242 (5%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
           Y   +++SSTND   + A     G + IVA  QT GRGR    W S+K + +  S++L  
Sbjct: 83  YIHKESLSSTNDMAKELAYKVPDGTV-IVAEEQTKGRGRMGRSWFSEKSSCILTSVILKP 141

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I  +    L+   A+ +   I     V T  KIKWPNDI++  +K+ GIL E  +  + 
Sbjct: 142 QIRPEKTVALTQVAALTVVKAIEEVCSVKT--KIKWPNDIILNSKKVCGILTEMSSEIDV 199

Query: 135 LQAVVVGIGLNVK--HCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKK-- 189
           +  +V+GIG+NV     P D     TSLQ E    +D K + + L  +    L+++ K  
Sbjct: 200 VNYIVIGIGINVNCTEFPDDLKEKATSLQLELEKPVDRKKLLASLLNN----LEIYYKEY 255

Query: 190 -DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            + G E +  L    +  IG  + +  +   I G+ + +D  G L+++ +KG    + +G
Sbjct: 256 EEKGFESLRPLILENSITIGKEVRVIYTDREIRGQAIAIDKEGKLVIKTEKGEEIALLSG 315

Query: 249 DI 250
           ++
Sbjct: 316 EV 317


>gi|331005750|ref|ZP_08329110.1| Biotin-protein ligase [gamma proteobacterium IMCC1989]
 gi|330420439|gb|EGG94745.1| Biotin-protein ligase [gamma proteobacterium IMCC1989]
          Length = 325

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 113/240 (47%), Gaps = 14/240 (5%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           +    I STN   MKR  +G+      ++  Q++G+GRR   W+S  G N+Y S +    
Sbjct: 86  DLHAEIESTNVNAMKRIAAGNAKGYLCLSESQSSGKGRRGRHWVSPFGHNIYLSFVWEFD 145

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
              + L  LS A+ V +  V+ +    G  V +KWPNDIL+  RK+ GIL+E      G+
Sbjct: 146 GGANQLEGLSLAVGVEVAKVLIACGLQG--VALKWPNDILLNGRKLGGILLEMSGDPAGV 203

Query: 136 QAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             VV+GIGLNV   K+  +D P+   S Q     +    + S +   +  +L+ +    G
Sbjct: 204 CQVVIGIGLNVRMNKNMAIDQPWASVSEQL--ASVSRNKLVSGVLNRLVPMLNTY-GSLG 260

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG--YLLLEEKKGCVRQIFTGDI 250
                 LW       G  +TI     SI G   GV   G   LL+ E++   R I+ G++
Sbjct: 261 FSSYQALWESLDVYRGKKVTILSGNTSIKGVACGVYANGSLRLLVNEEE---RPIYGGEV 317


>gi|229816397|ref|ZP_04446702.1| hypothetical protein COLINT_03451 [Collinsella intestinalis DSM
           13280]
 gi|229808046|gb|EEP43843.1| hypothetical protein COLINT_03451 [Collinsella intestinalis DSM
           13280]
          Length = 291

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 88/183 (48%), Gaps = 15/183 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           E  D I STN E  +R   G      + A  QTAGRG+R + W S  G LY S+LL   +
Sbjct: 9   EVVDEIGSTNAEMKRRGREGAPHGAALRARVQTAGRGQRTHMWASPAGGLYLSVLLRPDV 68

Query: 77  SKDSLTLLSFAIAV-AMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           S  +L  L  A A+ AM ++  +  P     ++KWPNDI+V  RK+AG+L E      G 
Sbjct: 69  SATALPALPVACAMGAMGALREAGCP---GARLKWPNDIVVGGRKLAGVLTELAMSDEGA 125

Query: 136 QAVVVGIGLNVK--HCPVD----TPYPVTSLQRE----GGCIDLKDIFSLLFQDVARVLD 185
            A V GIG+N++    P       P P T L+        C DL  +   +   + + ++
Sbjct: 126 FA-VCGIGVNIETPELPASDGALAPLPATGLRDALVPGASCPDLDVLADAIRDGILKFVE 184

Query: 186 LWK 188
            W 
Sbjct: 185 GWS 187


>gi|220927593|ref|YP_002504502.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulolyticum
           H10]
 gi|219997921|gb|ACL74522.1| biotin/acetyl-CoA-carboxylase ligase [Clostridium cellulolyticum
           H10]
          Length = 326

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 116/242 (47%), Gaps = 15/242 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +F+ I STN    K A  G      +++  QT GRGR   +W SD    ++ S+++   +
Sbjct: 82  YFEEIDSTNSYAKKIANEGCAHGTVVISEVQTMGRGRVGRQWQSDTAEGIWFSIVVRPDL 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             +++ +++ A +VA+   I  T   G    IKWPNDI++  RK+ GIL E       + 
Sbjct: 142 EPENIQVITLAASVAVVEAIKET--CGIICGIKWPNDIILNGRKLGGILTELSAEPGHVN 199

Query: 137 AVVVGIGLN----VKHCPVDTPYPVTSLQREGGCIDLKDI--FSLLFQDVARVLDLWKKD 190
            VVVGIGLN    ++H   +      SL+   G    K I   +LL   + R   ++K  
Sbjct: 200 YVVVGIGLNANQDLEHFDYEIRQKAISLKMYAG----KSISRANLLGSILTRFEKIYKSI 255

Query: 191 TGRE--EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              E  +I++ W  ++  IG  + +        G+ + V   G L++E K G  R+I  G
Sbjct: 256 LLGENRDIIDKWTAYSVTIGKEVKVAYKDMEYFGKALSVASDGRLIVECKDGVTREISAG 315

Query: 249 DI 250
           +I
Sbjct: 316 EI 317


>gi|291287151|ref|YP_003503967.1| biotin/acetyl-CoA-carboxylase ligase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884311|gb|ADD68011.1| biotin/acetyl-CoA-carboxylase ligase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 251

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 112/237 (47%), Gaps = 14/237 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           + + I STN   ++  L        +VA  QT+GRGR    W SD   NLY S+++    
Sbjct: 19  YLEEIDSTNAYAVRTDLEP---FTCVVADVQTSGRGRSGRVWHSDTDTNLYFSVVIG--- 72

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             DS  LL   I      +++ TL    D K+KWPNDI+V  +K+AGIL+ET      L+
Sbjct: 73  GLDSSMLLPLNIFAGY--ILSDTLKHLVDAKVKWPNDIIVNGKKLAGILMETSFSGGVLE 130

Query: 137 AVVVGIGLNVKH--CPVDTPYPVTSLQREGGCIDLKD-IFSLLFQDVARVLDLWKKDTGR 193
             V+GIGLNV     P D     TSL  E G    ++ I +          DL++ +  R
Sbjct: 131 KAVLGIGLNVNREVFPDDIKDIATSLYIETGEKHSREQILASFMTSFENSFDLFRSN--R 188

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +I+ LW  ++  +   ITI            G+D  G L   +  G ++ I TGDI
Sbjct: 189 IDIVKLWSSYSAYLDKKITIHKDGVKTGYTEKGIDATGCLQAIDSTGSLKTIITGDI 245


>gi|91781620|ref|YP_556826.1| biotin--protein ligase [Burkholderia xenovorans LB400]
 gi|91685574|gb|ABE28774.1| Biotin--acetyl-CoA-carboxylase ligase [Burkholderia xenovorans
           LB400]
          Length = 305

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 118/265 (44%), Gaps = 30/265 (11%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMARVKALPRKAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP----------VDTPYPV-----TSLQREGGCI 167
           GILIET        AVV+GIG NVK               TP        T+LQR     
Sbjct: 155 GILIETAWSTENASAVVIGIGTNVKGAAELAAKVDALNAGTPPQARGTMPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVG 226
           +L D  +     +   L  +  + G       W       G +++ ++     + G   G
Sbjct: 215 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAVHAYAGREVVLLEQGEEQMRGVAAG 273

Query: 227 VDDFGYLLLEEKKGCVRQ-IFTGDI 250
           VD+ G LLL+   G  RQ + TGD+
Sbjct: 274 VDEQGQLLLDTASG--RQTVATGDV 296


>gi|186680606|ref|YP_001863802.1| biotin--acetyl-CoA-carboxylase ligase [Nostoc punctiforme PCC
           73102]
 gi|186463058|gb|ACC78859.1| biotin--acetyl-CoA-carboxylase ligase [Nostoc punctiforme PCC
           73102]
          Length = 272

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 116/244 (47%), Gaps = 15/244 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F   FF+++SSTN         G +    ++A+ Q+AGRG+   +WIS  G LY S+ + 
Sbjct: 23  FSPHFFESVSSTNQTLWNLLHQGAISGTVVIATQQSAGRGQWGREWISPIGGLYVSVAI- 81

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTL-PVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
            S  +      S+ +  A    IAS L   G DV IKWPND+++  RK+ GIL ET   K
Sbjct: 82  -SFDRKIEATDSYQLTFATAWGIASQLRQCGIDVGIKWPNDLVLNSRKLGGILTETKVNK 140

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK---- 188
             +   V+G+G+N  +   DT   + S Q      D + I SL       +L +      
Sbjct: 141 GQITQAVIGVGINWTNPVPDTGINLESWQ---ASQDFRPISSLEILTSKVLLGIESGMEC 197

Query: 189 -KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
            +  G   +++ +      +GD + +     ++LG  VGV   G L ++ +    +++ T
Sbjct: 198 LQQEGVSILLSRYLDLLTNMGDRVYVN----NLLGTVVGVTPQGNLRVDLETHDTKELIT 253

Query: 248 GDIF 251
            +I+
Sbjct: 254 PEIY 257


>gi|109900297|ref|YP_663552.1| biotin--acetyl-CoA-carboxylase ligase [Pseudoalteromonas atlantica
           T6c]
 gi|109702578|gb|ABG42498.1| biotin--acetyl-CoA-carboxylase ligase [Pseudoalteromonas atlantica
           T6c]
          Length = 328

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 119/248 (47%), Gaps = 14/248 (5%)

Query: 7   ECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-N 65
            C++    +    + + STN    +R  S   G++  +A  QTAGRGRR   W+S  G +
Sbjct: 81  HCEHFVPTQLTLLNVVDSTNQYLKERIGSLHNGDV-CLAEAQTAGRGRRGRTWVSPYGAS 139

Query: 66  LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           LY S     +    S+  LS A+ VA+   + +      DV++KWPNDI    +K+AG+L
Sbjct: 140 LYLSQFWQFAGGYQSIGGLSLAVGVAITQALETAGY--QDVQLKWPNDIYAQGKKLAGVL 197

Query: 126 IETLNLKNGLQAVVVGIGLNVK----HCPVDTPY-PVTSLQREGGCIDLKDIFSLLFQDV 180
           IE           ++G+GLN+        +D P+  + +L  +G   D   + +LL  ++
Sbjct: 198 IEVEGQMGSACDCIIGVGLNMALDMGSERIDQPWIDLATLNPDG--FDRNRVSALLLDEL 255

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
            R  DL+ +  G E  +  WR         + + +   ++ G   G+D  G LLLE++ G
Sbjct: 256 TRCADLFSQ-AGLEPFLEKWRNRNVYQDKPVYLIIGNKTVHGICKGIDKTGALLLEQEDG 314

Query: 241 CVRQIFTG 248
              Q ++G
Sbjct: 315 I--QAYSG 320


>gi|319651318|ref|ZP_08005448.1| biotin synthetase [Bacillus sp. 2_A_57_CT2]
 gi|317397098|gb|EFV77806.1| biotin synthetase [Bacillus sp. 2_A_57_CT2]
          Length = 327

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 120/239 (50%), Gaps = 13/239 (5%)

Query: 20  DTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSISK 78
           +++ ST     + A  G      I+A  Q +GRGR D +W S K   ++ S++L  +I  
Sbjct: 90  ESVDSTQKIAHRLAYEGAQEGTVIIAEEQLSGRGRMDRRWHSPKSTGVWMSVILRPNIPP 149

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                L+   AVA+   I       TD+  +IKWPNDIL+  +K+ GIL E     + + 
Sbjct: 150 PKAPQLTLITAVAVVQAIEEL----TDLTPQIKWPNDILMNGKKVTGILTELQADADRII 205

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
           ++++GIG+NV     D P  +    TS+  E G  +   ++  +L   +  +  L+  D 
Sbjct: 206 SIIIGIGINVNQELDDYPDELKDIATSISIEKGEKLSRAELIRVLLAKLENLYKLYL-DK 264

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           G   I  LW  +A  IG  +T +   GSI G+ +G+ + G L++E+  G V  +++ DI
Sbjct: 265 GFYPIKLLWESYAVSIGKNLTARTITGSIYGKALGITEDGVLMIEDSSGKVHHVYSADI 323


>gi|261406082|ref|YP_003242323.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. Y412MC10]
 gi|261282545|gb|ACX64516.1| biotin/acetyl-CoA-carboxylase ligase [Paenibacillus sp. Y412MC10]
          Length = 329

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 116/241 (48%), Gaps = 9/241 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           +  D  +ST ++  + A  G      +++  QT GRGR   K+ S +G  ++ SL+L   
Sbjct: 88  KLLDKTTSTQEDARQLAEEGAAEGTLVISEEQTGGRGRMGRKFHSPRGKGIWMSLVLRPK 147

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
                   L+    VA+   IA +  V TD  IKWPNDIL   +K+ GIL+E+      +
Sbjct: 148 QPLHLTQQLTLLTGVAVCRAIAKSAGVQTD--IKWPNDILYQGKKVCGILLESATEDERV 205

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKD 190
           +  + GIG++      D P  +    TS++  GG  ++   +   +  ++  + +L+  +
Sbjct: 206 RYCIAGIGISANLKEADFPEELRNVATSIRIAGGKTVNRTSLIQSIMSEMEVLYELY-NE 264

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G E + +LW   +  +G  + ++ +     G   G++  G LL+  + G +  +++GDI
Sbjct: 265 QGFEPVASLWEALSGTVGREVQVQTARDRFSGIATGLNQDGALLVRNQHGELVPVYSGDI 324

Query: 251 F 251
            
Sbjct: 325 L 325


>gi|126179592|ref|YP_001047557.1| biotin--acetyl-CoA-carboxylase ligase [Methanoculleus marisnigri
           JR1]
 gi|125862386|gb|ABN57575.1| biotin--acetyl-CoA-carboxylase ligase [Methanoculleus marisnigri
           JR1]
          Length = 326

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 116/242 (47%), Gaps = 13/242 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLW---IVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           FD+ +ST     K A   D  NL    I+A  QT G GR    W+S  G ++A++LL   
Sbjct: 87  FDSTASTGWVAKKLAAETDPENLHGMVIIAEEQTGGVGRLGRAWVSPAGGIWATILLKPK 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           I  D L +++ A +VA+   I     +     IKWPNDI +  +K+AG+L+E     + +
Sbjct: 147 IPLDHLFMITMAGSVAIARAIRKEYDISA--LIKWPNDIFIGDKKVAGLLLELAAEADTV 204

Query: 136 QAVVVGIGLNVKHCPVDTP----YPVTSLQRE-GGCIDLKDIFSLLFQDVA-RVLDLWKK 189
              ++G+G++      D        VT+LQ E G  +D   + + + ++   R   L  +
Sbjct: 205 HYALLGLGIDANVSLDDLSSNLRETVTTLQAEVGREVDRVALLARVLREFELRYQQL--E 262

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           D   + I+  W+  +  +   + IK    +  G  + +D+ G L++ +  G + ++  GD
Sbjct: 263 DGEYDSIIREWKSLSRTLDHRVAIKTVNKTFSGEAIDIDEHGALIIRKDNGKIERVIAGD 322

Query: 250 IF 251
            F
Sbjct: 323 CF 324


>gi|260439204|ref|ZP_05793020.1| biotin-[acetyl-CoA-carboxylase] ligase [Butyrivibrio crossotus DSM
           2876]
 gi|292808219|gb|EFF67424.1| biotin-[acetyl-CoA-carboxylase] ligase [Butyrivibrio crossotus DSM
           2876]
          Length = 326

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 110/237 (46%), Gaps = 6/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSI 76
           +FD I STN E  ++A    +  +  +A  QT GRGR++  W S  K  ++ S  +   +
Sbjct: 83  YFDVIDSTNSEIKRQAEKEFIPGMLAIAEKQTLGRGRKERHWESPAKTGIWMSFAVKPDL 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                ++++   A+A+   I      G + +IKWPNDI++  RK+ GIL E       + 
Sbjct: 143 PPYKASMITLVTALAVAKAIKDV--TGLNTEIKWPNDIVIGSRKVVGILTEMSAEMTTIN 200

Query: 137 AVVVGIGLNV--KHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV+GIG+NV  +  P +     TSL   GG  +    I +   +   +  +++ KD   
Sbjct: 201 YVVIGIGINVNMESFPAELEDKATSLYIAGGTKVRRSSIVAKFGKYFEKYYEIFCKDGNL 260

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             I + +          + I      I    +G+D  G LL+++  G + +I  G++
Sbjct: 261 SGIKDEYEKLLVNRNKEVYIIEGDSRIKRVAIGIDTDGELLVKDDNGNIEKIMAGEV 317


>gi|167036997|ref|YP_001664575.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115415|ref|YP_004185574.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855831|gb|ABY94239.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928506|gb|ADV79191.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 326

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 118/233 (50%), Gaps = 8/233 (3%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           I STN+   + A     G + I+A  Q AGRGR    WIS KG  ++ S++L  +I    
Sbjct: 89  IDSTNNFAKEMASKVPDGTV-IIAEEQIAGRGRLGRSWISQKGCGIWMSIILKPNIQPQE 147

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L+   A+++   I     V  + KIKWPNDI++  +K+ GIL E  +  + +  V++
Sbjct: 148 ALNLTQVAAISVVKAIEEVFHV--ESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVII 205

Query: 141 GIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
           GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I 
Sbjct: 206 GIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQK-GFEYIR 264

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 265 PICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|325270695|ref|ZP_08137291.1| biotin-acetyl-CoA-carboxylase ligase [Prevotella multiformis DSM
           16608]
 gi|324986990|gb|EGC18977.1| biotin-acetyl-CoA-carboxylase ligase [Prevotella multiformis DSM
           16608]
          Length = 263

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 112/232 (48%), Gaps = 13/232 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            +T+ STN        + D      VA  QTAGRG+ +N W S+ G   L++ L+    +
Sbjct: 27  LETVDSTNSFLRNYTPAADEPMTVAVAGYQTAGRGQGENTWESEAGKNLLFSVLVHPVML 86

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S  LLS A A+A++  +A  +  G  +++KWPND+    RK++G LIET      ++
Sbjct: 87  PVRSQFLLSEAGALALKEALADYVKDG--IRLKWPNDVYWKDRKLSGTLIETKLGGGHIK 144

Query: 137 AVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLL---FQDVARVLDLWKKDT 191
             + G+GLNV       D P PV+  Q  G  +D  ++   +   F D   +L++     
Sbjct: 145 DCIFGVGLNVNQTVFRGDAPNPVSLCQILGHEVDKDELLDKIIRKFSDFYHLLEM----G 200

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           G  +I  ++       G     + + G   G  V V+D G+L+L ++ G +R
Sbjct: 201 GYNDISAMYHEALYRRGGFHRFRDADGEFDGAIVEVEDDGHLILRDRDGRIR 252


>gi|114561320|ref|YP_748833.1| biotin--protein ligase [Shewanella frigidimarina NCIMB 400]
 gi|114332613|gb|ABI69995.1| biotin--acetyl-CoA-carboxylase ligase [Shewanella frigidimarina
           NCIMB 400]
          Length = 320

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 125/252 (49%), Gaps = 24/252 (9%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
           N S   N    R  +FD  +STN   +  A     G++  +A  Q+AGRGRR  +W+S  
Sbjct: 69  NESHLVNGIDGRCFYFDETTSTNAFMLGHASELKSGDI-CIAEYQSAGRGRRGRQWLSPY 127

Query: 64  GN-LYASLL--LIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQR 119
            + +YAS+   L + IS  S   LS  +     S++ S    G + + +KWPNDI +  +
Sbjct: 128 AHHIYASMFWRLNNDISHASG--LSLVVGC---SIVKSLADFGVEGLGLKWPNDIYLDHK 182

Query: 120 KIAGILIETLNLKNGLQAVVVGIGLNVKHCP-----VDTPYPVTSLQREGGCIDLKDIFS 174
           K+AGIL+E  N       +V+G G+N+         +D P+   S     G +++ D   
Sbjct: 183 KLAGILVEVSNSSAQKTELVIGFGINMSMSVEQGELIDQPWNDLS-----GLVNMPDKTE 237

Query: 175 L---LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
           L   L + +   L L+++  G E  ++ W  F   IG  +++ ++  S+ G   G+D+ G
Sbjct: 238 LLIKLHKTLKADLQLFEQ-KGLEAFLDRWNKFDLFIGREVSLLMAPNSVNGICRGIDEQG 296

Query: 232 YLLLEEKKGCVR 243
            LLLE ++G  R
Sbjct: 297 ALLLENEQGVTR 308


>gi|121535058|ref|ZP_01666875.1| biotin--acetyl-CoA-carboxylase ligase [Thermosinus carboxydivorans
           Nor1]
 gi|121306308|gb|EAX47233.1| biotin--acetyl-CoA-carboxylase ligase [Thermosinus carboxydivorans
           Nor1]
          Length = 269

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 112/241 (46%), Gaps = 14/241 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +F  I STN+E  + A  G    L +VA  Q+ GRGR    W S  G  ++ S++L    
Sbjct: 29  YFSEIGSTNNEAKRLAAEGCPEGLIVVAEAQSTGRGRLARGWFSPFGKGIWLSVVLRPPF 88

Query: 77  SKDSLTLLSFAIAVAMRSVI--ASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                   +   AVA+   I   +  P G    IKWPNDIL   +K+ GIL E     + 
Sbjct: 89  HPLDAPKCTLMAAVALTKAIRKVTEAPCG----IKWPNDILYEGKKLVGILTEMSAEMDA 144

Query: 135 LQAVVVGIGLNVKHCPVDTPYPV----TSLQREGG-CIDLKDIFSLLFQDVARVLDLWKK 189
           +  VV+G+G+NV   P + P  +    TS+    G  +    + + +  ++  V  L  +
Sbjct: 145 INYVVIGMGINVNIAPEEFPPELRDIATSVAAAAGRPVSRLALLAEVLAELETVYSLAVR 204

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G   +++ WR     +G  + +     +  G  V +D+ G LL++  +G VR+I  GD
Sbjct: 205 Q-GFGPVLDEWRKLTITLGQQVNVLAPGETFAGIAVNIDNEGALLVDTGQG-VRRILAGD 262

Query: 250 I 250
           +
Sbjct: 263 V 263


>gi|296160360|ref|ZP_06843177.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. Ch1-1]
 gi|295889341|gb|EFG69142.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. Ch1-1]
          Length = 305

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 118/265 (44%), Gaps = 30/265 (11%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMARVKALPRKAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP----------VDTPYPV-----TSLQREGGCI 167
           GILIET        AVV+GIG NVK               TP        T+LQR     
Sbjct: 155 GILIETAWSTENASAVVIGIGTNVKGADELAAKVGALNAATPPQARGTMPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVG 226
           +L D  +     +   L  +  + G       W       G +++ ++     + G   G
Sbjct: 215 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAVHAYAGREVVLLEQGEEQMRGVAAG 273

Query: 227 VDDFGYLLLEEKKGCVRQ-IFTGDI 250
           VD+ G LLL+   G  RQ + TGD+
Sbjct: 274 VDEQGQLLLDTPSG--RQTVATGDV 296


>gi|170691591|ref|ZP_02882756.1| biotin--acetyl-CoA-carboxylase ligase [Burkholderia graminis C4D1M]
 gi|170143796|gb|EDT11959.1| biotin--acetyl-CoA-carboxylase ligase [Burkholderia graminis C4D1M]
          Length = 305

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 118/266 (44%), Gaps = 32/266 (12%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMSRVKALPRKAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP----------VDTPYPV-----TSLQREGGCI 167
           GILIET        AVV+GIG NVK              D P        T+LQR     
Sbjct: 155 GILIETAWSTEHASAVVIGIGTNVKGADELAAKIGALNADAPPQARGTAPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV-- 225
           +L D  +     +   L  +  + G       W       G  + + L  G  + R V  
Sbjct: 215 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAVHAYAGREVVL-LEQGQEVTRGVAA 272

Query: 226 GVDDFGYLLLEEKKGCVRQ-IFTGDI 250
           GVD+ G LLL+   G  RQ I TGD+
Sbjct: 273 GVDERGQLLLDTAAG--RQSIATGDV 296


>gi|293392143|ref|ZP_06636477.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952677|gb|EFE02796.1| biotin--protein ligase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 310

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 122/253 (48%), Gaps = 20/253 (7%)

Query: 3   SNLSECQNPYSFRYEFFDTISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
           + L++   PY    +    ISSTN    + +++   GDL     +A  QT GRGRR  +W
Sbjct: 63  ARLTQALAPYGVTLK--PVISSTNQYLLDHLEQLQKGDL----CLAEYQTTGRGRRGRQW 116

Query: 60  ISD-KGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ 118
           IS   G +  S     + +K SL  LS  I +A    +A     G   ++KWPNDILV  
Sbjct: 117 ISPFAGQIIMSFYWQLNPTK-SLDGLSSVIGLATVQALAELDMYG--FQVKWPNDILVND 173

Query: 119 RKIAGILIETLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSL 175
           RK+AGIL+E +N KNG+  ++VGIG+N+   ++  +D P+    L      +D + I   
Sbjct: 174 RKLAGILVEIVNRKNGMLNLIVGIGMNISLGQNKKIDQPW--AELSEFFPQVDREQIIIK 231

Query: 176 LFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
           + + +   L+ +++     E+   W       G  + +     +I G   G+D  G+L +
Sbjct: 232 MTKTIYCYLERFEQHGIDAELQQQWLNHDAYFGAEVNVITEKSAISGIEQGIDAAGHLCV 291

Query: 236 EEKKGCVRQIFTG 248
             + G  RQ F  
Sbjct: 292 ITENG--RQYFNA 302


>gi|218886102|ref|YP_002435423.1| biotin/acetyl-CoA-carboxylase ligase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757056|gb|ACL07955.1| biotin/acetyl-CoA-carboxylase ligase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 332

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 109/243 (44%), Gaps = 11/243 (4%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
           +   ++  STN E    AL G      + AS QTAGRGR    W S  G  +Y SL+L  
Sbjct: 90  FVLHESTESTNREAALLALGGAPEGTVVAASAQTAGRGRAGRVWASPAGVGVYVSLVLRP 149

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            ++  +  L++   AVA+   +A     G   + KWPND+L+  RK++G L E   + + 
Sbjct: 150 RLAPQAAPLVTLMTAVAVAEAVAEV--TGLAPRAKWPNDVLLHGRKVSGNLTEVALVADA 207

Query: 135 LQAVVVGIGLN----VKHCPVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVAR-VLDLWK 188
           +  VV G G+N    V+  P D     TSL  E G  +   D+     +        L +
Sbjct: 208 VSHVVTGAGINVNTRVEDLPEDLRGKATSLAAELGRPVSRVDVLRAFLERAEHWYAALRE 267

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
            D G   ++  W+  +  +G  + +   +G + G    VD  G L L +  G   ++  G
Sbjct: 268 GDPG--PVIARWKELSAIVGTPLRVGTPHGVVEGLVADVDPDGLLRLVDADGSEHRLHAG 325

Query: 249 DIF 251
           D+ 
Sbjct: 326 DVI 328


>gi|307728300|ref|YP_003905524.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1003]
 gi|307582835|gb|ADN56233.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1003]
          Length = 305

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/266 (32%), Positives = 118/266 (44%), Gaps = 32/266 (12%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMARVKALPRRAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC----------PVDTPYPV-----TSLQREGGCI 167
           GILIET        AVV+GIG NVK              D P        T+LQR     
Sbjct: 155 GILIETAWSTEHASAVVIGIGTNVKGADELAAKIGALTADAPPQARGTAPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV-- 225
           +L D  +     +   L  +  + G       W       G  + + L  G  + R V  
Sbjct: 215 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAMHAYAGREVVL-LEQGEEVTRGVAA 272

Query: 226 GVDDFGYLLLEEKKGCVRQ-IFTGDI 250
           GVD+ G LLL+   G  RQ + TGD+
Sbjct: 273 GVDERGQLLLDTAAG--RQSVATGDV 296


>gi|194337809|ref|YP_002019603.1| biotin/acetyl-CoA-carboxylase ligase [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194310286|gb|ACF44986.1| biotin/acetyl-CoA-carboxylase ligase [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 328

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 105/238 (44%), Gaps = 9/238 (3%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           +    +STN E    A  G      + A CQ+ GRGR    W+S  G NLY SL+L  ++
Sbjct: 86  YHPLTTSTNIEAKALAAEGAPEGSVVAADCQSGGRGRMGRSWVSPPGVNLYFSLILRPAV 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDV--KIKWPNDILVFQRKIAGILIETLNLKNG 134
               +  L+  +A A+   +       +D+   IKWPNDIL   +K+ G+L E  +  + 
Sbjct: 146 PSVRVPQLTLLVAAAIHQALCRH---SSDLVAMIKWPNDILADGKKLCGVLCEMQSEPDC 202

Query: 135 LQAVVVGIGLNVKHC--PVDTPYPVTSLQREGGCI-DLKDIFSLLFQDVARVLDLWKKDT 191
              VVVGIG+NV     P D     TSL  E G +    ++ + +      + D W  + 
Sbjct: 203 THFVVVGIGINVNQSEFPPDLQQSATSLFLESGQLFSRPELLASVLNHFEPLYDAWLLED 262

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
               I+      A      +TI     S+ G   G+  FG L LE  +G    + +G+
Sbjct: 263 DLGFILPYLEEHALLQSKEVTIDQLKRSVRGTVRGISRFGELKLESAEGETILVSSGE 320


>gi|119502859|ref|ZP_01624944.1| Biotin--(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2080]
 gi|119461205|gb|EAW42295.1| Biotin--(acetyl-CoA-carboxylase) ligase [marine gamma
           proteobacterium HTCC2080]
          Length = 275

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 107/242 (44%), Gaps = 28/242 (11%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLL 72
            R E    I STN    +RALS D+  + + A  QTAGRGR    W+S  K N+Y SL  
Sbjct: 30  LRIEVEREIDSTNAALKRRALSEDIHGVALFAETQTAGRGRLGRVWVSPPKSNIYLSLGW 89

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
              +    L  LS A   A+   +      G  +++KWPND+ +  +K  G+LI+ +   
Sbjct: 90  RTGLEPLKLAGLSLAAGCAIGEGLERNF--GLKMQLKWPNDLYLGGKKCGGVLIDLVQSS 147

Query: 133 NGLQAVVVGIGLNVKHC-----PVDTPY---------PVTSLQREGGCIDLKDIFSLLFQ 178
           N    +VVG+GLNV         +D P+         P+T  + E G   L  +  LL  
Sbjct: 148 NQDWTIVVGVGLNVAMPNSGGNDIDQPWTDLGSHSAVPLT--RNEVGGQLLGALVPLLSS 205

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
                   W++   R ++M          G  IT++    SI GR  GVD  G L +   
Sbjct: 206 WQVGAFSQWRESWSRRDLM---------AGHQITVQQGNHSISGRADGVDQSGALRVVTN 256

Query: 239 KG 240
           +G
Sbjct: 257 EG 258


>gi|171914697|ref|ZP_02930167.1| Biotin-(acetyl-CoA carboxylase) ligase [Verrucomicrobium spinosum
           DSM 4136]
          Length = 272

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 118/243 (48%), Gaps = 18/243 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS 75
           +  +T++ST+D       +G    L ++A  QT GRGRR+N+W S  G +L  S+LL   
Sbjct: 29  QVHETLASTSDHVRDLGSAGYPHGLVVLAEEQTVGRGRRENRWSSPPGQDLLLSVLLRPE 88

Query: 76  ISKD----SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNL 131
           +  D    + T  + AI  A+ S  AS  P      IKWPND+ +  RK+AGIL ET   
Sbjct: 89  VKMDLWPRTTTFAALAICRAIESFHASLQPA-----IKWPNDVYLNDRKVAGILAETFT- 142

Query: 132 KNGLQAVVVGIGLNVKHC--PVDTPYPVTSLQREGGC---IDLKDIFSLLFQDVARVLDL 186
             G   +V+GIGLNV     P +     TS++   G    +D   I   L + +  +L  
Sbjct: 143 GGGSAYMVLGIGLNVNTTTYPPELSQQATSVRLALGSSTPLDRNTIAISLLKHLDHLLS- 201

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            + D    ++++  R  +  +G  +T  +    + G    ++  G+L+++ + G V  + 
Sbjct: 202 -RYDEHYPQVVDEVRQRSWLLGKKLTAMVDGAEVRGVAATLNSEGHLVVQREDGSVMTLT 260

Query: 247 TGD 249
           + +
Sbjct: 261 SAE 263


>gi|327312525|ref|YP_004327962.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella denticola
           F0289]
 gi|326945305|gb|AEA21190.1| biotin--[acetyl-CoA-carboxylase] ligase [Prevotella denticola
           F0289]
          Length = 263

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 111/232 (47%), Gaps = 13/232 (5%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            +T+ STN        + D      VA+ QTAGRG+  N W S+ G   L++ L+    +
Sbjct: 27  LETVDSTNSFLRTYTPAADEPMTVAVAAYQTAGRGQGANTWESEAGKNLLFSVLVHPVML 86

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S  LLS A A+A++  +A    V  D+ +KWPNDI    RK++G LIET      ++
Sbjct: 87  PVRSRFLLSEAGALALKEALADY--VKDDICLKWPNDIYWKDRKLSGTLIETKLGGGHIK 144

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLL---FQDVARVLDLWKKDT 191
             + G+GLNV       D P PV+  Q  G  +D  ++   +   F D   +L++     
Sbjct: 145 DCIFGVGLNVNQTVFHSDAPNPVSLCQILGHEVDKDELLDKIIRKFSDFYHLLEM----G 200

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           G  +I  ++       G     + + G   G  + V+D G+L+L ++ G +R
Sbjct: 201 GYNDISAMYHEALYRCGGFHRFRDADGDFDGSIIEVEDDGHLILRDRNGSIR 252


>gi|322370320|ref|ZP_08044879.1| biotin--[acetyl-CoA-carboxylase] ligase [Haladaptatus
           paucihalophilus DX253]
 gi|320550028|gb|EFW91683.1| biotin--[acetyl-CoA-carboxylase] ligase [Haladaptatus
           paucihalophilus DX253]
          Length = 342

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 116/272 (42%), Gaps = 47/272 (17%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           F  E+ D+I STND   + A  G   ++ ++A  Q  GRGR +  W+   G ++ SL+L 
Sbjct: 74  FSVEYHDSIGSTNDRARELAEEG-AEDVVVLADEQVGGRGRLERTWVGPSGGVWLSLVLR 132

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR-------------- 119
            +I      LL+ A AVA+          G   +IKWPND+LV +               
Sbjct: 133 PNIPPAHAPLLTLAAAVAVARAAREA---GVPAEIKWPNDVLVSEERANEGQSDRSSDDV 189

Query: 120 ----------------------KIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV 157
                                 K+ GIL E     N +  V+VG G+NV     D P   
Sbjct: 190 LVSETSEGQSEQGTAAGARGGEKLCGILTEMEGEANRVSWVIVGTGINVNIPADDLPEGA 249

Query: 158 TSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSY 217
           TS+Q   G ++ +    +  Q V    D  + D   + ++  WR  +  +G  + ++ + 
Sbjct: 250 TSVQEVVGSVNRR----VFVQRVLEEFDALRTDV--DAVLPAWRELSATLGQRVRVETTN 303

Query: 218 GSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           G ++G  V +   G L++E   G VR +  GD
Sbjct: 304 GDVVGTAVDIVTPGALVVETDDGDVR-VHAGD 334


>gi|29654317|ref|NP_820009.1| bifunctional biotin operon repressor/biotin synthetase BirA
           [Coxiella burnetii RSA 493]
 gi|153206793|ref|ZP_01945634.1| bifunctional protein birA [Coxiella burnetii 'MSU Goat Q177']
 gi|154706391|ref|YP_001424418.1| biotin operon repressor [Coxiella burnetii Dugway 5J108-111]
 gi|161830514|ref|YP_001596714.1| bifunctional protein birA [Coxiella burnetii RSA 331]
 gi|165918577|ref|ZP_02218663.1| bifunctional protein birA [Coxiella burnetii RSA 334]
 gi|212218437|ref|YP_002305224.1| biotin operon repressor [Coxiella burnetii CbuK_Q154]
 gi|29541584|gb|AAO90523.1| biotin operon repressor [Coxiella burnetii RSA 493]
 gi|120577156|gb|EAX33780.1| bifunctional protein birA [Coxiella burnetii 'MSU Goat Q177']
 gi|154355677|gb|ABS77139.1| biotin operon repressor [Coxiella burnetii Dugway 5J108-111]
 gi|161762381|gb|ABX78023.1| bifunctional protein birA [Coxiella burnetii RSA 331]
 gi|165917705|gb|EDR36309.1| bifunctional protein birA [Coxiella burnetii RSA 334]
 gi|212012699|gb|ACJ20079.1| biotin operon repressor [Coxiella burnetii CbuK_Q154]
          Length = 323

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 113/240 (47%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R + F+ I+STN E +KR       N+  +A  QT G+GR    W S  G N+Y SL   
Sbjct: 83  RIDLFEQINSTN-EYLKRVNHPQQLNI-CLAEMQTQGKGRFQRAWHSPFGQNIYLSLKYP 140

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                  L  LS    +A+ + I    P+   + +KWPNDI+   +K+AGILIE     +
Sbjct: 141 FHKDVSELAGLSLVCGLAVCNAIEENCPLTKPIFVKWPNDIICEDKKLAGILIEIEAETH 200

Query: 134 GLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           G  + ++GIGLNV    +   ++ P+ ++         D   + + L   +   +D ++K
Sbjct: 201 GFCSAIIGIGLNVNMEKEQDKINQPW-ISIKNLTATDQDRNQLCAALINQLVNCIDCFEK 259

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G  E +  W+     +   I +K     + G+ +G++  GYL ++   G  R   +GD
Sbjct: 260 -KGFNEFLASWKTKDYLLNKQIQLKSGRQELQGKSLGINPQGYLTVQLSDGSERIFSSGD 318


>gi|212212566|ref|YP_002303502.1| biotin operon repressor [Coxiella burnetii CbuG_Q212]
 gi|212010976|gb|ACJ18357.1| biotin operon repressor [Coxiella burnetii CbuG_Q212]
          Length = 323

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 113/240 (47%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R + F+ I+STN E +KR       N+  +A  QT G+GR    W S  G N+Y SL   
Sbjct: 83  RIDLFEQINSTN-EYLKRVNHPQQLNI-CLAEMQTQGKGRFQRAWHSPFGQNIYLSLKYP 140

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                  L  LS    +A+ + I    P+   + +KWPNDI+   +K+AGILIE     +
Sbjct: 141 FHKDVSELAGLSLVCGLAVCNAIEKNCPLTKPIFVKWPNDIICEDKKLAGILIEIEAETH 200

Query: 134 GLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK 189
           G  + ++GIGLNV    +   ++ P+ ++         D   + + L   +   +D ++K
Sbjct: 201 GFCSAIIGIGLNVNMEKEQDKINQPW-ISIKNLTATDQDRNQLCAALINQLVNCIDCFEK 259

Query: 190 DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             G  E +  W+     +   I +K     + G+ +G++  GYL ++   G  R   +GD
Sbjct: 260 -KGFNEFLASWKTKDYLLNKQIQLKSGRQELQGKSLGINPQGYLTVQLSDGSERIFSSGD 318


>gi|320105762|ref|YP_004181352.1| biotin/acetyl-CoA-carboxylase ligase [Terriglobus saanensis SP1PR4]
 gi|319924283|gb|ADV81358.1| biotin/acetyl-CoA-carboxylase ligase [Terriglobus saanensis SP1PR4]
          Length = 269

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 121/247 (48%), Gaps = 16/247 (6%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R   F+ ISSTN   +++A          VA  QTAGRGR  + W S+ G  LY S LL 
Sbjct: 22  RVLHFEEISSTNTYLVEQAQQDAAAGTVCVADRQTAGRGRGGHAWHSEAGAGLYVSALLR 81

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV-----FQRKIAGILIET 128
             +S      +S A  +A+++ +  +   G  V ++WPNDI+V     F +K+ G+L ET
Sbjct: 82  PELSVSHALKISLAAGLAVQTTLEQS--CGFHVDLRWPNDIVVPQPGAFSKKMGGLLTET 139

Query: 129 -LNLKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVL 184
            ++++  L+  V+GIGLN+ H   P +     TS +   G  +  +++   L   +++ +
Sbjct: 140 GVSVEGQLRYAVIGIGLNLNHIEMPAEIAASATSARMITGRSVRREEVLVSLLHALSQEM 199

Query: 185 DLWKKDTGREEIMNLWRCFAC-GIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            L  +D   EEI+  +   +   +G  + +    G   G   G+D+ G+L +    G +R
Sbjct: 200 ILLVQDP--EEILRRFTSKSGWALGKRVKVDEDEG-YTGVTDGLDERGFLRVRLANGAIR 256

Query: 244 QIFTGDI 250
               G +
Sbjct: 257 TPRHGGV 263


>gi|303242169|ref|ZP_07328658.1| biotin/acetyl-CoA-carboxylase ligase [Acetivibrio cellulolyticus
           CD2]
 gi|302590251|gb|EFL60010.1| biotin/acetyl-CoA-carboxylase ligase [Acetivibrio cellulolyticus
           CD2]
          Length = 334

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 124/247 (50%), Gaps = 17/247 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLLIDSI 76
            F  I STN+   K AL G      +VA  QT+GRGR   +W  SDK  ++ SL+L   I
Sbjct: 84  HFGKIDSTNNYAKKIALEGCEEGTLVVADFQTSGRGRLGREWNSSDKKGVWMSLVLRPDI 143

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
             + + +++ A ++A+   +     +  +  IKWPNDI++  +K+ GIL+E     + + 
Sbjct: 144 PFEEVQIITLAASIAVVRALKEVAQI--EAGIKWPNDIIINGKKVCGILVEMNMEIDRIN 201

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQ-------REGGCIDLKDIFSLLFQDVARVLD 185
            +V+GIGLNV     D P  +    TSL+            +   ++   +      + D
Sbjct: 202 FLVLGIGLNVNQKVNDFPDELKDKATSLRICMEETLDNQKLLKRSELIRAILLKFEEIYD 261

Query: 186 LWKKDTGR-EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
             K ++G  EEI++ W+ ++  +G  +++       +G   G+   G L+++ + G V++
Sbjct: 262 --KVNSGAFEEIISEWKKYSVTLGKEVSMTYKDKQCIGIAEGITRDGKLIVKCEDGTVKE 319

Query: 245 IFTGDIF 251
           + +G+++
Sbjct: 320 VLSGEVW 326


>gi|110597308|ref|ZP_01385596.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium ferrooxidans DSM
           13031]
 gi|110341144|gb|EAT59612.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium ferrooxidans DSM
           13031]
          Length = 327

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 107/236 (45%), Gaps = 5/236 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
           + +T  STN +    A+ G +    + A  QT GRGR    W S  G NLY +L+L   +
Sbjct: 86  YHETTDSTNLQAKALAVRGSVEGTVVAADSQTGGRGRMGRSWNSPAGKNLYFTLILRPEV 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               +  L+  +AVA+   +   +P     KIKWPNDILV ++KI G+L E  +  +   
Sbjct: 146 PSLRVPQLTLLVAVALHRALVRFVP-DLQPKIKWPNDILVNEKKICGVLCEMQSEPDCTH 204

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VVVG+G+NV     P +     TSL  E G      ++ +        + D W  +   
Sbjct: 205 FVVVGLGINVNQSEFPAELEGRATSLFLECGRSFSKPELLAAFLNQFEPLYDRWLIEEDL 264

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
             +++     +     ++ ++    +I G   G+   G L+LE   G    + +G+
Sbjct: 265 GFVLSYIEGHSLLQSRVVMVEQFNRTISGTVSGIAKGGELMLEGDDGGTVLVSSGE 320


>gi|154505275|ref|ZP_02042013.1| hypothetical protein RUMGNA_02789 [Ruminococcus gnavus ATCC 29149]
 gi|153794473|gb|EDN76893.1| hypothetical protein RUMGNA_02789 [Ruminococcus gnavus ATCC 29149]
          Length = 326

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 113/250 (45%), Gaps = 19/250 (7%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLY 67
           QN Y     +F    STN +  +    G        A  QTAG+GRR   W S    N+Y
Sbjct: 79  QNVY-----YFTETDSTNIQAKRMGDQGAPHGTLAAAGQQTAGKGRRGRTWESPADQNIY 133

Query: 68  ASLLL---IDSISKDSLTL-LSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
            SLLL   I  +    LTL +++A A+A+R         G DV+IKWPND+++  +KI G
Sbjct: 134 MSLLLRPEIAPVKAPMLTLVMAYAAAMALREC------TGLDVQIKWPNDLVINGKKICG 187

Query: 124 ILIETLNLKNGLQAVVVGIGL--NVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDV 180
           IL E     + +  VV+GIG+  N++  P +     TSL+ E G  I    + + + +  
Sbjct: 188 ILTEMSTEIDYINYVVIGIGINTNIEQFPEELKQTATSLRIEAGHSIRRSPLIAAIMRWF 247

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
            +    + K      I   +       G  + +    G      +G+++ G LL+ +  G
Sbjct: 248 EKAYAEFMKTEDLSGIQKAYNELLVNCGREVRVLEPKGEWQAEALGINNGGELLVRKADG 307

Query: 241 CVRQIFTGDI 250
               ++ G++
Sbjct: 308 SETAVYAGEV 317


>gi|301064832|ref|ZP_07205203.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
 gi|300441077|gb|EFK05471.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
          Length = 330

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 105/237 (44%), Gaps = 5/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +    +STN +    A  G      ++A  QT GRGR    W S     +Y S+++    
Sbjct: 87  YHPETASTNTDAKILATQGAPEGTVVIAEHQTRGRGRLGRDWYSPHSRGIYISVIIRPRF 146

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           S     +L+   AV M   +  T   G +V +KWPNDI+V  RKI GIL E  +  + + 
Sbjct: 147 SLQDAPILTPLTAVVMAEAL--TEETGLEVLLKWPNDIVVSGRKIGGILTEIGSEMDQID 204

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             V+G+GLNV+ C  P D     TS++ E      +      +      +   KK  G  
Sbjct: 205 FAVIGLGLNVRRCRFPEDLKSKATSIEEETSRRVSRAGLVRSYLGKFETVYEQKKTWGFG 264

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            ++  +      +G  +T+      + GR   +D+ G L++E   G   ++ +GD+ 
Sbjct: 265 PLLKRYEALTAVVGKEVTVNSGGRRLSGRVRDLDEHGALIVEGGGGTTIRVVSGDVH 321


>gi|313126931|ref|YP_004037201.1| bira, biotin-(acetyl-CoA-carboxylase) ligase [Halogeometricum
           borinquense DSM 11551]
 gi|312293296|gb|ADQ67756.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Halogeometricum
           borinquense DSM 11551]
          Length = 275

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 119/256 (46%), Gaps = 33/256 (12%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
           EF +++ +T+    + A  G      +VA+  TA RGR  N+W +  G +++S LL   +
Sbjct: 8   EFHESLGNTSLRVRQLADDGAPHGTMVVANELTAARGRTGNEWAAPPGGIWSSTLLRPDL 67

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV-----------FQRKIAGIL 125
           S + +  L+FA A+A   V+ +  P+G D ++KWPND++V             +K+AGIL
Sbjct: 68  STEHVGRLTFAGAMA---VVDAVEPLGVDARLKWPNDVVVASPSAEDAADAVPKKLAGIL 124

Query: 126 IETL----------------NLKNGLQAVVVGIGLNVKHCPVDTP--YPVTSLQREGGCI 167
            E +                +    ++ V+VG G+N    P +     PVT+L+ E G +
Sbjct: 125 TEPVVDGVTVPGKPVDEVFGDDNVSVEYVLVGTGINADFDPAEVSLDRPVTTLRAEVGSV 184

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITI-KLSYGSILGRFVG 226
           D + +     + +       + D G   +++ WR  A  +G  +T+ +     + G    
Sbjct: 185 DRERVAERYRESLVARCAAAESDEGFAALLDDWRERAETLGSRVTVRRRGNADVTGIARD 244

Query: 227 VDDFGYLLLEEKKGCV 242
           V   G LL+E  +  V
Sbjct: 245 VSPRGGLLVETDERTV 260


>gi|307243188|ref|ZP_07525361.1| biotin--[acetyl-CoA-carboxylase] ligase [Peptostreptococcus
           stomatis DSM 17678]
 gi|306493449|gb|EFM65429.1| biotin--[acetyl-CoA-carboxylase] ligase [Peptostreptococcus
           stomatis DSM 17678]
          Length = 327

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 119/238 (50%), Gaps = 12/238 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +FD+I STN      A     G++ +V+  QT G+GR    W+SD    +Y S +L  SI
Sbjct: 88  YFDSIDSTNIYANTIANQASEGSV-VVSKEQTQGKGRSGKVWVSDNDQGIYFSTILKPSI 146

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
               ++  SF   VA  ++  S   +G   +IKWPND+++  RKIAGIL E       + 
Sbjct: 147 P---ISRASFLTQVAGAALATSLERLGVACQIKWPNDLVLNGRKIAGILTEMRAEIESIS 203

Query: 137 AVVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK-KDTGR 193
            ++VGIG+N+  K          TSL  EG  I   D+    F D   + + +K KD  R
Sbjct: 204 YIIVGIGVNIGPKTFEESISTVATSLANEGYQIQDLDLLRAFFIDFEDLYEDFKNKDYTR 263

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFV-GVDDFGYLLLEEKKGCVRQIFTGDI 250
             I+ + +  +  +G  I + +  G     F   +D++G L++  + G + ++FTG+I
Sbjct: 264 --ILGILKDKSAVLGKEIYL-IRDGQKDKVFAENIDEYGNLIVRNELGFLEEVFTGEI 318


>gi|167039708|ref|YP_001662693.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X514]
 gi|300915043|ref|ZP_07132358.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X561]
 gi|307724965|ref|YP_003904716.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X513]
 gi|166853948|gb|ABY92357.1| biotin--acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X514]
 gi|300888767|gb|EFK83914.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X561]
 gi|307582026|gb|ADN55425.1| biotin/acetyl-CoA-carboxylase ligase [Thermoanaerobacter sp. X513]
          Length = 326

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 118/233 (50%), Gaps = 8/233 (3%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           I STN+   + A     G + I+A  Q AGRGR    WIS KG  ++ S++L  +I    
Sbjct: 89  IDSTNNFAKEMASKVPDGTV-IIAEEQIAGRGRLGRSWISQKGCGIWMSIILKPNIQPQE 147

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L+   A+++   I     V  + KIKWPNDI++  +K+ GIL E  +  + +  V++
Sbjct: 148 ALNLTQVAAISVVKAIEEVFHV--ESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVII 205

Query: 141 GIGLNVK--HCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
           GIG+NV   + P +     TSL  E    +D K + + +  ++    + + +  G E I 
Sbjct: 206 GIGVNVNCDNFPEELKGKATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQK-GFEYIG 264

Query: 198 NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            +    +  IG  I +  + G I G+ V +D+ G L++E K+G    I +GD+
Sbjct: 265 PICIEKSITIGRQIKVIANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDV 317


>gi|186474973|ref|YP_001856443.1| biotin--protein ligase [Burkholderia phymatum STM815]
 gi|184191432|gb|ACC69397.1| biotin--acetyl-CoA-carboxylase ligase [Burkholderia phymatum
           STM815]
          Length = 319

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 116/264 (43%), Gaps = 28/264 (10%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL  + G L      VA  QTAGRGRR   W ++ GN
Sbjct: 47  HDWPIEIVEETGSTNADLMARVKALPREPGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 106

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 107 ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 165

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCP----------VDTPYPV-----TSLQREGGCI 167
           GILIET        AVV+GIG NVK              D P        T+L R     
Sbjct: 166 GILIETAWSTPDASAVVIGIGTNVKGADELAAKVGALNADVPAQARGAAPTALSRALPNA 225

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWR-CFACGIGDLITIKLSYGSILGRFVG 226
           +L D  +     +   L  +  + G       W  C A    D++  +       G   G
Sbjct: 226 NLTDTLAAELNALEPALQRFGAE-GFAPFRQRWNGCHAYAGRDVVLFEQGVEIERGVAAG 284

Query: 227 VDDFGYLLLEEKKGCVRQIFTGDI 250
           VD+ G LLL+   G +  I TGD+
Sbjct: 285 VDELGQLLLDTPSGQL-AIATGDV 307


>gi|289675469|ref|ZP_06496359.1| biotin--protein ligase [Pseudomonas syringae pv. syringae FF5]
          Length = 319

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P ++    +D+I STN E  +    G    + +VA  QT+GRGRR  KW+S    NLY S
Sbjct: 73  PANWSVRTYDSIDSTNAEAARLITQGVAMPVLVVAEQQTSGRGRRGRKWVSPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSTSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMTV 249

Query: 187 WKKDT 191
            +K++
Sbjct: 250 HRKES 254


>gi|260881531|ref|ZP_05404657.2| biotin-[acetyl-CoA-carboxylase] ligase [Mitsuokella multacida DSM
           20544]
 gi|260848702|gb|EEX68709.1| biotin-[acetyl-CoA-carboxylase] ligase [Mitsuokella multacida DSM
           20544]
          Length = 339

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 118/246 (47%), Gaps = 21/246 (8%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD--KGNLYASLLLIDS 75
           F+ TI STN E  + A  G    L +VA  Q  GRGR +  + S   KG  ++ +L  D 
Sbjct: 95  FYPTIDSTNLEAKRLAQQGAPDGLVVVAEEQGKGRGRLERSFFSPAGKGIWFSVILRPDF 154

Query: 76  ISKDSL--TLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
           + +D+   TLLS A+AVA      +    G  V IKWPND+L   +K+ GIL E      
Sbjct: 155 LPQDAPKCTLLS-AVAVAK-----AAEDFGMKVGIKWPNDVLAGGKKLVGILTEMSAEME 208

Query: 134 GLQAVVVGIGLNV----KHCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWK 188
            +  V++G G+NV    +  P +      S    +G  I     F  + + +  + D   
Sbjct: 209 RIHYVIIGTGINVNIKAEEFPEELRDKAASFSEIKGEKIPRAAFFRAVLEHMDALYDAIL 268

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVG----VDDFGYLLLEEKKGCVRQ 244
           ++ G  E+ + WR ++  +G  + I  + G   G FVG    +D+ G LL++   G  R+
Sbjct: 269 RE-GFAEVFSEWRRYSITLGQTVRIIDARGGGQGAFVGKAVDIDEDGALLVDTAAGR-RR 326

Query: 245 IFTGDI 250
           +  GD+
Sbjct: 327 VLAGDV 332


>gi|297183210|gb|ADI19350.1| biotin-(acetyl-CoA carboxylase) ligase [uncultured Chloroflexi
           bacterium HF0500_03M05]
          Length = 227

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query: 27  DECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLS 85
           DE    A +G      ++A  QT GRGR    WIS  G N+  S++   S ++  L  ++
Sbjct: 2   DEARMLADNGAPEGTVVIAREQTTGRGRFKRSWISPSGRNILFSVVFRPSSAQ--LNYVN 59

Query: 86  FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLN 145
            A  +A+   +AS    G    +KWPND+ +  RK+AGILIET          +VGIGLN
Sbjct: 60  MAATLAVSRAVASL--TGLKTSVKWPNDVRINGRKVAGILIETAIEMEKPHFAIVGIGLN 117

Query: 146 VKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRC 202
           V   P + P      TSL  E G   + D+  +L   + ++ DL+ +      + + W  
Sbjct: 118 VNLVPSEYPEIAAIATSLYVETG--RMHDMTGVLLAVLEQLDDLYGEVLQGRSLTDEWSV 175

Query: 203 FACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               +G ++ ++       GR + VD+ G LLL    G    +  G++
Sbjct: 176 ELETLGRMVRVQWRDQLFDGRAISVDEQGNLLLLNADGSTVTVVAGEV 223


>gi|58584877|ref|YP_198450.1| biotin-(acetyl-CoA carboxylase) ligase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419193|gb|AAW71208.1| Biotin-(acetyl-CoA carboxylase) ligase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 303

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 130/295 (44%), Gaps = 62/295 (21%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS---- 69
           F    ++ +SSTN + +     G      I+A  QT GRGR    WIS +GN YAS    
Sbjct: 9   FHIYHYEEVSSTNGKALDLIDRGISNETVIIADKQTEGRGRTGKNWISPEGNFYASFIIN 68

Query: 70  LLLIDSI----------------------------------SKDSLTLLSFAIAVAMRSV 95
           LL I S+                                  S   LT L+F  A+A+ + 
Sbjct: 69  LLQITSLGSSITHWDSRLAVAAHLDVIPAHDAKIQCWNDRESLSKLTELTFVTALAVGNT 128

Query: 96  IASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV---- 151
           + S +   ++V+ KWPNDI V  +KI+GIL+E  +  N L   V+GIG+N+ H P+    
Sbjct: 129 LLSFIN-DSNVQYKWPNDIFVDGKKISGILLEKKSNSNWL---VIGIGINIDHAPLLEAT 184

Query: 152 -------DTPYPVTSLQRE------GGCIDLKDIFSL--LFQDVARVLDLWKKDTGREEI 196
                   +  PVT  + +         + L++I+ L  L  +   +   W  D G   I
Sbjct: 185 CINKLLSSSVVPVTDTKIQMQVPMSHARMILQNIYILKELVTNFNNLRKQWILD-GFCAI 243

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
             +W   A  + + I++K +     G F+ +D  G L+L++K G +     G++F
Sbjct: 244 REMWLKRAFKMNEQISVKFASKLHEGIFIDIDKGGRLVLQQKDGSLIYFDAGELF 298


>gi|297182596|gb|ADI18755.1| biotin-(acetyl-CoA carboxylase) ligase [uncultured gamma
           proteobacterium HF4000_36I10]
          Length = 325

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 107/225 (47%), Gaps = 12/225 (5%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           I+STN    +RA  G+      VA  QTAGRGR   +W+S  G NL  S+L        +
Sbjct: 89  ITSTNTLLAERARQGEASGGVCVAEQQTAGRGRLGRQWVSPYGRNLTFSVLWEFQNGAAA 148

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
           L  LS  + +A+   +     VG  + +KWPND+L   RK+AG+L+E      G   V++
Sbjct: 149 LEGLSLGVGLAVAEALRDLGVVG--LGLKWPNDVLCEGRKLAGVLLEMQGDAAGRCQVII 206

Query: 141 GIGLNVK---HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK--KDTGREE 195
           GIGLNV      P+D  +  T LQR+G      D   LL Q + R+L L    +  G  E
Sbjct: 207 GIGLNVALPDDAPIDQAW--TDLQRQG--FAGSDRNQLLAQILNRLLPLLAGFEQAGFVE 262

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           +   W+ F     +   ++     + G   GV   G L  E ++G
Sbjct: 263 LKERWQAFDALADEPAELRRGDEVVAGICRGVAPNGALRFETERG 307


>gi|50084054|ref|YP_045564.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           sp. ADP1]
 gi|49530030|emb|CAG67742.1| putative biotin--[acetyl-CoA-carboxylase] synthetase [Acinetobacter
           sp. ADP1]
          Length = 253

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 111/221 (50%), Gaps = 20/221 (9%)

Query: 20  DTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKD 79
           +  +STND+  + A  G L  L + ++ QT GRG+   +WIS KGN+Y S L+    + D
Sbjct: 26  EITTSTNDDVRELAQKGILTAL-VCSNVQTQGRGQHQRQWISPKGNIYLSTLINTQTTLD 84

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               L  A+ +     +A+      ++++KWPND+   Q K  GIL+E L+        +
Sbjct: 85  GRMALEVALNILQMPALAN-----LNLQVKWPNDLYSLQGKWGGILVEPLSATQA----I 135

Query: 140 VGIGLNV---KHCPVDTPYPVTSLQREGGCIDLK--DIFSLLFQDVARVLDLWKKDTGRE 194
           VG+G+NV   +H   DT   +TSL  + GC   +   + + L+  + +  D +  D G  
Sbjct: 136 VGVGINVVTPEHH--DTDQAITSL-TDLGCHQRERTHLIAQLYLAIQQAKDWF--DHGCY 190

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
            +   +  +A  + D +  +   G++ G F G++  G +L+
Sbjct: 191 RLAERFNHYAAFMHDHVRFEHHQGNLNGHFEGINHEGAVLI 231


>gi|330976623|gb|EGH76667.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 319

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 7/184 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P ++    +D+I STN E  +  + G    + +VA  QT+GRGRR  KW+S    NLY S
Sbjct: 73  PANWSVRTYDSIDSTNAEAARLIVQGVPMPVLVVAEQQTSGRGRRGRKWVSPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSTSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMTV 249

Query: 187 WKKD 190
            +K+
Sbjct: 250 HRKE 253


>gi|145220515|ref|YP_001131224.1| biotin--acetyl-CoA-carboxylase ligase [Prosthecochloris
           vibrioformis DSM 265]
 gi|145206679|gb|ABP37722.1| biotin--acetyl-CoA-carboxylase ligase [Chlorobium phaeovibrioides
           DSM 265]
          Length = 325

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 112/264 (42%), Gaps = 43/264 (16%)

Query: 10  NPYSFRYEFF--DTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NL 66
           N  +F  E    + + STN      A  G    L + A  QT GRGR    W S  G N+
Sbjct: 76  NTSAFAREMVWEEELVSTNTTARVLAGKGAAEGLVVSADRQTGGRGRLGRSWESAPGVNI 135

Query: 67  YASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILI 126
           + SL+L   +    +  L+  +AVA+   IAS LP      IKWPNDI    RK+AG+L 
Sbjct: 136 HCSLVLRPRVPLQRIPQLTLLVAVAIHKAIASLLP-DLSAAIKWPNDIYSDGRKLAGVLC 194

Query: 127 ETLNLKNGLQAVVVGIGLNVKH--CPVDTPYPVTSLQREGGCI--------DLKDIFSLL 176
           E  +  +    VVVGIG+NV     P       TSL    G I        ++ + F  L
Sbjct: 195 EMESEADCAHFVVVGIGINVNQESFPPHLSQSATSLLLASGRIASRPQLLAEIFNHFEPL 254

Query: 177 FQ------DVARVLDL-----WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV 225
           +       D+A VLD      W KD  RE                + +   +G I GR  
Sbjct: 255 YHEWCEVDDLAFVLDYLERHAWLKD--RE----------------VEVSRLHGKIAGRVS 296

Query: 226 GVDDFGYLLLEEKKGCVRQIFTGD 249
           G+   G L + E  G V  I +G+
Sbjct: 297 GLSALGELRVVESDGTVHLIGSGE 320


>gi|295838644|ref|ZP_06825577.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces sp. SPB74]
 gi|295827116|gb|EFG65253.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces sp. SPB74]
          Length = 289

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 112/245 (45%), Gaps = 30/245 (12%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLLIDSISKDSLT 82
           ST+ +   RA     G + +VA  QTA RGR D +W    +  L+ S+LL   +    L 
Sbjct: 40  STHTDLRARAAGTPEGAV-LVAEEQTAARGRLDRRWSAPPRSGLFFSVLLRPEVPAARLG 98

Query: 83  LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV----FQRKIAGILIETLNLKNGLQAV 138
            L     VA+ + ++     G D  +KWPND+L+     +RK AGIL E    ++G  AV
Sbjct: 99  WLPLLAGVALATALSRA--AGVDTALKWPNDLLLTVDGAERKAAGILAEA--TEDG--AV 152

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSL----LFQDVARVL----DLWKKD 190
           V+GIGLNV     + P P        G + L D  +L    L + V R L    + W++ 
Sbjct: 153 VLGIGLNVSLRADELPVPTA------GSLALADAITLDRDPLLRAVLRSLAEWYERWREA 206

Query: 191 TGREEIMNLWRCFACG---IGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
            G      L   +A G   +G  +  +L   G +LG  V +D  G L+L    G    + 
Sbjct: 207 DGDPAACGLQAAYAAGCSTLGRQVRAELPGGGELLGEAVALDGDGRLVLVTPGGAREAVG 266

Query: 247 TGDIF 251
            GDI 
Sbjct: 267 AGDIV 271


>gi|18976449|ref|NP_577806.1| biotin--protein ligase [Pyrococcus furiosus DSM 3638]
 gi|3288812|gb|AAC25558.1| biotin ligase BirA homolog [Pyrococcus furiosus DSM 3638]
 gi|18891985|gb|AAL80201.1| biotin operon repressor/biotin--[acetyl CoA carboxylase] ligase
           [Pyrococcus furiosus DSM 3638]
          Length = 235

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 117/249 (46%), Gaps = 49/249 (19%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLW----IVASCQTAGRGRRDNKWISDKGNLYASLLLI 73
           ++  ++STN+          LGN      IVA  QT G GR   +W S  G L+ S++L 
Sbjct: 15  YYREVTSTNEVA-------KLGNFEEGTVIVADTQTMGHGRIGRRWESPPGGLWMSVVLH 67

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             IS + L  LSF  A+A   V+ +        KIKWPND+LV  +KIAGIL+E    K 
Sbjct: 68  PRISTEDLPKLSFLGALA---VVRTLSEFSIQGKIKWPNDVLVDYKKIAGILVE----KR 120

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG------------CIDLKDIFSLLFQDVA 181
           G   VV+G+GLNV +   + P   TS+    G              +L +++ +     A
Sbjct: 121 G-DNVVLGVGLNVNN---EAPENATSMAEILGTSVPLIEVFRALVTNLDELYKMFLSSPA 176

Query: 182 RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            +L++ KK    E I+ +       IGD        G I G    +D+ G L+L    G 
Sbjct: 177 SLLEMAKK----EMILGVPVRI---IGD--------GEIEGIAEDIDELGRLILRLSDGS 221

Query: 242 VRQIFTGDI 250
           +++I  GD+
Sbjct: 222 LKKIVYGDV 230


>gi|294495300|ref|YP_003541793.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalophilus mahii DSM
           5219]
 gi|292666299|gb|ADE36148.1| biotin/acetyl-CoA-carboxylase ligase [Methanohalophilus mahii DSM
           5219]
          Length = 322

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 114/237 (48%), Gaps = 12/237 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSIS 77
            F  + STND     A     G + +VA  Q  GRGRR   W+S  G ++ S++L  SI 
Sbjct: 87  HFMELESTNDYAKTIAKDTTEGTV-VVAEVQKKGRGRRGFDWVSPHGGVWISIVLKPSIV 145

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
               + L+    +A   V+ S   +G    +KWPND+LV  +KI GIL E     + ++ 
Sbjct: 146 SADASRLTLVGGLA---VVDSLKSIGLTPSLKWPNDVLVNGKKICGILTEMEAEIDRVEY 202

Query: 138 VVVGIGLNV----KHCPVDTPYPVTSLQRE-GGCID-LKDIFSLLFQDVARVLDLWKKDT 191
           +V+G+G+N+    +  P +     T++  E G  +D L+ + SLL+      +    K  
Sbjct: 203 IVLGMGINLNFNTEMLPEEIRDGSTTISDELGTYVDRLEFVRSLLYNLEQYYVHF--KTQ 260

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             EE+M  W   +  IG  + I      + GR +G+   G LLL++  G   +I +G
Sbjct: 261 PFEELMERWIDSSDTIGRKVRIVTPSKMVDGRAIGISPSGGLLLQKNNGSTEEILSG 317


>gi|320540643|ref|ZP_08040293.1| putative bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/ DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Serratia symbiotica str. Tucson]
 gi|320029574|gb|EFW11603.1| putative bifunctional biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/ DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Serratia symbiotica str. Tucson]
          Length = 320

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 108/240 (45%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R      + STN   + R      G+  I A  Q AGRGRR  +W+S  G NLY S+   
Sbjct: 80  RVTVLPVVDSTNQYLLDRICKLQSGDACI-AEYQQAGRGRRGRQWVSPFGTNLYLSMFWR 138

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        DV++KWPND+ +  RK+AGIL+E      
Sbjct: 139 LEQGPAAAMGLSLVIGIVMAEVLQRL--GAEDVRVKWPNDLYLNDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+  C  +         +LQ  G  ID  ++ + L  ++ + L  ++ D
Sbjct: 197 DAAHLVMGAGINLAMCGTNADAINQGWINLQEAGISIDRNELAATLLNELRQSLKQFEND 256

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G    +  W      I   I + +    I G   G+D  G LLL++ +G ++    G+I
Sbjct: 257 -GLTPFVARWHSLDNFIDRPIKLLIGEQQIFGIARGIDQQGALLLDQ-QGVIKPFIGGEI 314


>gi|330940858|gb|EGH43825.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 319

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 7/184 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P ++    +D+I STN E  +    G    + +VA  QT+GRGRR  KW+S    NLY S
Sbjct: 73  PANWSVRTYDSIDSTNAEAARLITQGVAMPVLVVAEQQTSGRGRRGRKWVSPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSTSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMTV 249

Query: 187 WKKD 190
            +K+
Sbjct: 250 HRKE 253


>gi|297180355|gb|ADI16572.1| biotin-(acetyl-CoA carboxylase) ligase [uncultured gamma
           proteobacterium HF0010_01E20]
          Length = 310

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 118/256 (46%), Gaps = 12/256 (4%)

Query: 1   MFSNLSECQN--PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNK 58
              +L   QN  P     +  D   STN E M+R       +  I+   Q+AGRGRR   
Sbjct: 52  QLHDLHYIQNSLPQQLSVQLLDYTDSTNSEMMRRRTKFGGADQLILTEYQSAGRGRRGKV 111

Query: 59  WISDKGNLYASLLLID-SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF 117
           W  D G   A  L I+  ++ ++L  LS  + +A+   +      G D ++KWPND+ V 
Sbjct: 112 WFGDYGRNIAMTLGIEFPLNLNALGGLSSVVGLALLQALELE---GVDAQLKWPNDVWVK 168

Query: 118 QRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFS 174
           ++K+AGIL+E +  K G  A +VGIG+NV    V        VT+L+R G  I   D+  
Sbjct: 169 EQKLAGILVELVPTKIGTLA-IVGIGINVDLTNVQASKIDQSVTTLRRLGALISRDDLVV 227

Query: 175 LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            +   + +  +++  + G    ++ +    C       + L   S  G   G+D  G L 
Sbjct: 228 AVHASLRKNFEVYSSE-GFAPFLDAFNSAHCLQDRAAILVLGTESQQGIVRGIDITGGLR 286

Query: 235 LEEKKGCVRQIFTGDI 250
            E+  G  R + +G++
Sbjct: 287 FEQ-NGATRIVTSGEV 301


>gi|257091889|ref|YP_003165530.1| biotin/acetyl-CoA-carboxylase ligase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044413|gb|ACV33601.1| biotin/acetyl-CoA-carboxylase ligase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 268

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 120/245 (48%), Gaps = 15/245 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLL 72
           F  E      ST+   ++RA  G      +VA  QTAGRGRR   W+S   G+L  SLL 
Sbjct: 26  FAVEALPECVSTSTLLLERARQGAPSGALLVADRQTAGRGRRGRSWLSSPAGSLTFSLLW 85

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
             +     L  LS A+ VA+   + ++   G  +++KWPNDIL+   K+ GILIE L   
Sbjct: 86  RFACPVARLAGLSLAVGVAVARALEASGVAG--IELKWPNDILLDGGKVGGILIE-LEAA 142

Query: 133 NGLQAVVVGIGLNVKHCPV---DTPYPVTSL-QREGGCIDLKDIFSLLFQDVARVLDLWK 188
            G    V+GIGLN++       +  +P  +L Q      D   + + L  D+A VLD + 
Sbjct: 143 PGSMLAVIGIGLNLQLPATGDEEMLHPPAALAQALSPVPDRHQLLAQLLIDLATVLDGF- 201

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSIL---GRFVGVDDFGYLLLEEKKGCVRQI 245
            ++G   + + W+      G    ++L  G ++   G+ +G D  G LLL+   G V + 
Sbjct: 202 AESGFAAVRDDWQARHAWQGRY--VRLLNGGLVDREGKCLGADTDGALLLKTAAG-VERC 258

Query: 246 FTGDI 250
            +GD+
Sbjct: 259 LSGDL 263


>gi|330899752|gb|EGH31171.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 319

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 7/184 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P ++    +D+I STN E  +    G    + +VA  QT+GRGRR  KW+S    NLY S
Sbjct: 73  PANWSVRTYDSIDSTNAEAARLITQGVAMPVLVVAEQQTSGRGRRGRKWVSPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMNVLRDMGVQGAG--LKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVKH---CPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                +  V++GIG+NV       VD  +    L+  GG +D   + + +   +  ++ +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSTSEVDQLWTSVRLE-TGGLVDRNQVAARISTQLEALMTV 249

Query: 187 WKKD 190
            +K+
Sbjct: 250 HRKE 253


>gi|325295265|ref|YP_004281779.1| biotin/acetyl-CoA-carboxylase ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065713|gb|ADY73720.1| biotin/acetyl-CoA-carboxylase ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 253

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 118/237 (49%), Gaps = 20/237 (8%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           F + + STN E +KR        L +VA  QT G+GRR  KWIS+KG  LY S +    I
Sbjct: 29  FLEEVDSTN-EYLKRV--EFCHGLCVVAEKQTGGKGRRGKKWISEKGKGLYVSFMF-SPI 84

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           S    +L S A  VA+ +V+ +   +     +KWPNDI +  +KI+GIL E L+      
Sbjct: 85  SYQIASLSSLAFGVAVLNVLKT---LDKRFYLKWPNDIYINGKKISGILPELLS-----D 136

Query: 137 AVVVGIGLNVKHCPVD---TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            +++GIG+N+ +   +      P TSL  E    D   I   L  +V    +L KK    
Sbjct: 137 RLIIGIGINLNYTRDELSSLEVPATSLFAEKIPFDKHSILDKLILEVENYYELLKKKAFN 196

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +  +      IG  +++   +    G  +G+D  G L++ E +G +R++F+G++
Sbjct: 197 ---VKEFEKNCPLIGKEVSVIEEHKQFNGIALGIDTNGCLVV-EVEGKIRRLFSGNV 249


>gi|281421267|ref|ZP_06252266.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella copri DSM 18205]
 gi|281404802|gb|EFB35482.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella copri DSM 18205]
          Length = 246

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 111/220 (50%), Gaps = 26/220 (11%)

Query: 44  VASCQTAGRGRRDNKWISDKGN--LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           +A  QTAGRG+  + W S+ G   L++ ++    +      LLS A A+A++  + S   
Sbjct: 33  IADYQTAGRGQGVHTWESEPGKNLLFSMMMCPKWVPLRQQFLLSEAGALAVKDALDSY-- 90

Query: 102 VGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVT 158
             TD + +KWPND+  + +KI+G LIET     G++  + GIG++V       D P PV+
Sbjct: 91  --TDGITLKWPNDVYWYDKKISGTLIETAIDSKGIKRCIFGIGIDVNQTEFHSDAPNPVS 148

Query: 159 SLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDL-ITIKLSY 217
             Q  G  +D +++   + +   R  +L +    R + M++      GI  L +  +  Y
Sbjct: 149 LAQILGHEVDREEVLQKVIEAFCRYYELLR----RADYMDV-----SGIYHLSLYRRKGY 199

Query: 218 -------GSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
                  G   G FV V+D G+L+L +KKG +R    G+I
Sbjct: 200 HWYEDKDGKFEGAFVEVEDDGHLILHDKKGVIRSYAFGEI 239


>gi|193066775|ref|ZP_03047794.1| bifunctional protein BirA [Escherichia coli E22]
 gi|192925579|gb|EDV80254.1| bifunctional protein BirA [Escherichia coli E22]
          Length = 321

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 115/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ EG  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEEGINLDRNTLAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|193084028|gb|ACF09702.1| biotin-protein ligase [uncultured marine crenarchaeote
           AD1000-202-A2]
          Length = 332

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 118/226 (52%), Gaps = 18/226 (7%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F+ I ST +  +K A + +     +++  QT GRGR   KW S  G ++ S+++  
Sbjct: 89  RIYYFNNIDSTQNFAIKIAPNKNENGTIVISKRQTFGRGRLKRKWKSPVGGIWLSVIVHP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
                 +TL+  A ++A+   I   L + T   +KWPND+ + ++K+AGIL++T    N 
Sbjct: 149 QFRTSQITLVPIATSLALHKAIEKVLKIKTA--LKWPNDLTLKKKKVAGILLDTSIQSNK 206

Query: 135 LQAVVVGIGLNVKHCPVD-------TP--YPVTSL-QREGGCIDLKDIFSLLFQDVARVL 184
           ++ +V+GIG+N K  P +       TP  Y V++L ++    + L   F    +++ +++
Sbjct: 207 IEFLVLGIGINFKIKPRNLEKLLKKTPNFYGVSTLVEKNEKPLPLVKQFLYELENIFQMI 266

Query: 185 DLWKKDTG-REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDD 229
                +TG  ++I+  W   +  IG  +++ +    I G+ + +D+
Sbjct: 267 -----NTGSNKKIVKEWTKRSSTIGKNVSVVIDNDRINGKALKMDN 307


>gi|323141553|ref|ZP_08076438.1| biotin--[acetyl-CoA-carboxylase] ligase [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413965|gb|EFY04799.1| biotin--[acetyl-CoA-carboxylase] ligase [Phascolarctobacterium sp.
           YIT 12067]
          Length = 335

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 104/243 (42%), Gaps = 17/243 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + D++ S+N+     A  G    L +VA  Q AG+GR    WIS     ++ S++L    
Sbjct: 87  YRDSVDSSNNLAKALANEGCENGLLVVAEEQGAGKGRLSRGWISPYAKGIWFSVVLKPPF 146

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                +  +   AVA+   I      G    IKWPND+L+  RK+ GIL E       + 
Sbjct: 147 LPQEASKCTLLAAVAVVKSINKI--AGVHAAIKWPNDVLLLGRKLVGILTEMNAEFGHIN 204

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK------- 189
            VV+G G+N    P D P  V  L      + + D  +  F  V  + D+ K        
Sbjct: 205 YVVIGTGINTNASPEDYPEEVRDL-----AVSVADAATEPFTRVELLCDILKNMEDLYET 259

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   + + WR ++C +G  + +     +  G    +D+ G L++  + G   ++  
Sbjct: 260 AVQDGFGPVFDEWRRYSCTLGQEVKVIAPDMTYFGTAEDIDEEGLLIVRREDGSKEKVVA 319

Query: 248 GDI 250
           GD+
Sbjct: 320 GDV 322


>gi|260774623|ref|ZP_05883535.1| biotin-protein ligase/biotin operon repressor [Vibrio metschnikovii
           CIP 69.14]
 gi|260610417|gb|EEX35624.1| biotin-protein ligase/biotin operon repressor [Vibrio metschnikovii
           CIP 69.14]
          Length = 322

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 120/253 (47%), Gaps = 20/253 (7%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG- 64
           S+  NP     E    I STN   +  +     G +  +A  Q  GRGRR   W+S  G 
Sbjct: 74  SQVTNPV----ELHPIIDSTNQYLLDNSHMISSGTV-CIAEYQNKGRGRRGRHWVSPFGS 128

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAG 123
           NLY S+         +   LS  I VA   ++ +   +G + +K+KWPND+    RK+AG
Sbjct: 129 NLYFSMYWRLDAGMAAAMGLSLVIGVA---IVEALEEMGLNGIKLKWPNDLYYQDRKLAG 185

Query: 124 ILIETLNLKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQREGGC--IDLKDIFSLLF 177
           IL+E      G   +V+GIG+N+    ++  +D P+  TSL +  G   ID   +   L 
Sbjct: 186 ILVEMSGQAGGAAHLVIGIGMNLIMQDENIAIDQPW--TSLSQVLGQEDIDRNQLVIKLI 243

Query: 178 QDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEE 237
           Q + R L+ +++  G +E +  W      +G  + + +    I G   G+D  G +LLE 
Sbjct: 244 QALNRSLENYEQH-GMQEFVERWNRLDNFLGRRVHLIIGPNKITGIERGIDQSGGVLLET 302

Query: 238 KKGCVRQIFTGDI 250
            +G ++    G+I
Sbjct: 303 PEG-IKSYLGGEI 314


>gi|116626596|ref|YP_828752.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229758|gb|ABJ88467.1| biotin--acetyl-CoA-carboxylase ligase [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 236

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 121/238 (50%), Gaps = 28/238 (11%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           +F+++ ST    M+ A + + G + ++A  Q AG GR+ + W S+ G+ +Y S++L  + 
Sbjct: 17  YFESLDST----MRVAAASEPGTI-VLADRQLAGLGRQGHTWHSEPGHGIYCSIVLPPT- 70

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                 +L+ A+ VA    IA     G    ++WPND+++  RK+AGIL++ +N      
Sbjct: 71  -----PVLTLALGVATIDAIAQA--AGIQCDLRWPNDLMLDNRKVAGILVQLVN-----G 118

Query: 137 AVVVGIGLNVKHC--PVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
           + + GIG+NV H   P D      SL++  G  +  +DI   LF  +  ++    +D+  
Sbjct: 119 SAIAGIGINVNHPGFPSDLAKEAISLRQHAGRELSREDILIALFPAIDSIV---GEDS-- 173

Query: 194 EEIMNLW-RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           E I+ L+    +   G  +T++   G I G   G+D  G+L++ +  G    I  G +
Sbjct: 174 ETILRLFTHASSYAAGRRVTVQQPGGDITGTTAGLDQSGFLIVRKDDGTDTLILAGGV 231


>gi|323464449|gb|ADX76602.1| biotin-acetyl-CoA-carboxylase ligase [Staphylococcus
           pseudintermedius ED99]
          Length = 323

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 123/250 (49%), Gaps = 26/250 (10%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           +++ + ++ ST  +  K+A+  D   + I++  QTAG+GR    W S KG  L+ SL+L 
Sbjct: 84  QFQTYPSVDSTQ-QVAKKAILNDDRTMLILSDEQTAGKGRFKRVWQSSKGKGLWMSLVLR 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I    LT  +  +++A+   I S  P    V+IKWPNDI +  +K+ G L E +   +
Sbjct: 143 PDIPFSMLTTFNLFMSLAISEAIQSYSPAK--VEIKWPNDIYIEGQKVCGFLTEMVANAD 200

Query: 134 GLQAVVVGIGLNVKHCPVD----TPYPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWK 188
           G++AV+ GIG+N+ H   D         TS++ + G  I+  D    L Q +      + 
Sbjct: 201 GIEAVICGIGINLNHDVEDFDEALQQTATSVKLQYGKIINRYDFLEQLMQRIEVRYQQFL 260

Query: 189 KD---TGREEIM---NLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFGYLLLEEKKG 240
            +   T ++E +   N+W            ++ + G     G  + +DD G+LL+ ++ G
Sbjct: 261 TEPFTTIKDEYIQRSNIWNK---------QLRFTEGKQQFYGNVMEIDDQGFLLVVDRDG 311

Query: 241 CVRQIFTGDI 250
              ++ + DI
Sbjct: 312 DFHRLMSADI 321


>gi|291520864|emb|CBK79157.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Coprococcus
           catus GD/7]
          Length = 325

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 111/237 (46%), Gaps = 7/237 (2%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + +  +STN      A  G      +VA  Q +GRGRR   W S KG+ ++ S+LL   I
Sbjct: 83  YEEEQASTNQTAKMLAEQGASHGTLVVAERQVSGRGRRGRPWHSPKGSGIWMSILLRPQI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              S ++L+   A+A+   I+S +       IKWPNDI++  RK+ GIL E  +  + + 
Sbjct: 143 HPMSASMLTLVAAMAVYDAISSRVE---GCAIKWPNDIVIDGRKVCGILTEMSSELDNIH 199

Query: 137 AVVVGIGLNVK--HCPVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            VV+GIG+NV     PVD     TS+    G      +I + +++   +  D + +    
Sbjct: 200 YVVIGIGINVNTDDFPVDIASVATSMHVITGAYYKRAEIIADIWKAFEKYYDFFVQTENL 259

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
             +++ +      +   + I+       G   G+D  G LL+E   G    + +G++
Sbjct: 260 VLMVDTYNQRLVNMDRRVMIEERGHRYEGTARGIDAEGGLLVERDDGTTTSVISGEV 316


>gi|237724277|ref|ZP_04554758.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229437465|gb|EEO47542.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 254

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 119/249 (47%), Gaps = 42/249 (16%)

Query: 20  DTISSTNDECMKRALSGDLGNLW-IVASCQTAGRGRRDNKWISDKG-NL-YASLLLIDSI 76
           +T++STND   +     ++     ++A  QTAG+G+R N W S+ G NL ++++    +I
Sbjct: 14  ETVTSTNDRLAELCQEKEIKEFTTLMAEYQTAGKGQRGNSWESEYGKNLTFSTVFYPQTI 73

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  S  +LS A+A A+R+ +A    V  D ++IKWPNDI    +KI GILIE     + +
Sbjct: 74  APASQFILSMAVASAIRTALAHY--VHADCLQIKWPNDIYWKDKKIVGILIENDLTGSQI 131

Query: 136 QAVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
              +VGIG+N+      +  P PV+  Q      D  ++ + +                 
Sbjct: 132 SQSIVGIGININQEEFHSSAPNPVSLRQITQKETDRMEVLNSVL---------------- 175

Query: 194 EEIMNLWRCFACGIGDLIT------IKLSY------------GSILGRFVGVDDFGYLLL 235
           E I+NL+        D+IT      +K  Y            G    + + V+  G+L+L
Sbjct: 176 EHIINLYSRIENRETDIITKIQEYYLKAQYRKEGYHPYCDAKGEFTAKLIRVEPDGHLIL 235

Query: 236 EEKKGCVRQ 244
           ++K G +R+
Sbjct: 236 KDKNGSLRK 244


>gi|85713349|ref|ZP_01044364.1| Biotin operon repressor/biotin--protein ligase fusion protein
           [Idiomarina baltica OS145]
 gi|85692827|gb|EAQ30810.1| Biotin operon repressor/biotin--protein ligase fusion protein
           [Idiomarina baltica OS145]
          Length = 330

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 120/242 (49%), Gaps = 23/242 (9%)

Query: 22  ISSTNDECMKRALSGDLGNLW-IVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKD 79
           + STND+  + + +  L   + I+A  QT GRGRR  +WIS  G NLY SL         
Sbjct: 89  VGSTNDDLKQLSDTQQLPQGYAILAEAQTQGRGRRGKQWISPFGTNLYISLYWRLEEGLG 148

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
               LS A+ +A+  V+   L +  +V +KWPND+ +  +K+AGILI+  +L++G    V
Sbjct: 149 RAMGLSLAVGLAIARVLREQLNI-KNVSVKWPNDVYIENKKVAGILIDIDSLEDGSARCV 207

Query: 140 VGIGLNVKHCPVDTPYPVTSLQR-EGGCIDLKDIFSL----------LFQDVARVLDLWK 188
           +G+G+N+         P T+ Q  +    D+    +L          L Q + R L  + 
Sbjct: 208 IGVGINLT-------LPDTAAQSIDQAWTDVNSHLALPLQRNRFAGRLHQYLVRTLTDY- 259

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           +++G  +   LWR +       + + L    + G   GVD+ G LL+ E  G V++ F G
Sbjct: 260 ENSGFGQFATLWREYDKFDTKPVRLLLGERKVDGLCRGVDETGALLV-EVDGSVKRFFGG 318

Query: 249 DI 250
           +I
Sbjct: 319 EI 320


>gi|212693678|ref|ZP_03301806.1| hypothetical protein BACDOR_03198 [Bacteroides dorei DSM 17855]
 gi|265755897|ref|ZP_06090364.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacteroides sp. 3_1_33FAA]
 gi|212663768|gb|EEB24342.1| hypothetical protein BACDOR_03198 [Bacteroides dorei DSM 17855]
 gi|263233975|gb|EEZ19576.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacteroides sp. 3_1_33FAA]
          Length = 255

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 119/249 (47%), Gaps = 42/249 (16%)

Query: 20  DTISSTNDECMKRALSGDLGNLW-IVASCQTAGRGRRDNKWISDKG-NL-YASLLLIDSI 76
           +T++STND   +     ++     ++A  QTAG+G+R N W S+ G NL ++++    +I
Sbjct: 15  ETVTSTNDRLAELCQEKEIKEFTTLMAEYQTAGKGQRGNSWESEYGKNLTFSTVFYPQTI 74

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  S  +LS A+A A+R+ +A    V  D ++IKWPNDI    +KI GILIE     + +
Sbjct: 75  APASQFILSMAVASAIRTALAHY--VHADCLQIKWPNDIYWKDKKIVGILIENDLTGSQI 132

Query: 136 QAVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
              +VGIG+N+      +  P PV+  Q      D  ++ + +                 
Sbjct: 133 SQSIVGIGININQEEFHSSAPNPVSLRQITQKETDRMEVLNSVL---------------- 176

Query: 194 EEIMNLWRCFACGIGDLIT------IKLSY------------GSILGRFVGVDDFGYLLL 235
           E I+NL+        D+IT      +K  Y            G    + + V+  G+L+L
Sbjct: 177 EHIINLYSRIENRETDIITKIQEYYLKAQYRKEGYHPYCDAKGEFTAKLIRVEPDGHLIL 236

Query: 236 EEKKGCVRQ 244
           ++K G +R+
Sbjct: 237 KDKNGSLRK 245


>gi|89891682|ref|ZP_01203185.1| putative biotin-(acetyl-CoA carboxylase) ligase [Flavobacteria
           bacterium BBFL7]
 gi|89516017|gb|EAS18681.1| putative biotin-(acetyl-CoA carboxylase) ligase [Flavobacteria
           bacterium BBFL7]
          Length = 235

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 104/219 (47%), Gaps = 11/219 (5%)

Query: 23  SSTNDECMKRALSGDLGNLW-IVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           +STNDE   R    +  +L  I +  QT GRG R + W+SD G NL  S+L+ D I   S
Sbjct: 10  TSTNDELKVRFRESETSHLMTIYSHSQTKGRGNRGSTWLSDSGKNLTFSVLVSDGIENLS 69

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVV 140
              L+  ++VAM   + + L +    KIKWPNDIL  Q K+AGILIE +         +V
Sbjct: 70  PFQLNQIVSVAMVDWLTTDLNI--QAKIKWPNDILSVQMKLAGILIENIYQNGHWSHSIV 127

Query: 141 GIGLNVKHCPV-DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNL 199
           GIGLNV      D P  ++     G    L+++       + R L        +E  +  
Sbjct: 128 GIGLNVNQEEFKDLPRAISLKNLTGKTFKLEELLLQFLFHLDRALK------NKEHTIGK 181

Query: 200 WRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
           +  +       +  ++   +++    GV + G LLLE++
Sbjct: 182 YLNYLFKYRQRMNFEIEGKALIATVYGVTESGELLLEKE 220


>gi|237708844|ref|ZP_04539325.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229457270|gb|EEO62991.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 254

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 119/249 (47%), Gaps = 42/249 (16%)

Query: 20  DTISSTNDECMKRALSGDLGNLW-IVASCQTAGRGRRDNKWISDKG-NL-YASLLLIDSI 76
           +T++STND   +     ++     ++A  QTAG+G+R N W S+ G NL ++++    +I
Sbjct: 14  ETVTSTNDRLAELCQEKEIKEFTTLMAEYQTAGKGQRGNSWESEYGKNLTFSTVFYPQTI 73

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +  S  +LS A+A A+R+ +A    V  D ++IKWPNDI    +KI GILIE     + +
Sbjct: 74  APASQFILSMAVASAIRTALAHY--VHADCLQIKWPNDIYWKDKKIVGILIENDLTGSQI 131

Query: 136 QAVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
              +VGIG+N+      +  P PV+  Q      D  ++ + +                 
Sbjct: 132 SQSIVGIGININQEEFHSSAPNPVSLRQITQKETDRMEVLNSVL---------------- 175

Query: 194 EEIMNLWRCFACGIGDLIT------IKLSY------------GSILGRFVGVDDFGYLLL 235
           E I+NL+        D+IT      +K  Y            G    + + V+  G+L+L
Sbjct: 176 EHIINLYSRIENRETDIITKIQEYYLKAQYRKEGYHPYCDAKGEFTAKLIRVEPDGHLIL 235

Query: 236 EEKKGCVRQ 244
           ++K G +R+
Sbjct: 236 KDKNGSLRK 244


>gi|25027296|ref|NP_737350.1| biotin--protein ligase [Corynebacterium efficiens YS-314]
 gi|23492577|dbj|BAC17550.1| putative biotin-[acetylCoA carboxylase] holoenzyme
           synthetase/biotin operon repressor bifunctional protein
           BirA [Corynebacterium efficiens YS-314]
          Length = 275

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 120/249 (48%), Gaps = 16/249 (6%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASC--QTAGRGRRDNKWISDKGN- 65
             PY+ R ++  T  STN + +     G     W VA+   Q  GRGR    W + +G+ 
Sbjct: 30  HGPYT-RVDYTPTTGSTNGDLLDADREG--APDWTVATTDYQDRGRGRLGRPWTAPEGSQ 86

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAG 123
            +++ L        + L  +  A  +A+   + S    G D V +KWPND+L+  RK+ G
Sbjct: 87  AIFSVLFRPRPSLLEHLGTVPLACGLALIDTLRS---FGVDGVGLKWPNDVLINGRKLCG 143

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E  +L     AVV+GIG+N+     + P P  TSL  EG  ID  D+   +   +  
Sbjct: 144 ILVEATSLDT-TPAVVIGIGINLNLTTGELPVPHATSLALEGYDIDRTDLLIRVLGHIHA 202

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            +  W++  G    ++ +R     +G D+  I      +LG  VG+ + G L++ +++G 
Sbjct: 203 RISDWER--GETVWLDDYRAVCSSLGQDVRVILPGDRELLGVAVGIAEGGQLMVRDEEGT 260

Query: 242 VRQIFTGDI 250
           +  +  G++
Sbjct: 261 IHTLSAGEV 269


>gi|73669100|ref|YP_305115.1| biotin--(acetyl-COA-carboxylase) synthetase [Methanosarcina barkeri
           str. Fusaro]
 gi|12018159|gb|AAG45428.1|AF317651_5 bifunctional biotin ligase/biotin operon repressor PYCB
           [Methanosarcina barkeri]
 gi|72396262|gb|AAZ70535.1| biotin--(acetyl-COA-carboxylase) synthetase [Methanosarcina barkeri
           str. Fusaro]
          Length = 326

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 112/237 (47%), Gaps = 10/237 (4%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
            +F+ ++STN    + A S + G L ++A  Q  GRGR   +WIS  G ++ S++L   I
Sbjct: 87  HYFEEVTSTNSIAKEIAASEEEGTL-VIAEVQKGGRGRLGREWISPHGGIWMSVILKPGI 145

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                + L+    +A+ +VI +   +  D +IKWPND+ +  +K+ GIL E     + + 
Sbjct: 146 PLRHASRLTLVAGLAVANVIRN---MDLDARIKWPNDVRINGKKVCGILTEAKAEVDKVD 202

Query: 137 AVVVGIGLNVKHCPVDTPYPV----TSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDT 191
            VV+GIG+NV     D P       T+L+ E G  I           ++ +   L+K   
Sbjct: 203 YVVLGIGINVNMDLKDIPESFRAGSTTLKAELGRHIKRVSFLQDFLFELEQQYILFKTQP 262

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
               I+N W   +  IG  + +      I G+ VGV   G L++++      +I  G
Sbjct: 263 -FSHILNDWLALSDTIGREVKVTTPSRIIEGKAVGVTPDGALVIKKADDTKEEIIAG 318


>gi|118594614|ref|ZP_01551961.1| Biotin--acetyl-CoA-carboxylase ligase [Methylophilales bacterium
           HTCC2181]
 gi|118440392|gb|EAV47019.1| Biotin--acetyl-CoA-carboxylase ligase [Methylophilales bacterium
           HTCC2181]
          Length = 329

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 116/231 (50%), Gaps = 15/231 (6%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL 72
           F     D + STN+   K + +G      +V   QT G+GRR  +W S  G NL  S L 
Sbjct: 81  FHLTVLDVVDSTNNYLKKASAAGHPHASCVVTHIQTHGKGRRGRQWQSALGENLTFSFLW 140

Query: 73  IDSISKDSLTLLSFAIAVAM-RSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGILIE 127
             +    +L+ LS A+ +A+ RS+    L +   + +KWPNDIL++     +K+AGILIE
Sbjct: 141 RFTKGASALSGLSLAVGIALIRSL--KKLHIHQAL-LKWPNDILIYDDGAYKKLAGILIE 197

Query: 128 TLNLKNGLQAVVVGIGLNV---KHCPVDTPYPVTSL-QREGGCIDLKDIFSLLFQDVARV 183
                +G  A ++GIG+N+   K        P +S+ Q     ID   I + + +D++ V
Sbjct: 198 LQGDMDGQSAAIIGIGINLNLSKKQTAKIDQPASSINQFTDEPIDPNTILATIIRDLSEV 257

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSI-LGRFVGVDDFGYL 233
           +  + +++G   + + W  +      +I I L  G+I  GR  GV+D G L
Sbjct: 258 MATF-EESGFAPLKDEWSSYDAFQDKVINIILGDGNIKQGRSNGVNDSGSL 307


>gi|78188061|ref|YP_378399.1| biotin--acetyl-CoA-carboxylase ligase [Chlorobium chlorochromatii
           CaD3]
 gi|78170260|gb|ABB27356.1| Biotin--acetyl-CoA-carboxylase ligase [Chlorobium chlorochromatii
           CaD3]
          Length = 327

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
           + ++D ++STN    + A SG      +VA  Q AGRGR    W+S  G NLY SL+L  
Sbjct: 85  FHYYDEVTSTNLLARELAQSGTPEGTVVVADTQRAGRGRMGRSWVSPSGVNLYFSLVLRP 144

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            +    +  ++  +A A+   I    P    + IKWPND+LV  +K+AGIL E  +    
Sbjct: 145 QVPLFRVPQVTLLVAAAVHQAIKKLAP-DVALGIKWPNDLLVQGKKVAGILCEMFSEPEQ 203

Query: 135 LQAVVVGIGLNV 146
           +  V+VGIG+N+
Sbjct: 204 VHFVIVGIGINL 215


>gi|319892448|ref|YP_004149323.1| Biotin-protein ligase / Biotin operon repressor [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162144|gb|ADV05687.1| Biotin-protein ligase / Biotin operon repressor [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 323

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 127/253 (50%), Gaps = 32/253 (12%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           +++ + ++ ST  +  K+A+  D   + I++  QTAG+GR    W S KG  L+ SL+L 
Sbjct: 84  QFQTYPSVDSTQ-QVAKKAILNDDRTMLILSDEQTAGKGRFKRVWQSSKGKGLWMSLVLR 142

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             I    LT  +  +++A+   I S  P    V+IKWPNDI +  +K+ G L E +   +
Sbjct: 143 PDIPFSMLTTFNLFMSLAISEAIQSYSPAK--VEIKWPNDIYIEGQKVCGFLTEMVANAD 200

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDL---KDI--FSLLFQDVARVLDLWK 188
           G++AV+ GIG+N+ H   D      +LQ+    + L   K+I  +  L Q + R+   ++
Sbjct: 201 GIEAVICGIGINLNHDVEDFD---EALQQTATSVKLHYGKNINRYDFLEQLMQRIEVRYQ 257

Query: 189 K------DTGREEIM---NLWRCFACGIGDLITIKLSYG--SILGRFVGVDDFGYLLLEE 237
           +       T ++E +   N+W            ++ + G     G  + +DD G+LL+ +
Sbjct: 258 QFLTEPFTTIKDEYIQRSNIWNK---------QLRFTEGKQQFYGNVMEIDDQGFLLVVD 308

Query: 238 KKGCVRQIFTGDI 250
           + G   ++ + DI
Sbjct: 309 RDGDFHRLMSADI 321


>gi|330505224|ref|YP_004382093.1| biotin--protein ligase [Pseudomonas mendocina NK-01]
 gi|328919510|gb|AEB60341.1| biotin--protein ligase [Pseudomonas mendocina NK-01]
          Length = 321

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 107/224 (47%), Gaps = 16/224 (7%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDSISKD 79
           ++ STN E  +R  +G+     ++A  QTAGRGRR   W S    NLY S++L       
Sbjct: 83  SVDSTNAEIFRRLEAGERAPFVLLAERQTAGRGRRGRVWASPFAENLYCSVVLRVDGGMS 142

Query: 80  SLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
            +  LS  + +A+   + S    G  V++KWPND+LV  RKI+GIL+E       +  VV
Sbjct: 143 QVEALSLTVGLAVAKTLQSLGLNG--VQLKWPNDVLVDGRKISGILLELAGDPADVCHVV 200

Query: 140 VGIGLNVKHC-----PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDL-WKKDTG- 192
           +GIG+NV         +D P+  +  Q  G  +D  D+ + L   +   L + W+     
Sbjct: 201 IGIGINVNMANDAPGAIDQPW-ASVRQCVGRMLDRNDLAAELLLQLRDCLSMHWQHGFAG 259

Query: 193 -REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
            REE    W       G  + +     + LG  +GVD+ G + L
Sbjct: 260 LREE----WEALHAWRGRSVALTAGNNATLGVVLGVDERGAVRL 299


>gi|223043198|ref|ZP_03613245.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus capitis
           SK14]
 gi|222443409|gb|EEE49507.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus capitis
           SK14]
          Length = 323

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 125/250 (50%), Gaps = 30/250 (12%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E ++++ ST  +  K+AL G+  +  I++  QT GRGR +  W S KG  L+ SL+L  +
Sbjct: 86  EVYNSVDSTQTKA-KKALVGNKSSFLILSDEQTEGRGRFNRNWSSSKGKGLWMSLVLRPN 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +   +  IA+ +R  I         V IKWPNDI + ++KI G L E +   + +
Sbjct: 145 VPFAMIPKFNLFIALGIRDAIQQF--SNDRVAIKWPNDIYIGKKKICGFLTEMVANYDAI 202

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQ-REGGCIDLKDIF-SLLFQDVARVLDLWKK 189
           +A++ GIG+N+ H   D      +  TS++      I+  D   +LL++   R     ++
Sbjct: 203 EAIICGIGINMNHVEADFNDEIRHIATSMRLHADDKINRYDFLKTLLYEINKRYKQFLEQ 262

Query: 190 --DTGREEIM---NLWRCFACGIGDLITIKLSYGSILGRFVG----VDDFGYLLLEEKKG 240
             +T REE +   N+W             +L +     +F+G    +D  G+LL+++ +G
Sbjct: 263 PFETIREEYIAATNMW-----------NRQLRFTENGHQFIGEAFDIDQDGFLLVKDDEG 311

Query: 241 CVRQIFTGDI 250
            + ++ + DI
Sbjct: 312 NLHRLMSADI 321


>gi|187922497|ref|YP_001894139.1| biotin--protein ligase [Burkholderia phytofirmans PsJN]
 gi|187713691|gb|ACD14915.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia phytofirmans
           PsJN]
          Length = 297

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 115/264 (43%), Gaps = 28/264 (10%)

Query: 12  YSFRYEFFDTISSTNDECMKR--ALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M R  AL    G L      VA  QTAGRGRR   W ++ GN
Sbjct: 28  HDWPIEIVEETGSTNADLMTRVKALPRKPGALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 87

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   +   LPV     + +KWPND+L+   K+A
Sbjct: 88  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGL-RALPVAGPGQIALKWPNDVLLEGDKLA 146

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC---------------PVDTPYPVTSLQREGGCI 167
           GILIET    +   AVV+GIG NVK                 P       T+LQR     
Sbjct: 147 GILIETAWSTDDASAVVIGIGTNVKGADELAAKVGALNAGVPPQARGTAPTALQRALPNA 206

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVG 226
           +L D  +     +   L  +  + G       W       G +++ ++     + G   G
Sbjct: 207 NLTDTLAAELNALEPALQRFGAE-GFAPFQARWNAVHAYAGREVVLLEQGQEQMRGVAAG 265

Query: 227 VDDFGYLLLEEKKGCVRQIFTGDI 250
           VD+ G LLL+   G    + TGD+
Sbjct: 266 VDERGQLLLDTATGR-ETVATGDV 288


>gi|333014301|gb|EGK33656.1| bifunctional protein birA [Shigella flexneri K-227]
          Length = 321

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 106/214 (49%), Gaps = 14/214 (6%)

Query: 44  VASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV 102
           VA  Q AGRGRR  KW S  G NLY S+         +   LS  I + M  V+     +
Sbjct: 108 VAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRK---L 164

Query: 103 GTD-VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLN-----VKHCPVDTPYP 156
           G D V++KWPND+ +  RK+AGIL+E          +V+G G+N     V+   V+  + 
Sbjct: 165 GADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGW- 223

Query: 157 VTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLS 216
             +LQ  G  +D   + ++L +++   L+L++++ G    ++LW      I   + + + 
Sbjct: 224 -ITLQEAGINLDRNTLAAMLIRELRAALELFEQE-GLAPYLSLWEKLDNFINRPVKLIIG 281

Query: 217 YGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I G   G+D  G LLLE+  G ++    G+I
Sbjct: 282 DKEIFGISRGIDKQGALLLEQ-DGIIKPWMGGEI 314


>gi|260654182|ref|ZP_05859672.1| biotin-[acetyl-CoA-carboxylase] ligase [Jonquetella anthropi E3_33
           E1]
 gi|260631167|gb|EEX49361.1| biotin-[acetyl-CoA-carboxylase] ligase [Jonquetella anthropi E3_33
           E1]
          Length = 328

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 106/240 (44%), Gaps = 8/240 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E    + STN  C  RA  G    L I A  QTAGRGR    W SD+   L  SLLL  +
Sbjct: 87  EILAQVDSTNTLCRTRAREGASDGLVIAAEHQTAGRGRSGRTWHSDQCQALQFSLLLRPA 146

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +      L++   A AM   + S    G + +IKWPND+L+  +K+ GIL E     + +
Sbjct: 147 LPPSRAALITQIGAAAMAQALVS---AGFEPQIKWPNDLLLNGKKVCGILTEMSCELDRI 203

Query: 136 QAVVVGIGLNVKHC--PVDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             V++G+GLNV     P D     TSL    G   D   + +        + D +  +  
Sbjct: 204 HWVIMGVGLNVNQTDFPPDIEGIATSLAAVSGKTHDRTALLAKFLNAFEPLFDDYLANPA 263

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFV-GVDDFGYLLLEEKKGCVRQIFTGDIF 251
             + + + R  +   G  I+     G      V G+D  G L +    G +R++ +G++ 
Sbjct: 264 SPQALEICRRRSSLTGREISFTDDAGLAQKAIVLGIDSVGRLEVRLADGQLRRLLSGEVH 323


>gi|259506566|ref|ZP_05749468.1| bifunctional biotin ligase/biotin operon repressor [Corynebacterium
           efficiens YS-314]
 gi|259165764|gb|EEW50318.1| bifunctional biotin ligase/biotin operon repressor [Corynebacterium
           efficiens YS-314]
          Length = 272

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 120/249 (48%), Gaps = 16/249 (6%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASC--QTAGRGRRDNKWISDKGN- 65
             PY+ R ++  T  STN + +     G     W VA+   Q  GRGR    W + +G+ 
Sbjct: 27  HGPYT-RVDYTPTTGSTNGDLLDADREG--APDWTVATTDYQDRGRGRLGRPWTAPEGSQ 83

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAG 123
            +++ L        + L  +  A  +A+   + S    G D V +KWPND+L+  RK+ G
Sbjct: 84  AIFSVLFRPRPSLLEHLGTVPLACGLALIDTLRS---FGVDGVGLKWPNDVLINGRKLCG 140

Query: 124 ILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGGCIDLKDIFSLLFQDVAR 182
           IL+E  +L     AVV+GIG+N+     + P P  TSL  EG  ID  D+   +   +  
Sbjct: 141 ILVEATSLDT-TPAVVIGIGINLNLTTGELPVPHATSLALEGYDIDRTDLLIRVLGHIHA 199

Query: 183 VLDLWKKDTGREEIMNLWRCFACGIG-DLITIKLSYGSILGRFVGVDDFGYLLLEEKKGC 241
            +  W++  G    ++ +R     +G D+  I      +LG  VG+ + G L++ +++G 
Sbjct: 200 RISDWER--GETVWLDDYRAVCSSLGQDVRVILPGDRELLGVAVGIAEGGQLMVRDEEGT 257

Query: 242 VRQIFTGDI 250
           +  +  G++
Sbjct: 258 IHTLSAGEV 266


>gi|189347902|ref|YP_001944431.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium limicola DSM 245]
 gi|189342049|gb|ACD91452.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobium limicola DSM 245]
          Length = 330

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 4/153 (2%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
           + +     STN E  K A  G      IVA  Q AGRGR    W+S  G NLY SL+L  
Sbjct: 84  FHYQKETESTNLEAKKLAAEGVPEGAVIVADSQRAGRGRLGRTWVSPAGKNLYFSLILRP 143

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           S+    +  ++  +A A+   I    P   D  +KWPNDIL   RK+ G+L E  +    
Sbjct: 144 SVVSLRIPQITLLVAAAIHQAICDLFPC-IDTGVKWPNDILAGGRKLCGVLCEMQSEPGM 202

Query: 135 LQAVVVGIGLNVKH--CPVDTPYPVTSLQREGG 165
              VVVGIG+NV     P +     TSL+ E G
Sbjct: 203 THFVVVGIGINVNQDDFPEELRDKATSLKLETG 235


>gi|146281153|ref|YP_001171306.1| biotin--protein ligase [Pseudomonas stutzeri A1501]
 gi|145569358|gb|ABP78464.1| BirA bifunctional protein [Pseudomonas stutzeri A1501]
          Length = 315

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 99/223 (44%), Gaps = 12/223 (5%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            FD + STN E + R LS       +VA  Q+AGRGRR   W+S  G NLY SL      
Sbjct: 80  LFDALDSTNAEAL-RLLSTGRAPFLVVAESQSAGRGRRGRHWVSPFGQNLYCSLAFKVHG 138

Query: 77  SKDSLTLLSFAIAVA-MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
               L+ +S  + +A M+++    LP      +KWPND+ V  RKI GIL+E        
Sbjct: 139 GTRQLSGMSLVVGLAVMQTLRGMGLP---QAGLKWPNDVYVDGRKIGGILLELTGDPADE 195

Query: 136 QAVVVGIGLNVKHCP---VDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             V+ GIG+NV       +D P+  TSL+   G +D  ++       +   LD      G
Sbjct: 196 CHVIAGIGINVNMADAKGIDQPW--TSLREWIGMVDRNELLLTFAATLKTYLDR-HLAAG 252

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLL 235
              +   W       G   T+      + G  +GVD  G L L
Sbjct: 253 FASLREEWEAAHIWQGQSCTLSTGAHELSGTVLGVDPQGGLRL 295


>gi|300871730|ref|YP_003786603.1| hypothetical protein BP951000_2126 [Brachyspira pilosicoli 95/1000]
 gi|300689431|gb|ADK32102.1| bifunctional protein, putative [Brachyspira pilosicoli 95/1000]
          Length = 260

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 119/240 (49%), Gaps = 28/240 (11%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSG---DLGNLWIVASCQTAGRGRRDNKWISDKG-NLY 67
           Y    + F+++ STN + ++   +G   + G+++I A  QTAG+G   NKW+S+    L+
Sbjct: 20  YGRNLKIFESLESTNTKMIEDLNNGIKLEEGSVYI-ALKQTAGKGTHGNKWVSNNDLGLW 78

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIE 127
            S+L+     K++L   SF   +A+   +     V   VK  WPND+LV  RKI+G LI+
Sbjct: 79  FSVLVYTPFKKEAL---SFLPGIALSKCLREKYNVNAHVK--WPNDVLVKNRKISGTLIQ 133

Query: 128 TLNLKNGLQAVVVGIGLNVKHC----PVDTPYPVTSLQREGGC-IDLKDIFSLL---FQD 179
              ++N   A ++G G+N+ H     P D  +  TSL  E    ++L + +  L   F++
Sbjct: 134 VTPIENR-NACIIGTGVNLYHTKEDFPSDIEHKATSLYMETNLKVELSEFYKELITCFEE 192

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
           V          T  +++   +R ++  IG +I  K     I      + + GYL++E  K
Sbjct: 193 VY---------TSEKKLSEYFREYSNMIGRVIKAKKDDEEITALVKDITEEGYLIVEVNK 243


>gi|271962869|ref|YP_003337065.1| biotin--acetyl-CoA-carboxylase ligase [Streptosporangium roseum DSM
           43021]
 gi|270506044|gb|ACZ84322.1| biotin--acetyl-CoA-carboxylase ligase [Streptosporangium roseum DSM
           43021]
          Length = 274

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 111/238 (46%), Gaps = 21/238 (8%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW-ISDKGNLYASLLLIDSISKDSLT 82
           STN +  +    G      ++A  Q AGRGR    W +  +  L  S+LL          
Sbjct: 41  STNADLAQAVRDGARQGAVLIAEAQFAGRGRLGRVWSVPPRSGLTFSMLLRPEPPPTRQG 100

Query: 83  LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
            L   + +A+ S +     V  DV++KWPND+L+ +RK+AG+L E ++      AV++G+
Sbjct: 101 WLPLLVGLAVASAVRKLAEV--DVRLKWPNDLLIGERKLAGVLAERVD-----SAVIMGV 153

Query: 143 GLNVK----HCPVDTPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIM 197
           GLNV       PV+T    TSL   E  C+D   +   + +++      W ++ G  +  
Sbjct: 154 GLNVSVRADELPVET---ATSLAVEEAACVDRDPLIRAVLREIELHYREWSQEDGDADAC 210

Query: 198 NLWRCF---ACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
            L   +   +  +G  + ++L    +L G   G+D  G+LL+   KG    +  GD+ 
Sbjct: 211 GLRAAYLGLSATVGREVRVELPGERVLTGLATGIDQAGHLLV-RSKGEEHTLSAGDVV 267


>gi|332533465|ref|ZP_08409328.1| biotin-protein ligase / biotin operon repressor [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037012|gb|EGI73470.1| biotin-protein ligase / biotin operon repressor [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 330

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 116/243 (47%), Gaps = 16/243 (6%)

Query: 17  EFFDTISSTNDECMKRALSG---DLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLL 72
           E    I STN E M+R  +    + G + IVA  Q AGRGRR   W S  G NLY S   
Sbjct: 88  EVHPIIDSTNSELMRRIQAKTTLESGTV-IVAEMQQAGRGRRGRVWQSPFGANLYYSYFW 146

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLK 132
                  +   +S A+ +A+   I +   V  DV++KWPNDI + ++K+AG+L+E     
Sbjct: 147 RLDDGLQAAMGVSIAVGLAVYDAIKALYQV--DVELKWPNDIYINKQKLAGVLVELDGQP 204

Query: 133 NGLQAVVVGIGLNVK-----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
            G   +V+GIG+N++        +D  +  T L +    +D   + + L   + R L  +
Sbjct: 205 QGPCQLVIGIGINLQMPESFSQHIDQAW--TDLNQHTQKLDKNQLVASLTHHLERRLAQY 262

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           ++ TG + +   W       G+ + +   + S  G   G+D  G + + +  G V+  + 
Sbjct: 263 RQ-TGLQAMYEQWNSLNAFAGEYVELNTGHRSWRGICEGIDPQGGIRIRQ-DGEVKSYYG 320

Query: 248 GDI 250
           G++
Sbjct: 321 GEV 323


>gi|238898677|ref|YP_002924358.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase;
           transcriptional repressor of biotin synthesis (BirA
           family) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466436|gb|ACQ68210.1| bifunctional: biotin-[acetylCoA carboxylase] holoenzyme synthetase;
           transcriptional repressor of biotin synthesis (BirA
           family) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 318

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 104/210 (49%), Gaps = 7/210 (3%)

Query: 44  VASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPV 102
           VA  QTAGRGRR  +W+S  G NLY S+         +   LS  I + +  V+ +    
Sbjct: 108 VAEHQTAGRGRRGREWVSPFGQNLYLSMFWRLEKGTAAAVGLSLVIGIVITQVLRNL--G 165

Query: 103 GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV--TSL 160
           G D+++KWPND+    +K+AG+L+E L  K     V++G+G+N+ +   +       + L
Sbjct: 166 GIDIRVKWPNDLYYRDKKLAGVLVELLGKKFKPAQVIIGMGININNPSSNKGIEQNWSHL 225

Query: 161 QREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSI 220
           +  G  ID   + +LL  ++   L  ++K TG    ++ W      +   + + +    I
Sbjct: 226 KEAGITIDRNKLTALLLSELRSQLIEFEK-TGLSTFISKWHELDNYLNRPVKLIVGDQQI 284

Query: 221 LGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G   G+D  G LLL E +G ++    GDI
Sbjct: 285 QGIARGIDQHGGLLL-ETEGGIKTYQVGDI 313


>gi|163784531|ref|ZP_02179391.1| birA [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880197|gb|EDP73841.1| birA [Hydrogenivirga sp. 128-5-R1-1]
          Length = 246

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 85/176 (48%), Gaps = 28/176 (15%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLID 74
           Y FF+ I STN+         + G + +VA  QTAG+GR+  KW+S KG  +Y S+LL  
Sbjct: 11  YIFFEEIDSTNNYLKNNEF--EEGTV-VVAETQTAGKGRKGRKWVSIKGKGIYFSILLKP 67

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            I    +   S    +A+   I   L      KIKWPNDI +  +K AGIL ET    N 
Sbjct: 68  KIPVSEILRFSLIFPLAVHKTI---LDFEIQAKIKWPNDIYINGKKTAGILTETDIEGNE 124

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +   VVGIG+N+ H                   DLK+I     QD+A  L + KK+
Sbjct: 125 INKAVVGIGININHV----------------INDLKEI-----QDIATSLSIEKKE 159


>gi|73662597|ref|YP_301378.1| biotin-acetyl-CoA carboxylase ligase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495112|dbj|BAE18433.1| putative Biotin-acetyl-CoA carboxylase ligase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 323

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 124/259 (47%), Gaps = 23/259 (8%)

Query: 5   LSECQNPYSFRY-EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK 63
           +   Q+ + F + + FD + ST     K+ L G+     I++  QT G+GR +  W S K
Sbjct: 73  MPTIQSQHLFEHVDVFDQVESTQ-LLAKQKLVGNTDTFLILSDEQTKGKGRFNRPWASAK 131

Query: 64  GN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIA 122
           G  L+ S++L   +  D++T  +  +A+ +R  I       +DV +KWPNDI +  +K+ 
Sbjct: 132 GKGLWMSIVLRPDVPFDTITKFNLFMALGIRDAIQQF--SKSDVSVKWPNDIYINNQKVC 189

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHCPVD----TPYPVTSLQ-REGGCIDLKDIFSLLF 177
           G L E +   +G++AV+ GIG+N+   P D         TS++  +   ++  D   +L 
Sbjct: 190 GFLTEMVANSDGIEAVICGIGINMNQEPSDFTGELAQKATSIRIHKKDKVNRYDFLEVLI 249

Query: 178 QDVARVLDLWKKD---TGREEIM---NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
             +      + K+   + R+E +   N+W        + +  K       G  + +DD G
Sbjct: 250 SQIEYRYKQFIKEPFSSIRDEYIATSNIWHKQLRFTENNVQFK-------GEAIDIDDNG 302

Query: 232 YLLLEEKKGCVRQIFTGDI 250
           +L++ ++     Q+ + DI
Sbjct: 303 FLIVLDENKQQHQLMSADI 321


>gi|147919954|ref|YP_686292.1| biotin--(acetyl-CoA-carboxylase) synthetase [uncultured
           methanogenic archaeon RC-I]
 gi|110621688|emb|CAJ36966.1| biotin--(acetyl-CoA-carboxylase) synthetase [uncultured
           methanogenic archaeon RC-I]
          Length = 319

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 120/258 (46%), Gaps = 32/258 (12%)

Query: 11  PYSFRYEF-----------FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKW 59
           P+  RY             F+   ST+    + A  G      ++A  QT G+GR   KW
Sbjct: 66  PFEVRYGLQTRLIGSKIVHFNVTGSTHLVARQLAERGIEEGTVVIAETQTRGKGRLGRKW 125

Query: 60  ISDKGNLYASLLL---IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILV 116
            + +G ++ +++L   ID +   S+TL+      A  SV  +   +G +  IKWPND+LV
Sbjct: 126 SARQGGIWMTVVLKPKIDPMHAASITLM------AAVSVTKALRELGLEAVIKWPNDVLV 179

Query: 117 FQRKIAGILIETLNLKNGLQAVVVGIGLNVKH-CPVDTPYPVTSLQREGGCID----LKD 171
             +KI GIL E     + +  +++  G+NV +  P+D     T+    G  +D     + 
Sbjct: 180 NGKKICGILTEMSAETDMVNFIILSAGINVNNEVPLDI--ATTARAELGHKVDRLKLAQS 237

Query: 172 IFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFG 231
           I   L +D A +     ++ G   I+  WR ++  +G  + +     +I G    VDD G
Sbjct: 238 ILEELDEDYATL-----REQGFTPILWNWRRYSDTLGRPVEVTYQGEAIRGIAQDVDDAG 292

Query: 232 YLLLEEKKGCVRQIFTGD 249
            LL++   G VR+I +GD
Sbjct: 293 SLLVKLADGSVRKIVSGD 310


>gi|311693254|gb|ADP96127.1| biotin-protein ligase [marine bacterium HP15]
          Length = 321

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 111/231 (48%), Gaps = 14/231 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
            D + STN E +++  +G  G   ++A CQT+GRGRR   W S +G NLY S+ L     
Sbjct: 85  LDEVDSTNAEVIRQITAGSKGVPVVIADCQTSGRGRRGRVWQSPRGENLYLSMGLTFHGG 144

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL-NLKNGLQ 136
              L  LS  + VA+ + +   L V  +V +KWPNDI +   K+ GIL+E    L+ G+ 
Sbjct: 145 FGVLDGLSLVLGVAVANAL-ERLGV-PEVGLKWPNDIFLPDGKLGGILVELQGELEEGVV 202

Query: 137 AVVVGIGLNVKHCPVD-TPYPVTSLQREGGCIDLK----DIFSLLFQDVARVLDLWKKDT 191
            V+ GIGLNV     D    P +SL R   C  ++     I   +   V   + L+  D 
Sbjct: 203 QVIAGIGLNVHMSRADGVDQPWSSLAR--ACPQVEWSRSQIGGAIIDAVFDAVALF-SDI 259

Query: 192 GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCV 242
           G  +    W+     +G   ++K   G + G   G+DD G   +  + G V
Sbjct: 260 GFADFRESWQRRDVFMGK--SLKARGGDVEGVGCGIDDAGNYQIRTENGLV 308


>gi|307329369|ref|ZP_07608532.1| biotin/acetyl-CoA-carboxylase ligase [Streptomyces violaceusniger
           Tu 4113]
 gi|306885037|gb|EFN16060.1| biotin/acetyl-CoA-carboxylase ligase [Streptomyces violaceusniger
           Tu 4113]
          Length = 271

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 108/255 (42%), Gaps = 33/255 (12%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLID 74
           +E      STN + + RA +G      +VA  QTAGRGR D  W +  +  L+ S+LL  
Sbjct: 20  FEVVQATGSTNTDLVTRARAGAPEGAVLVAEEQTAGRGRLDRAWTAPARSGLFFSILLRP 79

Query: 75  S---ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIE 127
           +   +  +    L     VA    ++ T   G D  +KWPND+LV     +RK  GIL E
Sbjct: 80  ADAGVPTERWGWLPLLAGVASARALSRT--AGVDTALKWPNDLLVTVAGEERKFGGILAE 137

Query: 128 TLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSL----LFQDVARV 183
                    AVV+G+GLNV     + P P        G + L D  S     L + V R 
Sbjct: 138 RAG-----DAVVIGMGLNVSLRADELPVPTA------GSLALADAVSTDRDPLLRAVLRS 186

Query: 184 LDLW-------KKDTGREEIMNLWRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLL 235
           +  W       + D G   +   +      +G  +  +L  G   +G  V VD  G L+L
Sbjct: 187 IAQWYGEWCRFEGDPGASGLQETYAAGCATLGRQVRAELPGGRERVGEAVAVDGDGRLVL 246

Query: 236 EEKKGCVRQIFTGDI 250
             + G    +  GDI
Sbjct: 247 ATEGGVQEPVSAGDI 261


>gi|160885109|ref|ZP_02066112.1| hypothetical protein BACOVA_03107 [Bacteroides ovatus ATCC 8483]
 gi|156109459|gb|EDO11204.1| hypothetical protein BACOVA_03107 [Bacteroides ovatus ATCC 8483]
          Length = 252

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 102/213 (47%), Gaps = 24/213 (11%)

Query: 43  IVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTL 100
           IVA  QT+GRG+R N W SD G   L+++++  + +      L+S  I++A++  + +  
Sbjct: 40  IVADFQTSGRGQRGNSWESDPGKNLLFSTVIFPEFLEARRQFLISQIISLAIKEELDT-- 97

Query: 101 PVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKH--CPVDTPYPVT 158
              +D+ IKWPNDI   ++KI G+LIE   +   +   + GIG+N+         P PV+
Sbjct: 98  -YTSDISIKWPNDIYWKEKKICGMLIENDLMGRNINQSIAGIGININQEIFHSSAPNPVS 156

Query: 159 SLQREGGCIDLKDIFSLLFQDVARVLDLWKK-DTGREEIMNLWRCFACGIGD-------L 210
            LQ  G   DL  I   +   +     L KK DT            AC  G+       +
Sbjct: 157 LLQITGEEHDLFKILKNIMLRIQSYYSLLKKGDTT---------SIACQYGESLFRREGM 207

Query: 211 ITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
              K + G  L R V V+  G L+LE++K   R
Sbjct: 208 HQYKDANGEFLARIVCVEPEGRLILEDEKLTKR 240


>gi|242242737|ref|ZP_04797182.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis W23144]
 gi|242233873|gb|EES36185.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis W23144]
          Length = 323

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 115/246 (46%), Gaps = 22/246 (8%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E + T+ ST  +  KRAL G+     I++  QT GRGR +  W S KG  L+ SL+L   
Sbjct: 86  EVYQTVDSTQLKA-KRALVGNNDTFLILSDEQTEGRGRFNRNWESSKGKGLWMSLVLRPD 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +   +  IA+ +R  I         V IKWPNDI +  +KI G L E +   + +
Sbjct: 145 VPFSMIPKFNLFIALGIRDAIQQF--SNERVTIKWPNDIYIGNKKICGFLTEMVANYDAI 202

Query: 136 QAVVVGIGLNVKHCPVDTPYPV----TSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKD 190
           +A++ GIG+N+ H   D    +    TS++      I+     + L   +    D +   
Sbjct: 203 EAIICGIGINMNHVESDFDEDIKDKATSIRMHSDSKINRYTFLTTLLTQIIHRFDQFLHQ 262

Query: 191 TG---REEIM---NLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           T    REE +   N+W          +    +    LG  + +D  G+L++++++G + +
Sbjct: 263 TFESIREEYIHATNIWHR-------QLKFTENDHQFLGEAIDIDSDGFLIVKDEEGQLHR 315

Query: 245 IFTGDI 250
           + + DI
Sbjct: 316 LMSADI 321


>gi|88607177|ref|YP_505452.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma phagocytophilum
           HZ]
 gi|88598240|gb|ABD43710.1| biotin--acetyl-CoA-carboxylase ligase [Anaplasma phagocytophilum
           HZ]
          Length = 241

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 108/205 (52%), Gaps = 20/205 (9%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTL 83
           STN + M+ A  G      IVA  Q++G GRR  +W S KGNLY S++L + +   +L+ 
Sbjct: 14  STNLDAMELAEQGADSGTVIVADEQSSGVGRRGRQWYSPKGNLYFSIVLKEHLHVPTLSF 73

Query: 84  L-SFAIAVAMRSVIA-----STLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
             + ++ +++  + +     S +P    +K KWPND+ V  +KI+G+L+++    + +  
Sbjct: 74  ACALSVGISLEQIFSQHIENSKIPT---LKYKWPNDVFVDNKKISGVLLQSKVQGHSIPW 130

Query: 138 VVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLK----DIFSLLFQDVARVLDLWKKDTGR 193
           +V G+G+N+ H      +P  +        DLK    ++  ++ +++A++LD++   +G 
Sbjct: 131 IVCGVGVNILH------HPEYATSISSYIPDLKLTNIELLDVVLENLAKLLDIYSA-SGF 183

Query: 194 EEIMNLWRCFACGIGDLITIKLSYG 218
             + +LW   A  +   + I  S G
Sbjct: 184 APLRSLWLKKAHALNSHVCITTSDG 208


>gi|149179396|ref|ZP_01857952.1| Biotin--acetyl-CoA-carboxylase ligase [Planctomyces maris DSM 8797]
 gi|148841764|gb|EDL56171.1| Biotin--acetyl-CoA-carboxylase ligase [Planctomyces maris DSM 8797]
          Length = 268

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 119/251 (47%), Gaps = 24/251 (9%)

Query: 17  EFFDTISSTND-----ECM---KRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYA 68
           ++F++++STN       C+      L        ++   QTAGRGR  N W S +G L  
Sbjct: 22  DYFESLASTNSWALSTHCIPVGSSTLRETSHPSLVLTGNQTAGRGRGSNSWWSPEGGLTF 81

Query: 69  SLLL---IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           SL++   +  I  +  +L++ A  +A+   +   LP    +++KWPND+ + Q+K+AGIL
Sbjct: 82  SLVVDTRVLQIQLEQQSLIALATGLAVCETLEKHLP-DYSLQLKWPNDVYLQQKKVAGIL 140

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDV 180
           +ET   + GL  VV+G+G+N+ +  +     + S      +  G    L      L   +
Sbjct: 141 VETAASQPGL--VVIGVGVNLNNSFLSAEAELQSRGTSLYETTGQKFSLPSTLIDLINGI 198

Query: 181 A-RVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
             R+ D+  K +     M  WR F    G  I I        G  + +DD GYL+L+ + 
Sbjct: 199 ENRLYDVTGKTSS---FMADWRRFCLLTGRAIRINTGLEVKQGTCLEIDDQGYLILQTET 255

Query: 240 GCVRQIFTGDI 250
           G  R I +G I
Sbjct: 256 GLER-IISGTI 265


>gi|110637031|ref|YP_677238.1| biotin--[acetyl-CoA-carboxylase] ligase [Cytophaga hutchinsonii
           ATCC 33406]
 gi|110279712|gb|ABG57898.1| biotin--[acetyl-CoA-carboxylase] ligase [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 254

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 116/239 (48%), Gaps = 21/239 (8%)

Query: 17  EFFDTISSTNDEC-----MKRALSGDLGNLWIVASCQTAGRGRRDNKWIS--DKGNLYAS 69
            F  +  STN E       ++A++G    L ++ + QTAGRG++ N W+S  D    ++ 
Sbjct: 16  HFLPSCHSTNTEASLLIRAQKAVNG----LIVITNEQTAGRGQQGNSWLSKADSNLTFSV 71

Query: 70  LLLIDSIS-KDSLTL---LSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGIL 125
           +   + +  KDS  L    S +IA  +  ++   +     VK+KWPNDIL+  +K+ GIL
Sbjct: 72  IFFPEKLHLKDSFYLNIVSSLSIAKTVDELVPENI-----VKVKWPNDILLNNKKVCGIL 126

Query: 126 IETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLD 185
           IE +     + AVV+GIG+NV H   + P+             L+++F+ + +++     
Sbjct: 127 IENMLRGEHIHAVVMGIGVNVNHSDGNLPFAGAMSSEAAKTFHLQEVFTRICENLEPYYL 186

Query: 186 LWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           + ++     E+  L+     G+ +      S G+  G    V   G L +E++ G ++Q
Sbjct: 187 MLEQGL-FAELDALYLQNLYGLNEKKHFSDSEGNFTGTIQAVLPGGLLQVEKESGVIKQ 244


>gi|324998344|ref|ZP_08119456.1| birA, biotin-(acetyl-CoA-carboxylase) ligase [Pseudonocardia sp.
           P1]
          Length = 289

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 99/243 (40%), Gaps = 9/243 (3%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLL--ID 74
           +   +  STN + +  A  G      ++A  Q  GRGR D  W S  G      +L   +
Sbjct: 40  DVVGSTGSTNADLLAEAGRGAPDRSVLIAEEQVRGRGRLDRTWTSRPGAALTMSVLWRPE 99

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR--KIAGILIETLNLK 132
            +  D L  L     VA+   IA   P      +KWPND+L      K AGIL E   + 
Sbjct: 100 GVPADRLGWLPMLAGVALIDAIAELAP-DLPAALKWPNDLLAGPSLGKAAGILAEMTAVS 158

Query: 133 NGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
            G   VV+GIGLNV     D P+  TSL   G      ++ + L   + R    W+   G
Sbjct: 159 GGGPGVVLGIGLNVSTPSTDLPWGATSLAAHGLAATRSEVATTLLAHLYRREADWRDAGG 218

Query: 193 REEIMNL---WRCFACGIGDLITIKLSYG-SILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
             E   L   +R     +G  + ++   G  ++G    VD  G LL+    G    +  G
Sbjct: 219 DAEASGLRRDYRSRCASLGARVRVEKPGGDQLIGMAEDVDPQGRLLVHPDGGQRVAVAAG 278

Query: 249 DIF 251
           DI 
Sbjct: 279 DIV 281


>gi|193213651|ref|YP_001999604.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobaculum parvum NCIB
           8327]
 gi|193087128|gb|ACF12404.1| biotin/acetyl-CoA-carboxylase ligase [Chlorobaculum parvum NCIB
           8327]
          Length = 329

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 102/235 (43%), Gaps = 5/235 (2%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
            + + STN + +  A  G      +VA  QT GRGR    W+S  G NLY S++L   + 
Sbjct: 87  LEQVDSTNVKALALAREGAAEGTVVVADSQTGGRGRMRRAWVSPPGVNLYCSIVLRPPLP 146

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
              +  +    A A+   +    P      IKWPND++V  RK+ GIL E  +  +    
Sbjct: 147 SVRVPEIPLVAAAAIHGAVTQECPE-LQAFIKWPNDLIVAGRKVCGILCEMESEPDFTHF 205

Query: 138 VVVGIGLNVKHCPVDTPYP--VTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
           VVVG GLNV   PV        TSL  E G  +    + + +     R+   W  +    
Sbjct: 206 VVVGFGLNVNLDPVPDELQGIATSLAIETGRQVSRARLLAAILNRFERLYREWLDEEDLG 265

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
            ++      A   G  + I+     + G   G+   G+LLL ++ G V  + +G+
Sbjct: 266 SLLPALEEHAWLKGRALQIEQFNRVLTGTEAGLSPQGHLLLRQEDGTVVPVASGE 320


>gi|269963591|ref|ZP_06177915.1| biotin--protein ligase [Vibrio harveyi 1DA3]
 gi|269831675|gb|EEZ85810.1| biotin--protein ligase [Vibrio harveyi 1DA3]
          Length = 321

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 107/241 (44%), Gaps = 11/241 (4%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG- 64
           ++ Q       E    I STN   + +    D G +  +A  Q  GRGRR  +WIS  G 
Sbjct: 71  TQLQAKVETPIELISVIDSTNQYLLDKVNESDKGRV-CLAEYQAKGRGRRGRQWISPFGT 129

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAG 123
           NLY S+         +   LS  + +A    I S   +G D VK+KWPNDI    +K+AG
Sbjct: 130 NLYLSMYWRLDAGMAAAMGLSLVVGIAAVEAIES---LGIDGVKLKWPNDIYYQDKKLAG 186

Query: 124 ILIETLNLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQD 179
           IL+E      G   +V+G+GLN+        +D P+   +   +G  ID   +   L + 
Sbjct: 187 ILVEMSGQAGGAAHLVIGMGLNIGMPDMQPEIDQPWTTLNQVSDGVLIDRTQLAIKLIEH 246

Query: 180 VARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKK 239
               L+ ++   G    ++ W      IG  + + +    I G   G+D  G ++LE + 
Sbjct: 247 WKNALEEYEM-AGLAGFVDRWNRLDNFIGRSVKLLMGPREIHGVVKGIDQQGGVVLETEN 305

Query: 240 G 240
           G
Sbjct: 306 G 306


>gi|193214348|ref|YP_001995547.1| biotin/acetyl-CoA-carboxylase ligase [Chloroherpeton thalassium
           ATCC 35110]
 gi|193087825|gb|ACF13100.1| biotin/acetyl-CoA-carboxylase ligase [Chloroherpeton thalassium
           ATCC 35110]
          Length = 265

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 15/223 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSIS 77
           + T SSTN+   K A SG      I+A  QT G+GR ++ W+S+ G NL  +++L  +  
Sbjct: 29  YHTASSTNEIGHKLARSGAFDGTLILAETQTRGKGRGEHVWLSNPGENLTFTIVLRPNCK 88

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
               T+LS   ++A+   I          +IKWPND+L+  +K+ G+L+E+         
Sbjct: 89  PAQTTVLSLMGSLAIADAIYKMH--NKKPEIKWPNDVLLGGKKVCGLLLESAISGEQADY 146

Query: 138 VVVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFS--LLFQDVARVLD---LWKKD 190
           V++GIGLNV  K  P +     TSL+     +     FS   +  +VAR ++   L  K 
Sbjct: 147 VLLGIGLNVNQKVFPKEIESVATSLR-----LAANRAFSRAAVLSEVARHVEKRYLQFKA 201

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
              + I+  W+ +   +G  IT   +     G  + +DD+GYL
Sbjct: 202 NNSQSILEDWKAYCTMLGKKITFLHNGMERTGVAIDIDDYGYL 244


>gi|118576521|ref|YP_876264.1| biotin-(acetyl-CoA carboxylase) ligase [Cenarchaeum symbiosum A]
 gi|118195042|gb|ABK77960.1| biotin-(acetyl-CoA carboxylase) ligase [Cenarchaeum symbiosum A]
          Length = 323

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 116/243 (47%), Gaps = 15/243 (6%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F+++ ST    ++ A         ++A  QTAGRGR   +WIS  G ++ S++   
Sbjct: 89  RIHYFESLDSTQAYALRIAGEKREDGAVVIARRQTAGRGRMGRRWISPHGGVWLSVITRP 148

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
           +    + T+L  A +VA+   I +    G   ++KWPND+LV   K+AGIL++      G
Sbjct: 149 ARGGPN-TVLPLAASVALAEAIEAAA--GVRPELKWPNDVLVNGGKVAGILVDASVSPGG 205

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDT--- 191
           +   V+G+G+N     +D      S +       L D        V   L   ++ T   
Sbjct: 206 VDHAVIGVGIN-----LDVKAGEISRRTGRAAASLSDHADAAPAIVREFLSALERATDSL 260

Query: 192 ---GREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
              G   I++ W   +C +G  I+++   G++ GR + VD  G L+L +  G  R++ +G
Sbjct: 261 DAGGSAGILSRWTGLSCTVGRNISVETGGGTVRGRALCVDPDGALVL-DCNGDRRRVVSG 319

Query: 249 DIF 251
           D+ 
Sbjct: 320 DLV 322


>gi|328676636|gb|AEB27506.1| Biotin-protein ligase / Biotin operon repressor [Francisella cf.
           novicida Fx1]
          Length = 260

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 5/141 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
           + E+F TI STND  +    +      ++    QT GRGRR +KWIS DK N+Y++L   
Sbjct: 19  KVEYFPTIDSTNDYFLATNFTHKYHFCYV--DKQTKGRGRRGDKWISEDKDNIYSTLAFH 76

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
            + +  + +L S  IA+ + + I   +P      +KIK PNDI    +K+AGILIET N+
Sbjct: 77  CNFAITADSLKSVKIALGVLAAIKKYIPKNLQPYLKIKLPNDIYFQDQKLAGILIETKNI 136

Query: 132 KNGLQAVVVGIGLNVKHCPVD 152
           K     +++G+G+NV     D
Sbjct: 137 KKDSFDIIIGVGINVNMTNTD 157


>gi|255318629|ref|ZP_05359860.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter
           radioresistens SK82]
 gi|262379145|ref|ZP_06072301.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter
           radioresistens SH164]
 gi|255304311|gb|EET83497.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter
           radioresistens SK82]
 gi|262298602|gb|EEY86515.1| biotin-[acetyl-CoA-carboxylase] ligase [Acinetobacter
           radioresistens SH164]
          Length = 248

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 105/215 (48%), Gaps = 13/215 (6%)

Query: 23  SSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLT 82
           +STND+  + A  G + +  + ++ QT GRG+    W+S +GN+Y S LL    + D   
Sbjct: 29  TSTNDDVREIAQKG-IKSALVCSARQTQGRGQHQRPWVSPEGNIYLSTLLQTGTAIDGRL 87

Query: 83  LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
            L  A+ +       S  P+   +++KWPND+   Q K  GIL+E +      Q  ++G+
Sbjct: 88  ALEIALNILQ---CPSLQPL--KLQVKWPNDLYSHQGKWGGILVEPIT----AQQAIIGV 138

Query: 143 GLNVKHCPVDTPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWR 201
           G+N+          VTSL + G    DL  + + L+  + +  + +    G  ++ N + 
Sbjct: 139 GINIYQIHDVLDQSVTSLTQLGLAQTDLMQLIAELYHAIQQAGEWFSH--GSHQLANRFN 196

Query: 202 CFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLE 236
             A  + D++  +   G   G+F+G+ + G + L+
Sbjct: 197 HHAAFLNDMVYFEHHQGIAEGKFIGIQNDGAVTLQ 231


>gi|169630705|ref|YP_001704354.1| biotin--acetyl-CoA-carboxylase ligase (BirA bifunctional protein)
           [Mycobacterium abscessus ATCC 19977]
 gi|169242672|emb|CAM63700.1| Possible biotin--acetyl-CoA-carboxylase ligase (BirA bifunctional
           protein) [Mycobacterium abscessus]
          Length = 264

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 119/254 (46%), Gaps = 12/254 (4%)

Query: 4   NLSECQNPYSFRYEFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKW-IS 61
            L++    +  R +  +   STN + + RA +G D+  + ++A  QTAGRGR    W   
Sbjct: 7   TLTDSPGGHWRRIDVVEETGSTNADLVTRAAAGEDIDGVVLLAEHQTAGRGRHGRSWGAP 66

Query: 62  DKGNLYASLLL-IDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
               L  S+ + +  +  D   L+     VA+   +A     G    +KWPND+LV  RK
Sbjct: 67  AHTQLSMSVGIGVGEVPPDRWGLVPLLAGVAIVDAVAEV--SGIQAGLKWPNDVLVDGRK 124

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYP-VTSLQREG-GCIDLKDIFSLLFQ 178
           + GIL E        QA+V+G+GLN      + P P  TSL   G    D  ++   + +
Sbjct: 125 LCGILAEVATPH---QAIVLGLGLNATFAQHELPDPNATSLTILGWADPDRDELARAVLR 181

Query: 179 DVARVLDLWKKDTGREE-IMNLWRCFACGIGDLITIKL-SYGSILGRFVGVDDFGYLLLE 236
           ++   ++ W+   G +E ++  +R  +  +G  +  +L     ++G  VG+ + G L +E
Sbjct: 182 ELGGRIEHWRAARGLDERLLEDYRERSVTLGSRVRAELPGERELVGVAVGLGNDGQLRIE 241

Query: 237 EKKGCVRQIFTGDI 250
              G V  +  GDI
Sbjct: 242 AADGTVTAVTAGDI 255


>gi|49483645|ref|YP_040869.1| BirA bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-CoA-carboxylase] synthetase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257425522|ref|ZP_05601947.1| BirA  synthetase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257428181|ref|ZP_05604579.1| BirA  synthetase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430811|ref|ZP_05607193.1| biotin operon repressor [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433569|ref|ZP_05609927.1| biotin operon repressor [Staphylococcus aureus subsp. aureus E1410]
 gi|257436411|ref|ZP_05612458.1| BirA synthetase [Staphylococcus aureus subsp. aureus M876]
 gi|282904039|ref|ZP_06311927.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus C160]
 gi|282905804|ref|ZP_06313659.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908774|ref|ZP_06316592.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282911035|ref|ZP_06318837.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282914247|ref|ZP_06322034.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919170|ref|ZP_06326905.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924354|ref|ZP_06332028.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958221|ref|ZP_06375672.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|293501273|ref|ZP_06667124.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510234|ref|ZP_06668942.1| biotin operon repressor [Staphylococcus aureus subsp. aureus M809]
 gi|293526829|ref|ZP_06671513.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295427966|ref|ZP_06820598.1| birA [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297591064|ref|ZP_06949702.1| bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon
           transcriptional regulator [Staphylococcus aureus subsp.
           aureus MN8]
 gi|49241774|emb|CAG40465.1| BirA bifunctional protein [includes: biotin operon repressor;
           biotin--[acetyl-CoA-carboxylase] synthetase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257271979|gb|EEV04117.1| BirA synthetase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275022|gb|EEV06509.1| BirA synthetase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278939|gb|EEV09558.1| biotin operon repressor [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281662|gb|EEV11799.1| biotin operon repressor [Staphylococcus aureus subsp. aureus E1410]
 gi|257284693|gb|EEV14813.1| BirA synthetase [Staphylococcus aureus subsp. aureus M876]
 gi|282313741|gb|EFB44134.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316980|gb|EFB47354.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322315|gb|EFB52639.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324730|gb|EFB55040.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282327038|gb|EFB57333.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331096|gb|EFB60610.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282595657|gb|EFC00621.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus C160]
 gi|283790370|gb|EFC29187.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|290920387|gb|EFD97451.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096278|gb|EFE26539.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467178|gb|EFF09696.1| biotin operon repressor [Staphylococcus aureus subsp. aureus M809]
 gi|295128324|gb|EFG57958.1| birA [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297575950|gb|EFH94666.1| bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon
           transcriptional regulator [Staphylococcus aureus subsp.
           aureus MN8]
 gi|312438139|gb|ADQ77210.1| bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon
           transcriptional regulator [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|315195354|gb|EFU25741.1| BirA bifunctional protein [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 323

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 120/247 (48%), Gaps = 24/247 (9%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E +D+I ST     K++L G+  + +I++  QT GRGR +  W S KG  L+ S++L  +
Sbjct: 86  EVYDSIDSTQ-LAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPN 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++   ++  +  IA+ +R  I        +VK+KWPNDI +   K+ G L E +   +G+
Sbjct: 145 VAFSMISKFNLFIALGIRDAIQHF--SQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGI 202

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKK- 189
           +A++ GIG+N+     D      Y  TS+Q  +   +D       L Q++ +  + +   
Sbjct: 203 EAIICGIGINLTQQLEDFDESIRYRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTL 262

Query: 190 --DTGREEIM---NLW-RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
                REE +   N+W R       D            G+ + +D  GYL++ ++ G   
Sbjct: 263 PFSEIREEYIAASNIWNRTLLFTEND--------KQFKGQAIDLDYDGYLIVRDEAGESH 314

Query: 244 QIFTGDI 250
           ++ + DI
Sbjct: 315 RLISADI 321


>gi|755608|gb|AAA92879.1| biotin [acetyl-CoA carboxylase] ligase [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 305

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 101/197 (51%), Gaps = 16/197 (8%)

Query: 63  KGN-LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKI 121
           +GN ++ SL+L   I       L+   AVA+   I     + TD  IKWPNDIL+  +K 
Sbjct: 113 EGNGVWMSLILRPDIPLQKTPQLTLLAAVAVVQGIEEAAGIQTD--IKWPNDILINGKKT 170

Query: 122 AGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPV----TSL-QREGGCIDLKDIFS-- 174
            GIL E    ++ +++V++GIG+NV   P D P  +    TSL Q  G  ID   +    
Sbjct: 171 VGILTEMQAEEDRVRSVIIGIGINVNQQPNDFPDELKDIATSLSQAAGEKIDRAGVIQHI 230

Query: 175 -LLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
            L F+   R  D      G   I  LW  +A GIG  +  +   G+  G+ +G+DD G L
Sbjct: 231 LLCFE--KRYRDYMTH--GFTPIKLLWESYALGIGTNMRARTLNGTFYGKALGIDDEGVL 286

Query: 234 LLEEKKGCVRQIFTGDI 250
           LLE  +G +++I++ DI
Sbjct: 287 LLETNEG-IKKIYSADI 302


>gi|327401594|ref|YP_004342433.1| biotin/acetyl-CoA-carboxylase ligase [Archaeoglobus veneficus SNP6]
 gi|327317102|gb|AEA47718.1| biotin/acetyl-CoA-carboxylase ligase [Archaeoglobus veneficus SNP6]
          Length = 309

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 125/236 (52%), Gaps = 18/236 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSI 76
             + +I STN++  ++        + ++A  QTAGRGRR  +W S++G LY S+ L   +
Sbjct: 87  HHYSSIDSTNEKAKEKQ------GIVVIADRQTAGRGRRGRRWYSEEGGLYFSISLPPHL 140

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           + + L  L+    VA+   ++       + K+KWPND+LV  +K+ G+L E +       
Sbjct: 141 NMEDLPKLTLTTGVAVCEALSF-----ANAKLKWPNDVLVGGKKVCGVLCEVVGEAES-P 194

Query: 137 AVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK-DTGREE 195
           AVVVGIG+NV +   D    + +   E G +  K+IF  +  +  R   L++K  +  EE
Sbjct: 195 AVVVGIGINVTNPIPDELKDIATNLLEFG-VGRKEIFEKVVGNFFR---LYRKLPSDWEE 250

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIF 251
           I   W+  +  +G ++ I+++     G  V +D+ G L+L +  G V +IF+G+ F
Sbjct: 251 IRQRWKELSDTLGRIVEIRVAERLYRGIAVDIDESGALIL-DSNGKVERIFSGECF 305


>gi|15789854|ref|NP_279678.1| biotin acetyl-CoA carboxylase ligase [Halobacterium sp. NRC-1]
 gi|169235575|ref|YP_001688775.1| biotin--[acetyl-CoA-carboxylase] ligase 2 [Halobacterium salinarum
           R1]
 gi|10580250|gb|AAG19158.1| biotin acetyl-CoA carboxylase ligase [Halobacterium sp. NRC-1]
 gi|167726641|emb|CAP13427.1| biotin--[acetyl-CoA-carboxylase] ligase 2 [Halobacterium salinarum
           R1]
          Length = 282

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 118/277 (42%), Gaps = 32/277 (11%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M  + +  Q   S      +T  STND     A +G     +++A  QTAGRGR  N W 
Sbjct: 1   MTVDPAALQRQVSAPVVHRETCPSTNDIARAEARAGATDGTFVIADEQTAGRGRTGNAWA 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVF--- 117
           S  G +++S ++   I+   +  L+ A  +A     AS    G D ++KWPND++V    
Sbjct: 61  SPPGGVWSSTVVRADIAASHVGRLTLAGGLAAADTAAS---FGVDARLKWPNDVVVAAAD 117

Query: 118 ---QRKIAGILIETL------------------NLKNG-LQAVVVGIGLNVKHCP---VD 152
              Q K+ G+L E +                  +  N  +   V+GIG+N    P    D
Sbjct: 118 GSDQSKLCGVLTEAVIDEVPVAGKPVGSVLPETDPANADMSFAVLGIGVNAALDPDSLGD 177

Query: 153 TPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLIT 212
               VT+L+ E G +D   + + L + +   +   +   G ++ +   R  +  +G  + 
Sbjct: 178 LDRAVTTLRAERGAVDPTAVAATLHEHLRTWVSRVQTAGGMDDAVAAVRERSATLGKRVR 237

Query: 213 I-KLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           + +     + G  V +DD G L++E   G    +  G
Sbjct: 238 VTRFDDDPVTGTAVAIDDRGALVVERPDGARVHVTEG 274


>gi|328471073|gb|EGF41979.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Vibrio parahaemolyticus 10329]
          Length = 321

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 108/246 (43%), Gaps = 21/246 (8%)

Query: 6   SECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG- 64
           +  +N  S   E    I STN   +++    D G +  +A  Q  GRGRR  +WIS  G 
Sbjct: 71  TRLKNAISTPVELISVIDSTNQYLLEKVSESDKGRV-CIAEYQAQGRGRRGRQWISPFGT 129

Query: 65  NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGI 124
           NLY S+         +   LS  + +A    I S    G  VK+KWPNDI    +K+AGI
Sbjct: 130 NLYLSMYWRLDAGMAAAMGLSLVVGIAAVEAIESMGIQG--VKLKWPNDIYYQDKKLAGI 187

Query: 125 LIETLNLKNGLQAVVVGIGLNVK----HCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           L+E      G   +V+G+GLN+        +D P+  T+L +    + +        Q  
Sbjct: 188 LVEMSGQAGGAAHLVIGMGLNIGMPDVQPGIDQPW--TTLNQISNEVSIDRT-----QLA 240

Query: 181 ARVLDLWKKDTGREEIMNL------WRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLL 234
            R++D WK      E+  L      W      IG  + + +    I G   G+D  G ++
Sbjct: 241 IRLIDHWKAALEEYELTGLGGFVERWNRLDNFIGRPVKLLMGPREIHGVVQGIDQQGGVV 300

Query: 235 LEEKKG 240
           L+ + G
Sbjct: 301 LKTENG 306


>gi|56707619|ref|YP_169515.1| transcription repressor BirA [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89256863|ref|YP_514225.1| biotin--acetyl-CoA-carboxylase ligase [Francisella tularensis
           subsp. holarctica LVS]
 gi|110670090|ref|YP_666647.1| transcription repressor BirA [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115315244|ref|YP_763967.1| biotin--[acetyl-CoA-carboxylase] ligase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134302445|ref|YP_001122415.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156503037|ref|YP_001429102.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|167009244|ref|ZP_02274175.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. holarctica FSC200]
 gi|187932051|ref|YP_001892036.1| birA-like protein [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|224456689|ref|ZP_03665162.1| birA-like protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254368139|ref|ZP_04984159.1| bifunctional protein, biotin-holoenzyme synthetase; transcriptional
           repressor of biotin synthesis (birA family) [Francisella
           tularensis subsp. holarctica 257]
 gi|254369740|ref|ZP_04985750.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370136|ref|ZP_04986142.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874439|ref|ZP_05247149.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953248|ref|ZP_06557869.1| birA-like protein [Francisella tularensis subsp. holarctica URFT1]
 gi|295313528|ref|ZP_06804121.1| birA-like protein [Francisella tularensis subsp. holarctica URFT1]
 gi|56604111|emb|CAG45110.1| Bifunctional protein, biotin-[acetylCoA carboxylase] holoenzyme
           synthetase; transcriptional repressor of biotin
           synthesis (BirA family) [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144694|emb|CAJ80025.1| Biotin--acetyl-CoA-carboxylase ligase [Francisella tularensis
           subsp. holarctica LVS]
 gi|110320423|emb|CAL08493.1| Bifunctional protein, biotin-[acetylCoA carboxylase] holoenzyme
           synthetase; transcriptional repressor of biotin
           synthesis (BirA family) [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115130143|gb|ABI83330.1| biotin--[acetyl-CoA-carboxylase] ligase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134050222|gb|ABO47293.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|134253949|gb|EBA53043.1| bifunctional protein, biotin-holoenzyme synthetase; transcriptional
           repressor of biotin synthesis (birA family) [Francisella
           tularensis subsp. holarctica 257]
 gi|151568380|gb|EDN34034.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           tularensis FSC033]
 gi|156253640|gb|ABU62146.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|157122699|gb|EDO66828.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187712960|gb|ACD31257.1| birA-like protein [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|254840438|gb|EET18874.1| biotin-acetyl-CoA-carboxylase ligase [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282158776|gb|ADA78167.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 260

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 78/141 (55%), Gaps = 5/141 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
           + E+F TI STND  +    +      ++    QT GRGRR +KWIS DK N+Y++L   
Sbjct: 19  KVEYFPTIDSTNDYFLATNFTHKYHFCYV--DKQTKGRGRRGDKWISEDKDNIYSTLAFH 76

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
              +  + +L S  IA+ + + I   +P      +KIK PNDI    +K+AGILIET N+
Sbjct: 77  CDFAITADSLKSVKIALGVLAAIKKYIPKNLQQYLKIKLPNDIYFQDQKLAGILIETKNI 136

Query: 132 KNGLQAVVVGIGLNVKHCPVD 152
           K     +++G+G+NV     D
Sbjct: 137 KKDSFDIIIGVGINVNMTNTD 157


>gi|82751055|ref|YP_416796.1| bifunctional biotin operon-related protein and
           biotin-acetyl-CoA-carboxylase [Staphylococcus aureus
           RF122]
 gi|82656586|emb|CAI81009.1| bifunctional biotin operon-related protein and
           biotin-acetyl-CoA-carboxylase [Staphylococcus aureus
           RF122]
          Length = 323

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 121/247 (48%), Gaps = 24/247 (9%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E +D+I ST     K++L G+  + +I++  QT GRGR +  W S KG  L+ S++L  +
Sbjct: 86  EVYDSIDSTQ-LAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPN 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           ++   ++  +  IA+ +R  I  +     +VK+KWPNDI +   K+ G L E +   +G+
Sbjct: 145 VAFSMISKFNLFIALGIRDAIQHS--SQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGI 202

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKK- 189
           +A++ GIG+N+     D      +  TS+Q  +   +D       L Q++ +  + +   
Sbjct: 203 EAIICGIGINLTQQLEDFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTL 262

Query: 190 --DTGREEIM---NLW-RCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
                REE +   N+W R       D            G+ + +D  GYL++ ++ G   
Sbjct: 263 PFSEIREEYIAASNIWNRTLLFTEND--------KQFKGQAIDLDYDGYLIVRDEAGESH 314

Query: 244 QIFTGDI 250
           ++ + DI
Sbjct: 315 RLISADI 321


>gi|163846074|ref|YP_001634118.1| biotin--acetyl-CoA-carboxylase ligase [Chloroflexus aurantiacus
           J-10-fl]
 gi|163667363|gb|ABY33729.1| biotin--acetyl-CoA-carboxylase ligase [Chloroflexus aurantiacus
           J-10-fl]
          Length = 283

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 112/246 (45%), Gaps = 20/246 (8%)

Query: 19  FDTISSTNDECMK--RALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLID 74
           +D + ST D   +  + L  D   + IVA  QTAGRGR   +W++  G+  L++  L   
Sbjct: 31  YDRVGSTMDLAREAVQTLPPDALPVLIVADEQTAGRGRLGRRWVAPPGSALLFSLGLHPP 90

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR----KIAGILIETLN 130
           +++    T L +   VA+   I    P+     +KWPND+LV       K AGIL+E   
Sbjct: 91  AVATTMPTTLIWLATVALVETIEQETPL--QAGLKWPNDVLVKTSTGWAKTAGILLEGGW 148

Query: 131 LKNGLQAVVVGIGLNVKHCPVD--TPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLW 187
            KN L   ++G G+N+   P    T YP T+L       ID      +L     R  D W
Sbjct: 149 DKNSLVWAIIGCGININAAPDPQITRYPATALAIAAETAIDRLRFLHMLM----RRYDYW 204

Query: 188 KK---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +       +++   WR     +G  + I      + G  + V+  G L++ E  G +R+
Sbjct: 205 LRRLYSGESDQLWQTWRNRLLTLGQTVHIHTGNDLVYGTAIDVERNGSLIVREPSGTLRR 264

Query: 245 IFTGDI 250
           I +GD+
Sbjct: 265 IESGDV 270


>gi|227824809|ref|ZP_03989641.1| biotin-(acetyl-CoA carboxylase) ligase [Acidaminococcus sp. D21]
 gi|226905308|gb|EEH91226.1| biotin-(acetyl-CoA carboxylase) ligase [Acidaminococcus sp. D21]
          Length = 331

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 110/243 (45%), Gaps = 17/243 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           + D I STND   K AL G       VA  Q+ G+GR    W S  G  L+ SLLL  + 
Sbjct: 84  YEDVIPSTNDLLKKMALQGAPDGTVCVAEEQSVGKGRLARGWFSPYGKGLWFSLLLKPTF 143

Query: 77  ---SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                  +TLL+    V     +      G   +IKWPNDIL+  RK+ GIL E      
Sbjct: 144 LPQEAPKMTLLAAVAVVRAVRELC-----GVKAEIKWPNDILLEGRKLVGILTEMSAEFG 198

Query: 134 GLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKK---- 189
            +  +VVGIG+NV  C   +  P    +      D+ +  +     +A+VLD  +     
Sbjct: 199 HINYLVVGIGINV--CVPQSMVPEALRESAVSIDDVAEKPTDRVALLAKVLDHLETCYET 256

Query: 190 --DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               G   I++ WR ++  +G ++ +     +  G+   +D+ G LL+  + G V ++  
Sbjct: 257 VLKEGFGPILDEWRRYSVTLGRMVKVIAPDTTYTGKAEDIDEEGALLVRRENGHVERVLA 316

Query: 248 GDI 250
           GD+
Sbjct: 317 GDV 319


>gi|222523808|ref|YP_002568278.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus sp. Y-400-fl]
 gi|222447687|gb|ACM51953.1| biotin/acetyl-CoA-carboxylase ligase [Chloroflexus sp. Y-400-fl]
          Length = 276

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 112/246 (45%), Gaps = 20/246 (8%)

Query: 19  FDTISSTNDECMK--RALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLID 74
           +D + ST D   +  + L  D   + IVA  QTAGRGR   +W++  G+  L++  L   
Sbjct: 24  YDRVGSTMDLAREAVQTLPPDALPVLIVADEQTAGRGRLGRRWVAPPGSALLFSLGLHPP 83

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR----KIAGILIETLN 130
           +++    T L +   VA+   I    P+     +KWPND+LV       K AGIL+E   
Sbjct: 84  AVATTMPTTLIWLATVALVETIEQETPL--QAGLKWPNDVLVKTSTGWAKTAGILLEGGW 141

Query: 131 LKNGLQAVVVGIGLNVKHCPVD--TPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLW 187
            KN L   ++G G+N+   P    T YP T+L       ID      +L     R  D W
Sbjct: 142 DKNSLVWAIIGCGININAAPDPQITRYPATALAIAAETAIDRLRFLHMLM----RRYDYW 197

Query: 188 KK---DTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
            +       +++   WR     +G  + I      + G  + V+  G L++ E  G +R+
Sbjct: 198 LRRLYSGESDQLWQTWRNRLLTLGQTVHIHTGNDLVYGTAIDVERNGSLIVREPSGTLRR 257

Query: 245 IFTGDI 250
           I +GD+
Sbjct: 258 IESGDV 263


>gi|254372534|ref|ZP_04988023.1| hypothetical protein FTCG_00096 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570261|gb|EDN35915.1| hypothetical protein FTCG_00096 [Francisella novicida GA99-3549]
          Length = 260

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 78/141 (55%), Gaps = 5/141 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
           + E+F TI STND  +    +      ++    QT GRGRR +KWIS DK N+Y++L   
Sbjct: 19  KVEYFPTIDSTNDYFLATNFTHKYHFCYV--DKQTKGRGRRGDKWISEDKDNIYSTLAFH 76

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
              +  + +L S  IA+ + + I   +P      +KIK PNDI    +K+AGILIET N+
Sbjct: 77  CDFAITADSLKSVKIALGVLAAIKKYIPKNLQQYLKIKLPNDIYFQDQKLAGILIETKNI 136

Query: 132 KNGLQAVVVGIGLNVKHCPVD 152
           K     +++G+G+NV     D
Sbjct: 137 KKDSFDIIIGVGINVNMTNTD 157


>gi|118497167|ref|YP_898217.1| birA-like protein [Francisella tularensis subsp. novicida U112]
 gi|194323465|ref|ZP_03057242.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. novicida FTE]
 gi|118423073|gb|ABK89463.1| birA-like protein [Francisella novicida U112]
 gi|194322320|gb|EDX19801.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella tularensis
           subsp. novicida FTE]
          Length = 260

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 78/141 (55%), Gaps = 5/141 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
           + E+F TI STND  +    +      ++    QT GRGRR +KWIS DK N+Y++L   
Sbjct: 19  KVEYFPTIDSTNDYFLATNFTHKYHFCYV--DKQTKGRGRRGDKWISEDKDNIYSTLAFH 76

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
              +  + +L S  IA+ + + I   +P      +KIK PNDI    +K+AGILIET N+
Sbjct: 77  CDFAITADSLKSVKIALGVLAAIKKYIPKNLQQYLKIKLPNDIYFQDQKLAGILIETKNI 136

Query: 132 KNGLQAVVVGIGLNVKHCPVD 152
           K     +++G+G+NV     D
Sbjct: 137 KKDSFDIIIGVGINVNMTNTD 157


>gi|298372226|ref|ZP_06982216.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacteroidetes oral taxon
           274 str. F0058]
 gi|298275130|gb|EFI16681.1| biotin-[acetyl-CoA-carboxylase] ligase [Bacteroidetes oral taxon
           274 str. F0058]
          Length = 248

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 115/239 (48%), Gaps = 19/239 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVAS-CQTAGRGRRDNKWISDKGN--LYASLLLID 74
           F DT+ STN    +R  +  + N + VA+  Q AGRG+  N W S  G   L++ LL   
Sbjct: 11  FLDTVDSTNTFIARRLQTDIIPNGYCVAADYQRAGRGQAGNVWESASGQNLLFSVLLHTQ 70

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
               D   LLS  ++VA+   +A     G D KIK+PNDIL   +K+AGILIE       
Sbjct: 71  HFPLDRQFLLSKVVSVAIHKFLADR---GIDTKIKYPNDILYGNKKLAGILIENRIAGKQ 127

Query: 135 LQAVVVGIGLNVKHCP-VDTPYPVTSLQR-EGGCIDLKDIFSLLFQDVARVL---DLWKK 189
           +   +VG+GLN+     V+      S+++      D K + + L +++  ++   D+ K 
Sbjct: 128 MTFSIVGVGLNINQTEFVENKATAISIRQITNRTYDTKTLLAELRKEIVTLVADFDIKKA 187

Query: 190 DTGREEIM-NLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIF 246
           DT R+  + +L+R       D      + G I   R V V D G L L  K G  RQ +
Sbjct: 188 DTYRKPYLDHLFRT------DGYYRYEAAGEIFEARAVDVGDDGILRLVTKSGDERQFY 240


>gi|317046434|ref|YP_004114082.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. At-9b]
 gi|316948051|gb|ADU67526.1| biotin/acetyl-CoA-carboxylase ligase [Pantoea sp. At-9b]
          Length = 320

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 107/237 (45%), Gaps = 15/237 (6%)

Query: 21  TISSTND---ECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            I STN    + M + +SGD      +A  Q AGRGRR  +W S  G NLY S+      
Sbjct: 86  VIDSTNQYLLDRMDQLVSGDA----CIAEYQQAGRGRRGRQWFSPFGANLYMSMYWRLEQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
              +   LS  I + M  VI S      DV++KWPND+ +  RK+AGIL+E         
Sbjct: 142 GPAAAMGLSLVIGIVMAEVIQSL--GAKDVRVKWPNDLYLHDRKLAGILVELTGKTGDAA 199

Query: 137 AVVVGIGLNV---KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
            +V+G G+N+               +LQ  G  ID   + + L   +   L L+++D G 
Sbjct: 200 QIVIGAGINLAMRSEGASQINQGWINLQEAGVQIDRNQLSAQLINSLREALPLFERD-GL 258

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              +  W      I   + + +    + G   GVD  G LLLE+ +G V+    G+I
Sbjct: 259 APFIERWDALDNFINRPVKLLIGDREVHGIARGVDKQGGLLLEQ-EGEVKAWVGGEI 314


>gi|301063845|ref|ZP_07204329.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
 gi|300442048|gb|EFK06329.1| biotin--[acetyl-CoA-carboxylase] ligase [delta proteobacterium
           NaphS2]
          Length = 284

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 107/214 (50%), Gaps = 8/214 (3%)

Query: 43  IVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLP 101
           ++A  QT G GR   +W S KG NL  S+LL  +++ D++ +L+   A+A    +     
Sbjct: 63  VIADEQTDGLGRMGRRWFSKKGENLLFSVLLRPTLAPDNVFILTMIFALAGTDALKEV-- 120

Query: 102 VGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVD---TPYPVT 158
            G D  IKWPNDI + Q+K+ G+L E   L   +Q +V+G+GLNV   P +   T Y  +
Sbjct: 121 SGLDAGIKWPNDIYLGQKKLGGVLTEFSVLGESVQYLVLGMGLNVNWKPKEGETTGYMTS 180

Query: 159 SLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGREEIM-NLWRCFACGIGDLITIKLS 216
           S+  E G  +  +++   L   +A       +D   +E++   W   +  +G  + I+  
Sbjct: 181 SVFSESGKRVSREELLVFLLGRLAVYYQGCMEDGKEKELLYKRWNKKSVVLGRPVVIETG 240

Query: 217 YGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              I+G    +D  G L +   +G  ++I  GD+
Sbjct: 241 KERIIGNAAEIDQDGALWVVTSEGEEKRILCGDV 274


>gi|108798275|ref|YP_638472.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium sp. MCS]
 gi|119867371|ref|YP_937323.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium sp. KMS]
 gi|108768694|gb|ABG07416.1| Biotin--acetyl-CoA-carboxylase ligase [Mycobacterium sp. MCS]
 gi|119693460|gb|ABL90533.1| biotin--acetyl-CoA-carboxylase ligase [Mycobacterium sp. KMS]
          Length = 270

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 116/241 (48%), Gaps = 13/241 (5%)

Query: 17  EFFDTISSTNDECMKRALSG-DLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           +  D   STN + + RA +G D+    ++   Q+AGRGR   +W +   +  A  + +D+
Sbjct: 26  DVVDETGSTNADLLARAAAGEDVAGSVLLTEFQSAGRGRHGRQWTAPPRSQVAMSVAVDA 85

Query: 76  --ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
             +  D+   L     VA+R  +A    V  +  +KWPND+LV + K+AGIL E    ++
Sbjct: 86  GGVRPDAWGWLPLLTGVAVRDAVAEVSAV--EAGLKWPNDVLVGEGKLAGILAEVAAPQH 143

Query: 134 GLQAVVVGIGLNVKHCPVDTPYP-VTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDT 191
               V+VGIGLNV     + P P  TSL   G    D   + + L +++   +  W++  
Sbjct: 144 ---VVIVGIGLNVTLSAAEAPDPRATSLTMLGARNHDRTALAAALLRNLGTRIARWRRAA 200

Query: 192 GREE-IMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEKKGCVRQIFTGD 249
           G +E ++  +R  +  +G  +T  L     L G    +DD G L +   +  V  +  GD
Sbjct: 201 GADEGLIADYRRHSLTLGREVTATLPGDRRLDGTATDIDDLGRLTITTGRDSV-TVAAGD 259

Query: 250 I 250
           I
Sbjct: 260 I 260


>gi|291551183|emb|CBL27445.1| birA, biotin-[acetyl-CoA-carboxylase] ligase region [Ruminococcus
           torques L2-14]
          Length = 330

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 80/158 (50%), Gaps = 11/158 (6%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSI 76
           ++D++ STN    +    G       VA  QTAGRGRR   W S  G+ +Y SLLL   I
Sbjct: 83  YYDSVDSTNLRIKQMGDEGAPEGTLAVADKQTAGRGRRGRSWDSPSGSSIYMSLLLRPKI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVG-----TDVKIKWPNDILVFQRKIAGILIETLNL 131
             D   +L+  +A+   SV    +  G      DVKIKWPNDI++  +K+ GIL E    
Sbjct: 143 EPDQAPMLTLVMAL---SVAEGIMDCGDSCGNPDVKIKWPNDIIINGKKLVGILTEMSTQ 199

Query: 132 KNGLQAVVVGIGLNVK--HCPVDTPYPVTSLQREGGCI 167
            + +  V +G+G+NV     P +     TSL+ E G +
Sbjct: 200 IDYINHVTIGVGINVNLTEFPEEIRETATSLRLECGHV 237


>gi|264680919|ref|YP_003280829.1| biotin--acetyl-CoA-carboxylase ligase [Comamonas testosteroni
           CNB-2]
 gi|299530911|ref|ZP_07044325.1| biotin--acetyl-CoA-carboxylase ligase [Comamonas testosteroni S44]
 gi|262211435|gb|ACY35533.1| biotin--acetyl-CoA-carboxylase ligase [Comamonas testosteroni
           CNB-2]
 gi|298721132|gb|EFI62075.1| biotin--acetyl-CoA-carboxylase ligase [Comamonas testosteroni S44]
          Length = 276

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 14/151 (9%)

Query: 14  FRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLL 72
           F  E   TI S+N E M+RA  G    + ++A  QT GRGR    W+S  G+ L  SL L
Sbjct: 23  FTVEVLPTIDSSNTELMRRARDGLTDPVLLIAEQQTQGRGRLGRNWVSGVGDSLMFSLGL 82

Query: 73  IDSISKDSLTLLSFAIAVAMRSVIASTLP---VGTDVKIKWPNDI-LVFQRKIAGILIET 128
              ++    + LS A+ V++   +   LP       + IKWPND+ L   RK+AGILIET
Sbjct: 83  --PLAPRDWSGLSLAVGVSVAESLQPQLPAAGAAPKIGIKWPNDLWLEGDRKLAGILIET 140

Query: 129 LNLKNGLQA-------VVVGIGLNVKHCPVD 152
            +   G Q        VV+GIG+NV+  P D
Sbjct: 141 ASFVGGQQHDMTAPRYVVIGIGINVRPRPGD 171


>gi|289641479|ref|ZP_06473642.1| biotin/acetyl-CoA-carboxylase ligase [Frankia symbiont of Datisca
           glomerata]
 gi|289508689|gb|EFD29625.1| biotin/acetyl-CoA-carboxylase ligase [Frankia symbiont of Datisca
           glomerata]
          Length = 263

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 110/226 (48%), Gaps = 17/226 (7%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLT 82
           STN + +  A +G    L +VA  Q AGRGR D  W S  G  L  S+LL  ++   +L 
Sbjct: 33  STNADLVAAAKTGAGEGLVLVAEHQWAGRGRLDRSWASPSGAGLTFSVLLRPAVPAGALG 92

Query: 83  LLSFAIAVAMRSVIA--STLPVGTDVKIKWPNDILVFQRKIAGILIETL--NLKNGLQAV 138
            L     +++ S +   + +P G    +KWPND+LV   K+AGIL E +    ++G  AV
Sbjct: 93  WLPLVTGLSLASTLREFAGIPAG----LKWPNDVLVAGEKLAGILAEAVPDRDRSGTVAV 148

Query: 139 VVGIGLNVKHCPVDTPYPVTSL-----QREGGCIDLKDIFSLLFQDVARVLDLWKKDTGR 193
           +VGIGLNV +   + P   TS+     Q     +   ++   L + + RV   W  +   
Sbjct: 149 IVGIGLNVDNDVDELPPGATSVALRQRQESRPLVGRGELLIELLRGLVRVYRRWLAEP-- 206

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSIL-GRFVGVDDFGYLLLEEK 238
                 +R     +G  + ++L  GS++ G    VDD G L+++ +
Sbjct: 207 TATAAAYRSVCDTLGQRVRVELPDGSVVTGTATDVDDHGRLVVDGR 252


>gi|209521690|ref|ZP_03270380.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. H160]
 gi|209497881|gb|EDZ98046.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. H160]
          Length = 305

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 118/266 (44%), Gaps = 32/266 (12%)

Query: 12  YSFRYEFFDTISSTNDECMK--RALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M   +AL      L      VA  QTAGRGRR   W ++ GN
Sbjct: 36  HDWPIEIVEETGSTNADLMTHVKALPRRANALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 95

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 96  ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 154

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC---------------PVDTPYPVTSLQREGGCI 167
           GILIET    +   AVV+GIG NVK                 P       T+LQR     
Sbjct: 155 GILIETAWSTDDASAVVIGIGTNVKGADELAAKVGALNAEVPPQARGTAPTALQRALPNA 214

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV-- 225
           +L D  +     +  +L  +  + G       W       G  + + L  G  L R V  
Sbjct: 215 NLTDTLAAELNALEPMLQRFGAE-GFAPFQPRWNAVHAYAGRDVVV-LEQGQELARGVAA 272

Query: 226 GVDDFGYLLLEEKKGCVRQ-IFTGDI 250
           GVD+ G LLL+   G  RQ I TGD+
Sbjct: 273 GVDERGQLLLDTADG--RQCIATGDV 296


>gi|253700525|ref|YP_003021714.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M21]
 gi|251775375|gb|ACT17956.1| biotin/acetyl-CoA-carboxylase ligase [Geobacter sp. M21]
          Length = 327

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 112/234 (47%), Gaps = 10/234 (4%)

Query: 24  STNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLT 82
           STN    K A  G      ++A  Q+AG+GR    W+S  G NLY S++L  +I   +  
Sbjct: 94  STNSVAFKMAEEGAPEGTVVIADTQSAGKGRLGRIWLSPPGVNLYCSVVLRPAIPPVAAC 153

Query: 83  LLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGI 142
            L+F   VA+   +     +    +IKWPNDIL+  +K+AG+L E       +  VV+GI
Sbjct: 154 QLTFLSVVAVARAVERCTKL--KPQIKWPNDILINGKKVAGLLNEMNAETEKVNFVVLGI 211

Query: 143 G--LNVKHCPVDT---PYPVTSLQREGG-CIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           G  LN++   ++     +P TSL  EGG  +D      +L +++ ++ D +  + G   +
Sbjct: 212 GVNLNLRMSTMNEGLLRHPATSLLEEGGEEVDRLSFTRVLLEELDQLYDNFLVE-GDGPV 270

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
              W   +   G  + +        G   GVD FG LL+    G +  + +GD+
Sbjct: 271 RAEWLARSAIKGRSVRVSQQNREFRGVVQGVDSFGALLVLLSDGTLETVLSGDV 324


>gi|111220673|ref|YP_711467.1| putative biotin-ligase [Frankia alni ACN14a]
 gi|111148205|emb|CAJ59874.1| putative biotin-ligase [Frankia alni ACN14a]
          Length = 339

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 93/200 (46%), Gaps = 9/200 (4%)

Query: 41  LWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAST 99
           L + A  QTAGRGR D  W S  G  L  SLL+    +   L  L   +  ++ + + + 
Sbjct: 130 LVLAAERQTAGRGRLDRSWESRPGAGLTVSLLIRPRTAVSRLGWLPMVVGTSLVATVRAV 189

Query: 100 LPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTS 159
              G    +KWPND+LV   K+AGIL+E + +     +VV+G GLNV   P + P   TS
Sbjct: 190 --AGVPAVLKWPNDVLVEGGKLAGILVEVVPVPASAPSVVIGFGLNVNAEPDELPARSTS 247

Query: 160 LQREGG---CIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLS 216
           L   G     +D  ++   +   +   L  W+ D        L  C    IG  + ++L 
Sbjct: 248 LLLAGAHPVALDRTELLGRILTGLVDALAAWEADPQAARAAYLAVCAT--IGREVRVELP 305

Query: 217 YGSI-LGRFVGVDDFGYLLL 235
            GS  +GR   VD  G L++
Sbjct: 306 DGSADIGRATDVDLEGRLVV 325


>gi|208778960|ref|ZP_03246306.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella novicida FTG]
 gi|208744760|gb|EDZ91058.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella novicida FTG]
          Length = 260

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 78/141 (55%), Gaps = 5/141 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLLI 73
           + E+F TI STND  +    +      ++    QT GRGRR +KWIS DK N+Y++L   
Sbjct: 19  KVEYFPTIDSTNDYFLATNFTHKYHFCYV--DKQTKGRGRRGDKWISEDKDNIYSTLAFH 76

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
              +  + +L S  IA+ + + I   +P      +KIK PNDI    +K+AGILIET N+
Sbjct: 77  CDFAITADSLKSVKIALGVLAAIKKYIPKNLQQYLKIKLPNDIYFQDQKLAGILIETKNI 136

Query: 132 KNGLQAVVVGIGLNVKHCPVD 152
           K     +++G+G+NV     D
Sbjct: 137 KKDSFDIIIGVGINVNMTNTD 157


>gi|146313575|ref|YP_001178649.1| biotin--protein ligase [Enterobacter sp. 638]
 gi|145320451|gb|ABP62598.1| bifunctional BirA, biotin operon
           repressor/biotin--acetyl-CoA-carboxylase ligase
           [Enterobacter sp. 638]
          Length = 320

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 111/234 (47%), Gaps = 11/234 (4%)

Query: 22  ISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDS 80
           I STN   ++R    + G+   VA  Q AGRGRR  KW S  G NLY S+         +
Sbjct: 87  IDSTNQYLLERINELNSGDS-CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAA 145

Query: 81  LTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGLQAVV 139
              LS  I + +  V+     +G D V++KWPND+ +  RK+AGIL+E          +V
Sbjct: 146 AIGLSLVIGIVIAEVLHD---LGADKVRVKWPNDLYLNDRKLAGILVEMTGKTGDAAQIV 202

Query: 140 VGIGLNVKHCPVDTPYPVT---SLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEI 196
           +G GLN+    V T        +LQ  G  ID   +   L +++   L L+++D G    
Sbjct: 203 IGAGLNMVMRNVQTDVVNQGWITLQEAGVTIDRNTLAVRLIKELREALTLFEQD-GLSPF 261

Query: 197 MNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
           ++ W      I   + + +    I G   G++  G LLLE+ +G V+    G+I
Sbjct: 262 LSRWEKLDNFINRPVKLIIGDKEIFGTSRGINAQGALLLEQ-EGIVKPWVGGEI 314


>gi|293394011|ref|ZP_06638316.1| biotin--[acetyl-CoA-carboxylase] ligase [Serratia odorifera DSM
           4582]
 gi|291423482|gb|EFE96706.1| biotin--[acetyl-CoA-carboxylase] ligase [Serratia odorifera DSM
           4582]
          Length = 320

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 112/244 (45%), Gaps = 17/244 (6%)

Query: 15  RYEFFDTISSTNDECMKRAL---SGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASL 70
           R      + STN   + R     SGD      VA  Q AGRGRR   W+S  G NLY S+
Sbjct: 80  RVTVLPVVDSTNQYLLDRIAELASGDA----CVAEYQQAGRGRRGRHWVSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETL 129
                    +   LS  I + M  V+     +G + V++KWPND+ +  RK+AGIL+E  
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMTEVLQR---LGAEKVRVKWPNDLYLNDRKLAGILVELT 192

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDL 186
                   +V+G G+N+     +         +LQ  G  ID  ++ ++L  ++ R L  
Sbjct: 193 GKTGDAAQLVIGAGINLAMRETNADAINQGWINLQEAGITIDRNELAAMLLNEMRRALRQ 252

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIF 246
           ++++ G    ++ WR     I   + + +    I G   G+D  G LLLE+  G ++   
Sbjct: 253 FEQE-GLAPFISRWRNLDNFIDRPVKLLIGEQQIFGIARGIDQQGALLLEQ-DGELKPFI 310

Query: 247 TGDI 250
            G+I
Sbjct: 311 GGEI 314


>gi|270265458|ref|ZP_06193715.1| bifunctional protein BirA [Serratia odorifera 4Rx13]
 gi|270040595|gb|EFA13702.1| bifunctional protein BirA [Serratia odorifera 4Rx13]
          Length = 307

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 108/240 (45%), Gaps = 9/240 (3%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI 73
           R      + STN   + R      G+   VA  Q AGRGRR  +WIS  G NLY S+   
Sbjct: 67  RVTVLSVVDSTNQYLLDRITELQSGDA-CVAEYQQAGRGRRGRQWISPFGANLYLSMFWR 125

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
                 +   LS  I + M  V+        +V++KWPND+ +  RK+AGIL+E      
Sbjct: 126 LEQGPAAAMGLSLVIGIVMAEVLQRL--GAEEVRVKWPNDLYLNDRKLAGILVELTGKTG 183

Query: 134 GLQAVVVGIGLNVKHCPVDT---PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKD 190
               +V+G G+N+     +         +LQ  G  ID  ++ + L  ++ + L  ++ D
Sbjct: 184 DAAQLVMGAGINLAMRESNANAINQGWINLQEAGISIDRNELAATLLNELRQSLQQFEID 243

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
            G    ++ WR     I   + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 244 -GLVPFISRWRALDNFIDRPVKLLIGEQQIFGIARGIDQQGALLLEQ-NGAIKPFIGGEI 301


>gi|295675320|ref|YP_003603844.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1002]
 gi|295435163|gb|ADG14333.1| biotin/acetyl-CoA-carboxylase ligase [Burkholderia sp. CCGE1002]
          Length = 312

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 119/266 (44%), Gaps = 32/266 (12%)

Query: 12  YSFRYEFFDTISSTNDECMK--RALSGDLGNLWI----VASCQTAGRGRRDNKWISDKGN 65
           + +  E  +   STN + M   +AL      L      VA  QTAGRGRR   W ++ GN
Sbjct: 43  HDWPIEIVEETGSTNADLMAHMKALPRHANALPRPIVRVAYLQTAGRGRRGRPWYAEPGN 102

Query: 66  -LYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGT--DVKIKWPNDILVFQRKIA 122
            L  S+  +     + L  LS A+ VA+   + S LPV     + +KWPND+L+   K+A
Sbjct: 103 ALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRS-LPVAGPGQIALKWPNDVLLEGDKLA 161

Query: 123 GILIETLNLKNGLQAVVVGIGLNVKHC---------------PVDTPYPVTSLQREGGCI 167
           GILIET    +   AVV+GIG NVK                 P       T+LQR     
Sbjct: 162 GILIETAWSTDDASAVVIGIGTNVKGADELAAKVGALNAEVTPQARGTVPTALQRALPNA 221

Query: 168 DLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFV-- 225
           +L D  +     +  +L  +  + G       W       G  + + L  G  L R V  
Sbjct: 222 NLTDTLAAELSALEPMLQRFGAE-GFAPFQPRWNAVHAYAGRDVVL-LEQGQELARGVAA 279

Query: 226 GVDDFGYLLLEEKKGCVRQ-IFTGDI 250
           GVD+ G LLL+  +G  RQ I TGD+
Sbjct: 280 GVDERGQLLLDTAEG--RQSIATGDV 303


>gi|302544780|ref|ZP_07297122.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302462398|gb|EFL25491.1| biotin-[acetyl-CoA-carboxylase] ligase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 296

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 107/247 (43%), Gaps = 17/247 (6%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYASLLLIDS 75
           E  +   STN + + RA +G    + +VA  Q AGRGR D  W +  +  L+ S+LL   
Sbjct: 45  EVVEATGSTNTDLVARAGAGAPEGVVLVAEEQNAGRGRLDRTWTAPARSGLFFSILLRPG 104

Query: 76  ISKDSLTLLSF-AIAVAMRSVIASTLPVGTDVKIKWPNDILVF----QRKIAGILIETLN 130
            +    +   +  +   + S  A +   G D  +KWPND+LV     +RK  GIL E  +
Sbjct: 105 AAGVPTSRWGWLPLLAGLASAGALSRAAGVDTALKWPNDLLVTVGGEERKFGGILAERAD 164

Query: 131 LKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCI--DLKDIFSLLFQDVARVLDLWK 188
                 AVV+GIGLNV     + P P          I  D   +   + + + +    W+
Sbjct: 165 -----DAVVIGIGLNVSLRAGELPVPTAGSLALANAISTDRDPLLRAVLRSIEQWYGEWR 219

Query: 189 KDTGREEIMNLWRCFACG---IGDLITIKLS-YGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
           +  G      L   +A G   +G  +  +L   G+ +G  V +D  G L+L    G    
Sbjct: 220 RFEGDPAACGLQEAYAAGCATLGRRVRAELPGGGATVGEAVAIDGDGRLVLASDTGVQEP 279

Query: 245 IFTGDIF 251
           +  GDI 
Sbjct: 280 VSAGDIV 286


>gi|330953214|gb|EGH53474.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Pseudomonas syringae Cit 7]
          Length = 319

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 91/169 (53%), Gaps = 9/169 (5%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-KGNLYAS 69
           P ++    +D+I STN E  +    G    + +VA  QT+GRGRR  KW+S    NLY S
Sbjct: 73  PANWSVRTYDSIDSTNAEAARLIAQGVPLPVLVVAEQQTSGRGRRGRKWVSPFAENLYYS 132

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L        L  LS  + +A+ +V+      G    +KWPND+LV ++KIAGIL+E +
Sbjct: 133 LVLRIDGGMRQLEGLSLLVGLAVMTVLRDMGVQGAG--LKWPNDVLVGRQKIAGILLELI 190

Query: 130 NLKNGLQAVVVGIGLNVK---HCPVDTPYPVTSLQRE-GGCIDLKDIFS 174
                +  V++GIG+NV       VD  +  TS++ E GG +D   + +
Sbjct: 191 GDPADVCHVIIGIGVNVNMRSSSEVDQLW--TSMRLETGGLVDRNQVAA 237


>gi|37520907|ref|NP_924284.1| biotin acetyl-CoA carboxylase ligase [Gloeobacter violaceus PCC
           7421]
 gi|35211902|dbj|BAC89279.1| biotin acetyl-CoA carboxylase ligase [Gloeobacter violaceus PCC
           7421]
          Length = 258

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 103/227 (45%), Gaps = 21/227 (9%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           +  ++ I STN   M+    G      I+A  QT GRG    +W S  G LY S++L   
Sbjct: 21  FHLYERIDSTNRLAMEFLREGAAEGTTILAEQQTGGRGSNGRQWESLPGGLYLSVILRPQ 80

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ----RKIAGILIETLNL 131
           +    +  L+   A  +   +      G DV++KWPND+++ Q     K+ GIL ET   
Sbjct: 81  LKLADIFQLTLVAAFGVAQSLGRL--TGADVRLKWPNDLVIEQGRRLAKVGGILTETRIQ 138

Query: 132 KNGLQAVVVGIGLNVKHCPVDTPYPVTS-----LQREGGCIDLKDIFSLLFQDVARVLDL 186
            + L   VVGIG+N      D P P  +     L R    +DL  + + +   + +   L
Sbjct: 139 GDRLAGAVVGIGIN-----WDNPVPAEAARLKPLSRR--DLDLAPVAAAVLLGLEQSYQL 191

Query: 187 WKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYL 233
           W +  G E I++ +  +   +G  + +    G   GR +G+D+ G L
Sbjct: 192 WHQ-RGIERIVSGYERYLVNLGQAVEVPGHDGQ--GRIIGIDERGAL 235


>gi|312879985|ref|ZP_07739785.1| biotin/acetyl-CoA-carboxylase ligase [Aminomonas paucivorans DSM
           12260]
 gi|310783276|gb|EFQ23674.1| biotin/acetyl-CoA-carboxylase ligase [Aminomonas paucivorans DSM
           12260]
          Length = 340

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 109/247 (44%), Gaps = 8/247 (3%)

Query: 11  PYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYAS 69
           P       F  + ST     + A  G    + +VA  Q +GRGRR   W S  G  LY S
Sbjct: 85  PLGHPILHFPVLDSTQVPLKELARQGAPEGVVVVAQRQESGRGRRGRDWDSPPGGGLYFS 144

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           +LL   +    + L++FA A+A++  +      G    IKWPND+L+  RK+ GIL E  
Sbjct: 145 VLLRPPLLPGQVQLVNFAAALAVQEGLFRLF--GLRAAIKWPNDVLLEGRKLCGILSEAA 202

Query: 130 NLKNGLQAVVVGIGLNV----KHCPVDTPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVL 184
              + +  VV G+GLNV       P +    + +L+ R GG      + + + + +A  +
Sbjct: 203 VEADRIHHVVTGMGLNVNLSASQFPAELGARIATLKDRLGGPTSRGAVLAAVLESLASQM 262

Query: 185 DLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQ 244
                  G E ++  +R     +G  + ++L    + G  + VD  G L + +  G   +
Sbjct: 263 VRLSSPEGDEALLASYRERCSTLGMPVRVELDCSFVEGTALSVDREGALWVRDALGKEHR 322

Query: 245 IFTGDIF 251
               D+ 
Sbjct: 323 FAAADVH 329


>gi|313157340|gb|EFR56764.1| biotin--[acetyl-CoA-carboxylase] ligase [Alistipes sp. HGB5]
          Length = 250

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 113/238 (47%), Gaps = 16/238 (6%)

Query: 20  DTISSTNDECM-KRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS-I 76
           D  +STNDE    +   GD+  +W  A  QTAGRG+R + W S +G NL  S++L    +
Sbjct: 6   DETTSTNDEARDAKYRHGDI--VW--AERQTAGRGQRGHTWTSPEGENLTFSMVLEPRFL 61

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                 LLS A+ +A+    A+    G D +IKW NDI +  RK+ GILIE  +    L 
Sbjct: 62  PVGEQFLLSEAVTLALTDTFAA---YGIDTRIKWTNDIYIGDRKLVGILIEHNHAGASLS 118

Query: 137 AVVVGIGLNVKHCPVDT--PYPVTSLQREGGCIDLKDIF-SLLFQDVARVLDLWKKDTGR 193
             + GIG+NV     D   P PV+  Q  G   +   +  + L + + R   L + +  +
Sbjct: 119 RTIAGIGINVNQTAFDPALPNPVSLAQAGGRKFNRSRLLETFLVRCLRRYAQLERGE--K 176

Query: 194 EEIMNLWRCFACGIGDLITIKLSYGSILGRFV-GVDDFGYLLLEEKKGCVRQIFTGDI 250
           E + + +R     +G+    +L  G++    + GV   G L+L    G   +    +I
Sbjct: 177 ETLQHAYRERMYRLGEQHPYRLPDGTLFQAAIEGVLPSGELILRHADGTRHEYLFREI 234


>gi|225850777|ref|YP_002731011.1| biotin-(acetyl-CoA-carboxylase) ligase [Persephonella marina EX-H1]
 gi|225645665|gb|ACO03851.1| biotin-(acetyl-CoA-carboxylase) ligase [Persephonella marina EX-H1]
          Length = 313

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 125/243 (51%), Gaps = 23/243 (9%)

Query: 16  YEFFDTISSTNDECMKRALSGDLGNLWIV-ASCQTAGRGRRDNKWISDKGN-LYASLLLI 73
           Y FFD I STN      A S DL +  +V A  QT G+GR+  +WIS KG  LY S+++ 
Sbjct: 81  YIFFDQIDSTN----MYAKSNDLPDGTVVLAENQTKGKGRKGRRWISSKGKGLYFSIVIK 136

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKN 133
            +   + L  LS     A++  I   L     +KIKWPND+ +  RK AG LIET    N
Sbjct: 137 RNYPLNDLMKLSLLFPYAVKEAIKDYLE--NQIKIKWPNDLYINNRKFAGFLIETEIEGN 194

Query: 134 GLQAVVVGIGLNVKHCPV---DTPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKK 189
            +  ++ GIG+N+ + P    D     TSL+  EG     K++F  + + + + LD +  
Sbjct: 195 EINRIIAGIGININNEPEEFGDIKDTATSLKIEEGKTFCRKELFCRVLETIEKSLDKFSS 254

Query: 190 DTGREEIMN--LWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
               +EI    LW+      G+ I I L  G I GR +G+D  G L +  +KG +  +++
Sbjct: 255 LDLTDEIEKDLLWK------GENIRI-LDEG-IEGRLIGLDRSGGLKVLTEKGVL-TVYS 305

Query: 248 GDI 250
           GDI
Sbjct: 306 GDI 308


>gi|281181042|dbj|BAI57372.1| biotin-[acetyl-CoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Escherichia coli SE15]
          Length = 321

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEAGINLDRNSLAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|242373765|ref|ZP_04819339.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis M23864:W1]
 gi|242348502|gb|EES40104.1| possible biotin--[acetyl-CoA-carboxylase] ligase [Staphylococcus
           epidermidis M23864:W1]
          Length = 323

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 121/250 (48%), Gaps = 30/250 (12%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E + T+ ST  +  K+AL G+  +  I++  QT GRGR +  W S KG  L+ SL+L  +
Sbjct: 86  EVYSTVDSTQLKA-KQALVGNKNSFLILSDEQTEGRGRFNRNWSSSKGKGLWMSLVLRPN 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +   +  IA+ +R  I         V IKWPNDI +  +KI G L E +   + +
Sbjct: 145 VPFALIPKFNLFIALGIRDAIQQF--SNDRVAIKWPNDIYIGNKKICGFLTEMVANYDAI 202

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQREG-GCIDLKDIFSLLFQDVARVLDLWKK- 189
           +A++ GIG+N+ H   D      +  TS++      I+  D    L  ++ +  + +   
Sbjct: 203 EAIICGIGINMNHVENDFNEEIRHRATSMRMHADDKINRYDFLKTLLYEINKRYNQFLNQ 262

Query: 190 --DTGREEIM---NLWRCFACGIGDLITIKLSYGSILGRFVG----VDDFGYLLLEEKKG 240
             +T REE +   N+W             +L +     +F+G    +D  G+LL+++ +G
Sbjct: 263 PFETIREEYIAATNMW-----------NRQLRFTENDHQFIGEAFDIDQDGFLLVKDDEG 311

Query: 241 CVRQIFTGDI 250
            + ++ + DI
Sbjct: 312 NLHRLMSADI 321


>gi|313200439|ref|YP_004039097.1| biotin/acetyl-CoA-carboxylase ligase [Methylovorus sp. MP688]
 gi|312439755|gb|ADQ83861.1| biotin/acetyl-CoA-carboxylase ligase [Methylovorus sp. MP688]
          Length = 326

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 71/130 (54%), Gaps = 4/130 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDSIS 77
            D + STN   M++A SG       V S QT GRGRR   W S  GN L  SLL      
Sbjct: 87  HDQLDSTNRWLMQQAASGAAHLSCAVTSHQTHGRGRRGRVWQSALGNSLTFSLLWRFDTG 146

Query: 78  KDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA 137
             +L+ LS A+ +A+    A    +G  V +KWPND+LV  RK+AGILIE      G  A
Sbjct: 147 AAALSGLSLAVGLALGQAFAE---MGVTVALKWPNDVLVEYRKLAGILIELQGDMEGPSA 203

Query: 138 VVVGIGLNVK 147
            V+G+G+N++
Sbjct: 204 AVIGVGINLR 213


>gi|314933640|ref|ZP_07841005.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus caprae C87]
 gi|313653790|gb|EFS17547.1| biotin-[acetyl-CoA-carboxylase] ligase [Staphylococcus caprae C87]
          Length = 323

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 120/244 (49%), Gaps = 18/244 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN-LYASLLLIDS 75
           E ++++ ST  +  K+AL G+  +  I++  QT GRGR +  W S KG  L+ SL+L  +
Sbjct: 86  EVYNSVDSTQTKA-KKALVGNKSSFLILSDEQTEGRGRFNRNWSSSKGKGLWMSLVLRPN 144

Query: 76  ISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGL 135
           +    +   +  IA+ +R  I         V IKWPNDI + ++KI G L E +   + +
Sbjct: 145 VPFAMIPKFNLFIALGIRDAIQQF--SNDRVAIKWPNDIYIGKKKICGFLTEMVANYDAI 202

Query: 136 QAVVVGIGLNVKHCPVD----TPYPVTSLQ-REGGCIDLKDIFSLLFQDVARVLDLWKKD 190
           +A++ GIG+N+ H   D      +  TS++      I+  D   +L  ++ +     +  
Sbjct: 203 EAIICGIGINMNHVEDDFNDEIRHIATSMRLHADDKINRYDFLKILLYEINK-----RYK 257

Query: 191 TGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVG----VDDFGYLLLEEKKGCVRQIF 246
              E+   + R       ++   +L +     +F+G    +D  G+LL+++ +G + ++ 
Sbjct: 258 QFLEQPFEMIREEYIAATNMWNRQLRFTENGHQFIGKAFDIDQDGFLLVKDDEGNLHRLM 317

Query: 247 TGDI 250
           + DI
Sbjct: 318 SADI 321


>gi|315501897|ref|YP_004080784.1| biotin/acetyl-CoA-carboxylase ligase [Micromonospora sp. L5]
 gi|315408516|gb|ADU06633.1| biotin/acetyl-CoA-carboxylase ligase [Micromonospora sp. L5]
          Length = 290

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 117/263 (44%), Gaps = 33/263 (12%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWIS-DKGNLYASLLL- 72
           R E      STN + +  A +G+   L +VA  QTAGRGRR   W S  +  L  S+LL 
Sbjct: 32  RLELLAETGSTNADVVAAARAGEPEGLVVVAERQTAGRGRRGRVWQSPPRAGLATSVLLR 91

Query: 73  ------------IDSISKDSLTLLS-FAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQR 119
                       + +     L LL+  A+A A+R ++A       D ++KWPND+LV   
Sbjct: 92  PGEAVAERGWSPVPTTGYGWLPLLAGVALAEAVR-LLAE-----LDARLKWPNDLLVDGA 145

Query: 120 KIAGILIETLNLKNG-LQAVVVGIGLNVK----HCPVD-TPYPVTSLQREGGCIDLKDIF 173
           K AG+L E +  +N    A+VVG+GLNV       P + T  P TSLQ  G     +D  
Sbjct: 146 KCAGVLAEAVPGENDRPPAIVVGVGLNVTLRADELPENPTGLPATSLQLAGATATDRDPL 205

Query: 174 SLLFQDVAR-VLDLWKKDTGREEIMNLWRCFACG---IGDLITIKLSYG-SILGRFVGVD 228
                       + W+   G  E   L   +  G   +G  + + L  G  + G   GVD
Sbjct: 206 LRALLRSLADWYERWRDAGGDAEASGLREAYLAGCATVGRQVRVLLPDGREVHGTATGVD 265

Query: 229 DFGYLLLEEKKGCVRQIFTGDIF 251
             G LL+E     +R +  GD+ 
Sbjct: 266 ADGQLLVETGAETLR-LAAGDVL 287


>gi|251792305|ref|YP_003007030.1| biotin--protein ligase [Aggregatibacter aphrophilus NJ8700]
 gi|247533697|gb|ACS96943.1| biotin-[acetyl-CoA-carboxylase] ligase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 310

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 117/252 (46%), Gaps = 17/252 (6%)

Query: 5   LSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISD-K 63
           L++   PY    +    ISSTN   +    +   G+L  +A  Q+AGRGRR  +WIS   
Sbjct: 65  LAQALQPYHVTLK--PVISSTNQYLLDNIETLQKGDL-CLAEYQSAGRGRRGRQWISPFA 121

Query: 64  GNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAG 123
           G +  S       SK  L  LS  I +A+   +      G   ++KWPNDILV  RK+AG
Sbjct: 122 GQIILSFYWQLDPSK-PLDGLSSVIGLAIVQSLVELDMYG--FQVKWPNDILVNDRKLAG 178

Query: 124 ILIETLNLKNGLQAVVVGIGLNV-----KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQ 178
           IL+E +N  NG   +V+GIG+NV     KH  +D P+    L      ID + +   + +
Sbjct: 179 ILVEIINRPNGKLNLVIGIGMNVSLGQEKH--IDQPW--AELSEFFPNIDREQVIIQMVK 234

Query: 179 DVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEK 238
            + R L  +++     E+   W       G  + +      I G   G++  G+L L  +
Sbjct: 235 TIYRYLSHFEQHGIDAEMQQQWLEHDAYFGTEVNVITEKSVISGIDQGINSSGHLCLMTQ 294

Query: 239 KGCVRQIFTGDI 250
            G VR    G++
Sbjct: 295 DG-VRYFNAGEV 305


>gi|217077867|ref|YP_002335585.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermosipho africanus
           TCF52B]
 gi|217037722|gb|ACJ76244.1| biotin-[acetyl-CoA-carboxylase] ligase [Thermosipho africanus
           TCF52B]
          Length = 226

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISK 78
           F+ I+STN    +   + D G + ++A  QT GRGR    WIS +G L+ S+L      K
Sbjct: 10  FEKINSTNTYVKENYKNLDNGTI-VLAKVQTQGRGRLGRVWISQEGGLWFSILF-----K 63

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
            +L   +F   ++  ++++    +    KIKWPNDI   ++K++GIL E ++    +QA+
Sbjct: 64  KNLKYPNFYTKLSAITLLSILKNLKISAKIKWPNDIFFKEKKLSGILTEIISKNGKVQAI 123

Query: 139 VVGIGLNVKHCPVDTPYPVTSLQR 162
           VVGIGLNV +   +TP   TS+ +
Sbjct: 124 VVGIGLNVNN---ETPPEGTSVSK 144


>gi|288926038|ref|ZP_06419967.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella buccae D17]
 gi|288337258|gb|EFC75615.1| biotin-[acetyl-CoA-carboxylase] ligase [Prevotella buccae D17]
          Length = 252

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query: 21  TISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDS-ISK 78
           T+ STN         G+      VA+ QTAGRG+  N W S+ G NL  SL++    +  
Sbjct: 18  TVDSTNRYLHDCPPVGEEEMTVAVANYQTAGRGQGTNTWESEAGANLLFSLMVHPCWMPV 77

Query: 79  DSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAV 138
               LLS A A+A++  + + +     V +KWPND+     K++G LIET     G+   
Sbjct: 78  GRQFLLSMAGALALKETLDAYIDF---VTLKWPNDVYWRDSKLSGTLIETTVNSRGIGRC 134

Query: 139 VVGIGLNV--KHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE-E 195
           + GIGLNV  +    D P PV+  Q  G  ID + +   +        +L ++  GR  E
Sbjct: 135 IFGIGLNVNQREFRSDAPNPVSLYQLLGREIDREHLLHEILHAFEHYYELLRQ--GRYGE 192

Query: 196 IMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           +   +        D    +   G   G  V V+D G+L+L +++G +R
Sbjct: 193 VSQRYHEALYRRSDFYRYRDKDGEFEGTIVEVEDDGHLILRDREGSIR 240


>gi|282880119|ref|ZP_06288839.1| biotin-(acetyl-CoA-carboxylase) ligase [Prevotella timonensis CRIS
           5C-B1]
 gi|281305992|gb|EFA98032.1| biotin-(acetyl-CoA-carboxylase) ligase [Prevotella timonensis CRIS
           5C-B1]
          Length = 250

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 108/229 (47%), Gaps = 8/229 (3%)

Query: 19  FDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGN--LYASLLLIDSI 76
            DTI STN    + A       + +VA  QT G+G+  + W S+ G   L++ L+    I
Sbjct: 9   LDTIGSTNVYLSEHASVFQEDMVVVVADYQTCGKGQGQHSWESESGKNLLFSILIHPHHI 68

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
                 LLS A A++++ V+   +    D+ +KWPNDI     K+ G LIE      G++
Sbjct: 69  PIHRQFLLSMAGALSIKRVLDGYV---DDISLKWPNDIYWRDSKLCGTLIENTVDSQGIK 125

Query: 137 AVVVGIGLNVKHCPV--DTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGRE 194
             + GIGLNV       D P P++  Q     ++ + +   L    AR LDL   D  ++
Sbjct: 126 NSIFGIGLNVNQAVFLSDAPNPISLFQILKHEVNREKLLERLIDSFARQLDLLSVDP-QK 184

Query: 195 EIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
            ++  +       G+    + S G  +    GV++ G LLL +++G +R
Sbjct: 185 YVVKPYHEALYRKGEAHLYQDSNGIFMAILEGVNEQGQLLLRDEQGHLR 233


>gi|324110921|gb|EGC04912.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia fergusonii
           B253]
          Length = 321

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +VVG G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVVGAGINMAMRRVEESIVNQGW--ITLQEAGINLDRNALAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|225010888|ref|ZP_03701355.1| biotin/acetyl-CoA-carboxylase ligase [Flavobacteria bacterium
           MS024-3C]
 gi|225004935|gb|EEG42890.1| biotin/acetyl-CoA-carboxylase ligase [Flavobacteria bacterium
           MS024-3C]
          Length = 242

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 87/155 (56%), Gaps = 18/155 (11%)

Query: 18  FFDTISSTNDECMKRALSGDL--GNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDS 75
           F D ISSTND  +K  LS  L   N ++VA+ QT GRG+  N W++ KG   +S+ L  S
Sbjct: 5   FLDKISSTND-YLKDLLSKGLLQDNTFVVAADQTEGRGQMGNNWLAHKG---SSISL--S 58

Query: 76  ISKDSLTL-------LSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIET 128
           + K  L L       ++ ++++A+R V+A       ++ +KWPNDIL+  +K+ GILIE 
Sbjct: 59  VYKKHLNLSLEDQFKIAMSVSLAVRQVLA---LFSEELSVKWPNDILIKGKKVGGILIEN 115

Query: 129 LNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE 163
               N + + V+GIGLN+   P+      T+L   
Sbjct: 116 KIQGNLVTSSVIGIGLNILKFPMPELTQATALSEH 150


>gi|187780265|ref|ZP_02996738.1| hypothetical protein CLOSPO_03861 [Clostridium sporogenes ATCC
           15579]
 gi|187773890|gb|EDU37692.1| hypothetical protein CLOSPO_03861 [Clostridium sporogenes ATCC
           15579]
          Length = 327

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 120/243 (49%), Gaps = 18/243 (7%)

Query: 18  FFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASLLLIDSI 76
            FD+I+STND+  K A S + G + I++  QT G+GR    W S K   +Y S++L   I
Sbjct: 84  HFDSINSTNDKAKKIASSENDGTV-IISEEQTLGKGRLGRTWSSSKFKGVYMSIILKPDI 142

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQ 136
           +   +  ++    VA  +VI + L       IKWPNDI+V  +K+ GIL E     N + 
Sbjct: 143 NTMDVPKIT---QVAAAAVITTLLNNNIKAYIKWPNDIIVNNKKVCGILTEMSGEINKVN 199

Query: 137 AVVVGIGLNV----KHCPVDTPYPVTSLQREGG-----CIDLKDIFSLLFQDVARVLDLW 187
            VVVG+G+NV    +  P D     TSL+ E        I + DI +   +    +++  
Sbjct: 200 YVVVGMGINVNCEEEDIPKDLISKATSLKIEDNKEFKRNILVADILNNFEKLYTELIEYN 259

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
             DT  E    + +  +  IG  + I       LG+ VG++  G LL++ +   ++ + +
Sbjct: 260 NIDTSIE----ICKKNSILIGKEVRIINRNKERLGKAVGLNSNGELLVQFENEEIKPLIS 315

Query: 248 GDI 250
           G+I
Sbjct: 316 GEI 318


>gi|15807332|ref|NP_296062.1| birA bifunctional protein [Deinococcus radiodurans R1]
 gi|6460154|gb|AAF11888.1|AE002065_5 birA bifunctional protein [Deinococcus radiodurans R1]
          Length = 474

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 114/247 (46%), Gaps = 29/247 (11%)

Query: 13  SFRYEFFDTISSTNDECM-----KRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLY 67
           + RY+   T++ST DE       +R  +       +VA  QTAGRGRR   W +  G L 
Sbjct: 240 ALRYQ--GTVTSTQDEVRFWADSERGPAPH--GAVVVAERQTAGRGRRGRVWDTTHGTLA 295

Query: 68  ASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQ-RKIAGILI 126
            S+LL +++S   L  +  A  VA+ +   +   +G    +KWPND+L    RK+AGIL+
Sbjct: 296 FSVLLREALSLADLVRMPLAAGVALHAACTA---LGVPCGLKWPNDLLTPDGRKLAGILL 352

Query: 127 ETLNLKNGLQAVVVGIGLNVKHCPVDTPY---PVTSLQREGGCIDLKDIFSLLFQDVARV 183
           E        +  V+GIG+NV   P    +    V  L R         +  +LFQ     
Sbjct: 353 EADLRGEEARRAVLGIGINVGTAPEGAAHLHESVPDLTRA------AVLGEVLFQ----- 401

Query: 184 LDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVR 243
           L+ W        I+  W+  +  +G  + +  + G++ G    +D+ G LL+E   G + 
Sbjct: 402 LEHWLAQPA-PAIIATWKATSLTLGRPVRVTTARGTVEGVARDLDEQGNLLVETAAG-LE 459

Query: 244 QIFTGDI 250
            +  GD+
Sbjct: 460 TVSAGDV 466


>gi|301021755|ref|ZP_07185721.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 69-1]
 gi|300397880|gb|EFJ81418.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 69-1]
          Length = 320

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEAGINLDRNTLAAMLIRELRTALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|322613106|gb|EFY10055.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322617852|gb|EFY14747.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622210|gb|EFY19057.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626642|gb|EFY23446.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631290|gb|EFY28052.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635191|gb|EFY31910.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642623|gb|EFY39216.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647427|gb|EFY43917.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650778|gb|EFY47173.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653442|gb|EFY49774.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322657323|gb|EFY53600.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663323|gb|EFY59526.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322667368|gb|EFY63531.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672016|gb|EFY68134.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675088|gb|EFY71169.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322679343|gb|EFY75391.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684746|gb|EFY80748.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323196008|gb|EFZ81173.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323196224|gb|EFZ81379.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204940|gb|EFZ89929.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205619|gb|EFZ90583.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323212385|gb|EFZ97204.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323214252|gb|EFZ99007.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221166|gb|EGA05596.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225215|gb|EGA09456.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229177|gb|EGA13304.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235780|gb|EGA19861.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238653|gb|EGA22707.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242325|gb|EGA26353.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249739|gb|EGA33643.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251545|gb|EGA35415.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256805|gb|EGA40524.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262784|gb|EGA46336.1| biotin--protein ligase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323263974|gb|EGA47484.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268467|gb|EGA51936.1| bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin
           operon repressor [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 320

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 111/238 (46%), Gaps = 17/238 (7%)

Query: 21  TISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSI 76
            I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+      
Sbjct: 86  VIDSTNQYLLDRIGELRSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMYWRLEQ 141

Query: 77  SKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKNGL 135
              +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E        
Sbjct: 142 GPAAAIGLSLVIGIVMAEVLRE---LGADKVRVKWPNDLYLLDRKLAGILVELTGKTGDA 198

Query: 136 QAVVVGIGLNVKHCPVDTP---YPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTG 192
             +V+G G+N+    V+         +LQ  G  +D   + + L   +   L+L++++ G
Sbjct: 199 AQIVIGAGINMAMRRVEEDVINQGWITLQEAGITLDRNMLAAKLIYKLRAALELFEQE-G 257

Query: 193 REEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDI 250
               ++ W+     IG  + + +    I G   G+D  G LLLE+  G ++    G+I
Sbjct: 258 LSPYLSRWKKLDNFIGRPVKLIIGDKEIFGISRGIDTQGALLLEQ-DGVIKPWMGGEI 314


>gi|241668922|ref|ZP_04756500.1| biotin-(acetyl-CoA-carboxylase) ligase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254877454|ref|ZP_05250164.1| biotin-[acetyl-CoA-carboxylase] ligase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254843475|gb|EET21889.1| biotin-[acetyl-CoA-carboxylase] ligase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 260

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 71/121 (58%), Gaps = 9/121 (7%)

Query: 17  EFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLI-- 73
           E F TI STND  ++R LS      +  A  QT GRGRR +KWISD   N+Y++L     
Sbjct: 21  EHFSTIGSTNDYLLERDLSHKYH--FCYADQQTKGRGRRGDKWISDNSDNIYSTLAFSCN 78

Query: 74  DSISKDSLTLLSFAIAVAMRSVIASTLPVGTD--VKIKWPNDILVFQRKIAGILIETLNL 131
            SI+KDS   +S  IA+ +   I   +PV  +  +KIK PND+     K+AGILIET N+
Sbjct: 79  FSIAKDSF--ISLKIALGVLETIKKYIPVDQEEKLKIKLPNDVYFEDHKLAGILIETKNI 136

Query: 132 K 132
           K
Sbjct: 137 K 137


>gi|331675464|ref|ZP_08376213.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA280]
 gi|331067342|gb|EGI38748.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA280]
          Length = 320

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEAGINLDRNTLAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|300904222|ref|ZP_07122083.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 84-1]
 gi|301307397|ref|ZP_07213399.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 124-1]
 gi|300403827|gb|EFJ87365.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 84-1]
 gi|300837429|gb|EFK65189.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 124-1]
 gi|315252399|gb|EFU32367.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 85-1]
          Length = 321

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEAGINLDRNTLAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|108805401|ref|YP_645338.1| biotin--acetyl-CoA-carboxylase ligase [Rubrobacter xylanophilus DSM
           9941]
 gi|108766644|gb|ABG05526.1| Biotin--acetyl-CoA-carboxylase ligase [Rubrobacter xylanophilus DSM
           9941]
          Length = 264

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 115/242 (47%), Gaps = 6/242 (2%)

Query: 10  NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAS 69
           +P + R E   ++ ST +   + A +G      ++A  QT GRGR    W S  G L+ S
Sbjct: 20  SPLARRAEVHGSLPSTQERARELARAGAGHGTAVLARVQTGGRGRLGRYWASPPGGLWMS 79

Query: 70  LLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETL 129
           L+L   ++  +   ++ A AVA    +     +G + +IKWPND+LV  RK+ GIL ET+
Sbjct: 80  LVLRPGLAPGAAHRITPAAAVAGAKAL---WELGVEARIKWPNDLLVGGRKVCGILAETV 136

Query: 130 NLKNGLQAVVVGIGLNVKHCPVDT-PYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
                    V+GIGLN    P  T     T+L+RE G  D+  +  L        ++L +
Sbjct: 137 AAGGEGLCAVLGIGLNANLDPEQTGSAAATTLRRELG-RDVDLLQLLGLLLGCLEVELGR 195

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
                  ++  WR   C +G  + ++   G + G  V +   G LL+    G V ++F G
Sbjct: 196 VGGEFRAVLEDWRALECTLGRRVRVRRLGGVLEGTAVDLGPEGALLVRTSSGTV-EVFEG 254

Query: 249 DI 250
           ++
Sbjct: 255 EV 256


>gi|218551038|ref|YP_002384829.1| biotin--protein ligase [Escherichia fergusonii ATCC 35469]
 gi|218358579|emb|CAQ91227.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia fergusonii ATCC 35469]
          Length = 321

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 21/242 (8%)

Query: 19  FDTISSTNDECMKRA---LSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLID 74
              I STN   + R     SGD      VA  Q AGRGRR  KW S  G NLY S+    
Sbjct: 84  LPVIDSTNQYLLDRIGELKSGDA----CVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRL 139

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTD-VKIKWPNDILVFQRKIAGILIETLNLKN 133
                +   LS  I + M  V+     +G D V++KWPND+ +  RK+AGIL+E      
Sbjct: 140 EQGPAAAIGLSLVIGIVMAEVLRK---LGADKVRVKWPNDLYLQDRKLAGILVELTGKTG 196

Query: 134 GLQAVVVGIGLN-----VKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWK 188
               +V+G G+N     V+   V+  +   +LQ  G  +D   + ++L +++   L+L++
Sbjct: 197 DAAQIVIGAGINMAMRRVEESVVNQGW--ITLQEAGINLDRNTLAAMLIRELRAALELFE 254

Query: 189 KDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTG 248
           ++ G    ++ W      I   + + +    I G   G+D  G LLLE+  G ++    G
Sbjct: 255 QE-GLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMGG 312

Query: 249 DI 250
           +I
Sbjct: 313 EI 314


>gi|15804567|ref|NP_290608.1| biotin--protein ligase [Escherichia coli O157:H7 EDL933]
 gi|15834154|ref|NP_312927.1| biotin--protein ligase [Escherichia coli O157:H7 str. Sakai]
 gi|82778848|ref|YP_405197.1| biotin--protein ligase [Shigella dysenteriae Sd197]
 gi|168752646|ref|ZP_02777668.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4113]
 gi|168759132|ref|ZP_02784139.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4401]
 gi|168765262|ref|ZP_02790269.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4501]
 gi|168771444|ref|ZP_02796451.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4486]
 gi|168778065|ref|ZP_02803072.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4196]
 gi|168780898|ref|ZP_02805905.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4076]
 gi|168786837|ref|ZP_02811844.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC869]
 gi|168802900|ref|ZP_02827907.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC508]
 gi|170682429|ref|YP_001746361.1| biotin--protein ligase [Escherichia coli SMS-3-5]
 gi|208806288|ref|ZP_03248625.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4206]
 gi|208812148|ref|ZP_03253477.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4045]
 gi|208819796|ref|ZP_03260116.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4042]
 gi|209399876|ref|YP_002273493.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4115]
 gi|217326609|ref|ZP_03442693.1| bifunctional protein BirA [Escherichia coli O157:H7 str. TW14588]
 gi|218707596|ref|YP_002415115.1| biotin--protein ligase [Escherichia coli UMN026]
 gi|254795976|ref|YP_003080813.1| biotin--protein ligase [Escherichia coli O157:H7 str. TW14359]
 gi|261227311|ref|ZP_05941592.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257058|ref|ZP_05949591.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285391|ref|YP_003502209.1| Bifunctional protein BirA [Escherichia coli O55:H7 str. CB9615]
 gi|293407591|ref|ZP_06651509.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1412]
 gi|298383339|ref|ZP_06992931.1| biotin-protein ligase/Biotin operon repressor [Escherichia coli
           FVEC1302]
 gi|300897863|ref|ZP_07116247.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli MS 198-1]
 gi|309783928|ref|ZP_07678573.1| bifunctional protein birA [Shigella dysenteriae 1617]
 gi|331665629|ref|ZP_08366525.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli TA143]
 gi|331685716|ref|ZP_08386298.1| biotin-[acetyl-CoA-carboxylase] ligase [Escherichia coli H299]
 gi|12518899|gb|AAG59173.1|AE005629_2 biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Escherichia coli O157:H7 str. EDL933]
 gi|13364376|dbj|BAB38323.1| bifunctional protein BirA biotin-[acetylCoA carboxylase] holoenzyme
           synthetase / biotin operon repressor [Escherichia coli
           O157:H7 str. Sakai]
 gi|81242996|gb|ABB63706.1| biotin-[acetylCoA carboxylase] holoenzyme synthetase and biotin
           operon repressor [Shigella dysenteriae Sd197]
 gi|170520147|gb|ACB18325.1| bifunctional protein BirA [Escherichia coli SMS-3-5]
 gi|187766853|gb|EDU30697.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4196]
 gi|188013588|gb|EDU51710.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4113]
 gi|189001543|gb|EDU70529.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4076]
 gi|189354243|gb|EDU72662.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4401]
 gi|189359776|gb|EDU78195.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4486]
 gi|189364934|gb|EDU83350.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4501]
 gi|189373399|gb|EDU91815.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC869]
 gi|189375264|gb|EDU93680.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC508]
 gi|208726089|gb|EDZ75690.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4206]
 gi|208733425|gb|EDZ82112.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4045]
 gi|208739919|gb|EDZ87601.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4042]
 gi|209161276|gb|ACI38709.1| bifunctional protein BirA [Escherichia coli O157:H7 str. EC4115]
 gi|209751898|gb|ACI74256.1| pantothenate kinase [Escherichia coli]
 gi|209751900|gb|ACI74257.1| pantothenate kinase [Escherichia coli]
 gi|209751902|gb|ACI74258.1| pantothenate kinase [Escherichia coli]
 gi|209751904|gb|ACI74259.1| pantothenate kinase [Escherichia coli]
 gi|209751906|gb|ACI74260.1| pantothenate kinase [Escherichia coli]
 gi|217322830|gb|EEC31254.1| bifunctional protein BirA [Escherichia coli O157:H7 str. TW14588]
 gi|218434693|emb|CAR15625.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           and DNA-binding transcriptional repressor,
           bio-5'-AMP-binding [Escherichia coli UMN026]
 gi|254595376|gb|ACT74737.1| bifunctional biotin-[acetylCoA carboxylase] holoenzyme synthetase
           [Escherichia coli O157:H7 str. TW14359]
 gi|284924070|emb|CBG37169.1| bifunctional protein [includes: biotin operon repressor;
           biotin-[acetyl-CoA-carboxylase] synthetase] [Escherichia
           coli 042]
 gi|290765264|gb|ADD59225.1| Bifunctional protein BirA [Escherichia coli O55:H7 str. CB9615]
 gi|291425359|gb|EFE98399.1| biotin-protein ligase/Biotin operon repress